{ "uniprot_canonical_ac": "A0A0G2JW33-1", "uniprot_ac": "A0A0G2JW33", "uniprot_id": "A0A0G2JW33_RAT", "mass": { "chemical_mass": 27684.0, "monoisotopic_mass": 27684.0 }, "refseq": { "ac": "NP_001166857", "name": "C-type lectin domain family 7 member A", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001166857" }, "gene_names": [ { "name": "Clec7a", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33", "id": "A0A0G2JW33" }, { "name": "Clec7a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001166857", "id": "NP_001166857" }, { "name": "Clec7b; RGD1565140", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001166857", "id": "NP_001166857" } ], "protein_names": [ { "name": "C-type lectin domain containing 7A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2JW33" }, { "name": "C-type lectin domain family 7 member A isoform X2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006237162", "id": "XP_006237162" }, { "name": "C-type lectin domain family 7 member A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001166857", "id": "NP_001166857" }, { "name": "dectin-1; C-type lectin domain family 7, member A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001166857", "id": "NP_001166857" } ], "function": [ { "annotation": "Dectin-1 binds fungal beta-glucan and activates innate immune signaling and also plays essential roles in immune responses against fungi.", "evidence": [ { "database": "RefSeq", "id": "NP_001166857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001166857" }, { "database": "PubMed", "id": "18667041", "url": "https://glygen.org/publication/PubMed/18667041" } ] }, { "annotation": "Dectin1 activation of beta-(1-3)/(1-6)-D-glucan produces an anti-mastitis effect in rats", "evidence": [ { "database": "RefSeq", "id": "NP_001166857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001166857" }, { "database": "PubMed", "id": "21691936", "url": "https://glygen.org/publication/PubMed/21691936" } ] }, { "annotation": "Role of CARD9 in inflammatory signal pathway of peritoneal macrophages in severe acute pancreatitis.", "evidence": [ { "database": "RefSeq", "id": "NP_001166857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001166857" }, { "database": "PubMed", "id": "32790017", "url": "https://glygen.org/publication/PubMed/32790017" } ] }, { "annotation": "Syk is critical for Dectin-1-mediated activation of mast cells, although the signaling differs from that triggered by FcRI activation", "evidence": [ { "database": "RefSeq", "id": "NP_001166857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001166857" }, { "database": "PubMed", "id": "25246527", "url": "https://glygen.org/publication/PubMed/25246527" } ] } ], "disease": [ { "disease_id": "DOID:13564", "recommended_name": { "id": "DOID:13564", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13564", "name": "aspergillosis", "description": "An opportunistic mycosis that involves a spectrum of diseases of humans and animals caused by members of the genus Aspergillus infecting lungs, brain, kidney, heart, bone, eyes, sinuses, skin and gastrointestinal tract. It is a serious illnesses in people with a weakened immune system." }, "synonyms": [ { "id": "DOID:13564", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13564", "name": "Infection due to Aspergillus", "description": "" } ], "evidence": [ { "id": "13564", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:13564" } ] }, { "disease_id": "DOID:2058", "recommended_name": { "id": "DOID:2058", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2058", "name": "chronic mucocutaneous candidiasis", "description": "A candidiasis that refers to a heterogeneous group of disorders characterized by recurrent or persistent superficial fungal infections located_in skin, located_in mucous membrane, or located_in nail due to T-cell defects, has-agent Candida species and has_symptom scaling of skin lesions, has_symptom thickening of nails, has_symptom swollen periungal tissue, and has_symptom scarring of the scalp." }, "synonyms": [ { "id": "MONDO:0011880", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011880", "name": "candidiasis, familial, 3", "description": "" }, { "id": "MONDO:0011880", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011880", "name": "CANDF3", "description": "" }, { "id": "MONDO:0011880", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011880", "name": "candidiasis, familial, 3", "description": "" }, { "id": "MONDO:0011880", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011880", "name": "Fcnc", "description": "" }, { "id": "MONDO:0011880", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011880", "name": "candidiasis, familial chronic nail, with Icam1 deficiency", "description": "" }, { "id": "MONDO:0007257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007257", "name": "candidiasis, familial, 1", "description": "" }, { "id": "MONDO:0007257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007257", "name": "CANDF1", "description": "" }, { "id": "MONDO:0007257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007257", "name": "candidiasis, familial, 1", "description": "" }, { "id": "MONDO:0007257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007257", "name": "candidiasis, familial, 