{ "uniprot_canonical_ac": "A0A0G2JVZ2-1", "uniprot_ac": "A0A0G2JVZ2", "uniprot_id": "A0A0G2JVZ2_RAT", "mass": { "chemical_mass": 30406.0, "monoisotopic_mass": 30406.0 }, "refseq": { "ac": "NP_001165596", "name": "T-cell leukemia homeobox protein 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001165596" }, "gene_names": [ { "name": "Tlx2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2", "id": "A0A0G2JVZ2" }, { "name": "Hox11L.1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001165596", "id": "NP_001165596" }, { "name": "Tlx2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001165596", "id": "NP_001165596" } ], "protein_names": [ { "name": "T-cell leukemia homeobox 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2JVZ2" }, { "name": "T-cell leukemia homeobox protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001165596", "id": "NP_001165596" } ], "function": [ { "annotation": "Despite the phenotypic similarities between fmc/fmc rats and Hox11L1-/- mice, fmc does not appear to be a mutant allele of the Hox11L1 gene", "evidence": [ { "database": "RefSeq", "id": "NP_001165596", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001165596" }, { "database": "PubMed", "id": "16291166", "url": "https://glygen.org/publication/PubMed/16291166" } ] } ], "disease": [ { "disease_id": "DOID:0080072", "recommended_name": { "id": "DOID:0080072", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080072", "name": "intestinal pseudo-obstruction", "description": "A colonic disease that is characterized by bowel obstruction resulting from impairment of the muscle contractions that move food through the digestive tract." }, "synonyms": [ { "id": "DOID:0080072", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080072", "name": "neuronal intestinal dysplasia", "description": "" }, { "id": "DOID:0080072", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080072", "name": "Chronic intestinal pseudo-obstruction", "description": "" } ], "evidence": [ { "id": "0080072", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080072" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "common_name": "Rat" } ], "gene": [ { "name": "Tlx2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2", "locus": { "chromosome": "4", "start_pos": 115573799, "end_pos": 115575642, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000055188", "url": "https://www.ensembl.org/id/ENSRNOG00000055188" } ] } } ], "crossref": [ { "id": "ENSRNOG00000055188", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000055188", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00086", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00086", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "680117", "url": "https://www.ncbi.nlm.nih.gov/gene/680117", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001356", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001356", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017970", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017970", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020479", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020479", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:680117", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:680117", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "QGHGEST", "url": "https://omabrowser.org/oma/group/QGHGEST/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "380905at2759", "url": "http://www.orthodb.org/?query=380905at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45921", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45921", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45921:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45921:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00046", "url": "http://pfam.xfam.org/family/PF00046", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001165596", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001165596", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1595506", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1595506", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JVZ2-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEPAVLAPHHLPHHEPISFGIDQILSGPEPPGGGLGPGQVGQSQGESAAFSSGFHGTSGYAPAGSLASLPRGSGVGPGGVIRVPAHRPVPVPPPSGAAPAVAGPSGLGGPGGLAGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV", "length": 284, "header": "tr|A0A0G2JVZ2-1|A0A0G2JVZ2_RAT Isoform 1 of T-cell leukemia homeobox 2 OS=Rattus norvegicus OX=10116 GN=Tlx2 PE=4 SV=1 CANONICAL=A0A0G2JVZ2-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JVZ2-1", "url": "", "sequence": { "sequence": "MEPAVLAPHHLPHHEPISFGIDQILSGPEPPGGGLGPGQVGQSQGESAAFSSGFHGTSGYAPAGSLASLPRGSGVGPGGVIRVPAHRPVPVPPPSGAAPAVAGPSGLGGPGGLAGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV", "length": 284, "header": "tr|A0A0G2JVZ2-1|A0A0G2JVZ2_RAT Isoform 1 of T-cell leukemia homeobox 2 OS=Rattus norvegicus OX=10116 GN=Tlx2 PE=4 SV=1 CANONICAL=A0A0G2JVZ2-1" }, "locus": { "chromosome": "4", "start_pos": 115575428, "end_pos": 115574115, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000087788.2", "url": "https://www.ensembl.org/id/ENSRNOT00000087788.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000069677.1", "url": "https://www.ensembl.org/id/ENSRNOP00000069677.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Evaluation of Hox11L1 in the fmc/fmc rat model of chronic intestinal pseudo-obstruction.", "journal": "Journal of pediatric surgery", "date": "2005", "authors": "Parisi MA, Lipman NS, Clarke CM, Taylor B, Kapur RP", "evidence": [ { "database": "RefSeq", "id": "NP_001165596", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001165596" } ], "reference": [ { "type": "PubMed", "id": "16291166", "url": "https://glygen.org/publication/PubMed/16291166" } ] } ], "pathway": [ { "id": "rno:680117", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:680117", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O43763-1", "protein_name": "T-cell leukemia homeobox protein 2", "gene_name": "TLX2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEPGMLGPHNLPHHEPISFGIDQILSGPETPGGGLGLGRGGQGHGENGAFSGGYHGASGYGPAGSLAPLPGSSGVGPGGVIRVPAHRPLPVPPPAGGAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV", "length": 284 }, "evidence": [ { "id": "45224967", "url": "http://www.informatics.jax.org/homology/45224967", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q61663-1", "protein_name": "T-cell leukemia homeobox protein 2", "gene_name": "Tlx2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEPAVLAAHHLPHHEPISFGIDQILSGPEPPGGGLGPGQSGQSHGESAAFSSGFHGASGYAPAGSLASLPRGSGVGPGGVIRVPAHRPLPVPPPSGAAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV", "length": 284 }, "evidence": [ { "id": "45224967", "url": "http