1, autosomal dominant", "description": "" }, { "id": "MONDO:0007257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007257", "name": "Cmct", "description": "" }, { "id": "MONDO:0007257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007257", "name": "candidiasis, familial chronic mucocutaneous, autosomal dominant, with or without thyroid disease", "description": "" }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "candidiasis, familial, 8", "description": "Any chronic mucocutaneous candidiasis in which the cause of the disease is a mutation in the TRAF3IP2 gene." }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "TRAF3IP2 chronic mucocutaneous candidiasis (disease)", "description": "" }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "candidiasis, familial, 8", "description": "" }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "candidiasis, familial, type 8", "description": "" }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "chronic mucocutaneous candidiasis (disease) caused by mutation in TRAF3IP2", "description": "" }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "CANDF8", "description": "" }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "candidiasis, familial chronic mucocutaneous, autosomal recessive", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "candidiasis, familial, 4", "description": "Any familial chronic mucocutaneous candidiasis in which the cause of the disease is a mutation in the CLEC7A gene." }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "CLEC7A familial chronic mucocutaneous candidiasis", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "candidiasis, familial, 4", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "candidiasis, familial, 4, autosomal recessive", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "candidiasis, familial, type 4", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "familial chronic mucocutaneous candidiasis caused by mutation in CLEC7A", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "CANDF4", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "candidiasis, familial chronic mucocutaneous", "description": "" }, { "id": "MONDO:0014642", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014642", "name": "candidiasis, familial, 9", "description": "Any chronic mucocutaneous candidiasis in which the cause of the disease is a mutation in the IL17RC gene." }, { "id": "MONDO:0014642", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014642", "name": "IL17RC chronic mucocutaneous candidiasis (disease)", "description": "" }, { "id": "MONDO:0014642", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014642", "name": "candidiasis, familial, 9", "description": "" }, { "id": "MONDO:0014642", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014642", "name": "candidiasis, familial, type 9", "description": "" }, { "id": "MONDO:0014642", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014642", "name": "chronic mucocutaneous candidiasis (disease) caused by mutation in IL17RC", "description": "" }, { "id": "MONDO:0014642", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014642", "name": "CANDF9", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "predisposition to invasive fungal disease due to CARD9 deficiency", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "candidiasis, familial, 2, autosomal recessive", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "candidiasis, familial, type 2", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "invasive candidiasis-deep dermatophytosis syndrome", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "CANDF2", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "CARD9 deficiency", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "CARD9 immunodeficiency", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "candidiasis familial chronic mucocutaneous, autosomal recessive", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "candidiasis, familial chronic mucocutaneous, autosomal recessive", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "candidiasis, familial, 2", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "candidiasis, familial, 6", "description": "Any familial chronic mucocutaneous candidiasis in which the cause of the disease is a mutation in the IL17F gene." }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "IL17F familial chronic mucocutaneous candidiasis", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "candidiasis, familial, 6", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "candidiasis, familial, 6, autosomal dominant", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "candidiasis, familial, type 6", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "familial chronic mucocutaneous candidiasis caused by mutation in IL17F", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "CANDF6", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "candidiasis, familial chronic mucocutaneous, autosomal dominant", "description": "" }, { "id": "MIM:615527", "resource": "MIM", "url": "https://www.omim.org/entry/615527", "name": "Candidiasis, familial, 8", "description": "Candidiasis, familial, 8" }, { "id": "MIM:613108", "resource": "MIM", "url": "https://www.omim.org/entry/613108", "name": "Candidiasis, familial, 4", "description": "Candidiasis, familial, 4" }, { "id": "MIM:616445", "resource": "MIM", "url": "https://www.omim.org/entry/616445", "name": "Candidiasis, familial, 9", "description": "Candidiasis, familial, 9" }, { "id": "MIM:212050", "resource": "MIM", "url": "https://www.omim.org/entry/212050", "name": "Immunodeficiency 103, susceptibility to fungal infections", "description": "Immunodeficiency 103, susceptibility to fungal infections" }, { "id": "MIM:613956", "resource": "MIM", "url": "https://www.omim.org/entry/613956", "name": "Candidiasis, familial, 6", "description": "Candidiasis, familial, 6" } ], "evidence": [ { "id": "2058", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2058" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "common_name": "Rat" } ], "gene": [ { "name": "Clec7a", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33", "locus": { "chromosome": "4", "start_pos": 162902732, "end_pos": 162913897, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000054251", "url": "https://www.ensembl.org/id/ENSRNOG00000054251" } ] } } ], "crossref": [ { "id": "ENSRNOG00000054251", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000054251", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03593", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03593", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "502902", "url": "https://www.ncbi.nlm.nih.gov/gene/502902", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001304", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001304", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016186", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016186", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016187", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016187", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042808", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042808", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:502902", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:502902", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NWIIHEK", "url": "https://omabrowser.org/oma/group/NWIIHEK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3831534at2759", "url": "http://www.orthodb.org/?query=3831534at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47218", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47218", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47218:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47218:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00059", "url": "http://pfam.xfam.org/family/PF00059", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5607764", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "1565140", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1565140", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JW33-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B5BUZ1", "url": "https://www.uniprot.org/uniprot/B5BUZ1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B5BUZ1-1", "url": "https://www.uniprot.org/uniprot/B5BUZ1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B5BUZ2", "url": "https://www.uniprot.org/uniprot/B5BUZ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B5BUZ2-1", "url": "https://www.uniprot.org/uniprot/B5BUZ2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "VEYHSQIENMDEDGYTQLDFGTRNIHKRPVKSEKGSPAPSSRWRSIAVALGILCLLTVVVAAVLGALGEYGFNSGRYPEEKDNFPSRNKENHKPTEPSLDEKVAPSKASQTTGVFSGPCLPNWIMHAKSCYLFSFSENSWYGSRRHCSQLGAHLLKIDNAKEFEFIESQTSSHRVNSFWIGLSRNQSEGPWFWEDGSAFTPNSFQVRNTAPQESLPHNCVWIHGSEVYNQMCIASSFTICEKELNV", "length": 246, "header": "tr|A0A0G2JW33-1|A0A0G2JW33_RAT Isoform 1 of C-type lectin domain containing 7A OS=Rattus norvegicus OX=10116 GN=Clec7a PE=4 SV=1 CANONICAL=A0A0G2JW33-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JW33-1", "url": "", "sequence": { "sequence": "VEYHSQIENMDEDGYTQLDFGTRNIHKRPVKSEKGSPAPSSRWRSIAVALGILCLLTVVVAAVLGALGEYGFNSGRYPEEKDNFPSRNKENHKPTEPSLDEKVAPSKASQTTGVFSGPCLPNWIMHAKSCYLFSFSENSWYGSRRHCSQLGAHLLKIDNAKEFEFIESQTSSHRVNSFWIGLSRNQSEGPWFWEDGSAFTPNSFQVRNTAPQESLPHNCVWIHGSEVYNQMCIASSFTICEKELNV", "length": 246, "header": "tr|A0A0G2JW33-1|A0A0G2JW33_RAT Isoform 1 of C-type lectin domain containing 7A OS=Rattus norvegicus OX=10116 GN=Clec7a PE=4 SV=1 CANONICAL=A0A0G2JW33-1" }, "locus": { "chromosome": "4", "start_pos": 162913764, "end_pos": 162904376, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000077793.2", "url": "https://www.ensembl.org/id/ENSRNOT00000077793.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000069723.2", "url": "https://www.ensembl.org/id/ENSRNOP00000069723.2" } ] } }, { "isoform_ac": "B5BUZ1-1", "url": "", "sequence": { "sequence": "MDEDGYTQLDFGTRNIHKRPVKSEKGSPAPSSRWRSIAVALGILCLLTVVVAAVLGALAFRRFNSGRYPEEKDNFPSRNKENHKPTEPSLDEKVAPSKASQTTGVFSGPCLPNWIMHAKSCYLFSFSENSWYGSRRHCSQLGAHLLKIDNAKEFEFIESQTSSHRVNSFWIGLSRNQSEGPWFWEDGSAFTPNSFQVRNTAPQESLPHNCVWIHGSEVYNQMCIASSFTICEKEL", "length": 235, "header": "tr|B5BUZ1-1|B5BUZ1_RAT Computationally mapped isoform of Dectin-1 OS=Rattus norvegicus OX=10116 GN=Clec7a PE=2 SV=1 CANONICAL=A0A0G2JW33-1" }, "locus": { "chromosome": "4", "start_pos": 162913737, "end_pos": 162904385, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000091552.2", "url": "https://www.ensembl.org/id/ENSRNOT00000091552.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000073639.1", "url": "https://www.ensembl.org/id/ENSRNOP00000073639.1" } ] } }, { "isoform_ac": "B5BUZ2-1", "url": "", "sequence": { "sequence": "MDEDGYTQLDFGTRNIHKRPVKSEKGSPAPSSRWRSIAVALGILCLLTVVVAAVLGALGVFSGPCLPNWIMHAKSCYLFSFSENSWYGSRRHCSQLGAHLLKIDNAKEFEFIESQTSSHRVNSFWIGLSRNQSEGPWFWEDGSAFTPNSFQVRNTAPQESLPHNCVWIHGSEVYNQMCIASSFTICEKEL", "length": 190, "header": "tr|B5BUZ2-1|B5BUZ2_RAT Computationally mapped isoform of C-type lectin domain family 7 member A transcript variant 2 OS=Rattus norvegicus OX=10116 GN=Clec7a PE=2 SV=1 CANONICAL=A0A0G2JW33-1" }, "locus": { "chromosome": "4", "start_pos": 162913737, "end_pos": 162904385, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000108367.1", "url": "https://www.ensembl.org/id/ENSRNOT00000108367.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000087024.1", "url": "https://www.ensembl.org/id/ENSRNOP00000087024.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of rat beta-glucan receptor dectin-1.", "journal": "Microbiol. Immunol.", "date": "2008", "authors": "Kato Y, Adachi Y, Ohno N", "evidence": [ { "database": "UniProtKB", "id": "B5BUZ1", "url": "https://www.uniprot.org/uniprot/B5BUZ1" }, { "database": "RefSeq", "id": "NP_001166857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001166857" } ], "reference": [ { "type": "PubMed", "id": "18667041", "url": "https://glygen.org/publication/PubMed/18667041" } ] }, { "title": "Dectin1 activation of beta-(1-3)/(1-6)-D-glucan produces an anti-mastitis effect in rats.", "journal": "Inflammation research : official journal of the European Histamine Research Society ... [et al.]", "date": "2011", "authors": "Zhu W, Gu B, Miao J, Lu J, Zou S", "evidence": [ { "database": "RefSeq", "id": "NP_001166857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001166857" } ], "reference": [ { "type": "PubMed", "id": "21691936", "url": "https://glygen.org/publication/PubMed/21691936" } ] }, { "title": "Dectin-1-mediated signaling leads to characteristic gene expressions and cytokine secretion via spleen tyrosine kinase (Syk) in rat mast cells.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Kimura Y, Chihara K, Honjoh C, Takeuchi K, Yamauchi S, Yoshiki H, Fujieda S, Sada K", "evidence": [ { "database": "RefSeq", "id": "NP_001166857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001166857" } ], "reference": [ { "type": "PubMed", "id": "25246527", "url": "https://glygen.org/publication/PubMed/25246527" } ] }, { "title": "Role of CARD9 in inflammatory signal pathway of peritoneal macrophages in severe acute pancreatitis.", "journal": "Journal of cellular and molecular medicine", "date": "2020", "authors": "Wang J, Tian J, He YH, Yang ZW, Wang L, Lai YX, Xu P", "evidence": [ { "database": "RefSeq", "id": "NP_001166857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001166857" } ], "reference": [ { "type": "PubMed", "id": "32790017", "url": "https://glygen.org/publication/PubMed/32790017" } ] } ], "pathway": [ { "id": "rno:502902", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:502902", "resource": "KEGG Pathway" }, { "id": "R-RNO-5607764", "name": "CLEC7A (Dectin-1) signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5607764", "resource": "Reactome", "description": "CLEC7A (Dectin-1) signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6QLQ4-1", "protein_name": "C-type lectin domain family 7 member A", "gene_name": "Clec7a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKYHSHIENLDEDGYTQLDFSTQDIHKRPRGSEKGSQAPSSPWRPIAVGLGILCFVVVVVAAVLGALGEYGHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKEL", "length": 244 }, "evidence": [ { "id": "45240850", "url": "http://www.informatics.jax.org/homology/45240850", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BXN2-1", "protein_name": "C-type lectin domain family 7 member A", "gene_name": "CLEC7A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM", "length": 247 }, "evidence": [ { "id": "45240850", "url": "http://www.informatics.jax.org/homology/45240850", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "polysaccharide binding", "id": "GO:0030247", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030247", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "carbohydrate binding", "id": "GO:0030246", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030246", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "(1->3)-beta-D-glucan binding", "id": "GO:0001872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001872", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "pattern recognition receptor activity", "id": "GO:0038187", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038187", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "opsonin binding", "id": "GO:0001846", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001846", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "(1->3)-beta-D-glucan immune receptor activity", "id": "GO:0001874", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001874", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 34, "go_terms": [ { "name": "positive regulation of killing of cells of another organism", "id": "GO:0051712", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051712", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "detection of fungus", "id": "GO:0016046", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016046", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "response to yeast", "id": "GO:0001878", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001878", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "phagocytosis, engulfment", "id": "GO:0006911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006911", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of superoxide anion generation", "id": "GO:0032930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032930", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0043280", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043280", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of nitric oxide biosynthetic process", "id": "GO:0045429", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045429", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of interleukin-6 production", "id": "GO:0032755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032755", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "cell-cell adhesion", "id": "GO:0098609", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098609", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of protein-containing complex assembly", "id": "GO:0031334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031334", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of wound healing", "id": "GO:0090303", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090303", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of phagocytosis", "id": "GO:0050766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050766", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of type II interferon production", "id": "GO:0032729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032729", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of interleukin-8 production", "id": "GO:0032757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032757", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "phagocytosis, recognition", "id": "GO:0006910", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006910", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of monocyte chemotactic protein-1 production", "id": "GO:0071639", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071639", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of interleukin-1 beta production", "id": "GO:0032731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032731", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of interleukin-2 production", "id": "GO:0032743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032743", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of interleukin-10 production", "id": "GO:0032733", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032733", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "response to molecule of fungal origin", "id": "GO:0002238", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002238", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "cell recognition", "id": "GO:0008037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008037", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "cellular response to molecule of fungal origin", "id": "GO:0071226", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071226", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of cytokine production involved in inflammatory response", "id": "GO:1900017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900017", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of interleukin-12 production", "id": "GO:0032735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032735", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "detection of yeast", "id": "GO:0001879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001879", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "cell surface pattern recognition receptor signaling pathway", "id": "GO:0002752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002752", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of respiratory burst", "id": "GO:0060267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060267", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of lymphocyte activation", "id": "GO:0051251", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051251", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "positive regulation of cell maturation", "id": "GO:1903431", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903431", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "detection of molecule of fungal origin", "id": "GO:0032491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032491", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JW33", "url": "https://www.uniprot.org/uniprot/A0A0G2JW33" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 185, "end_pos": 187, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }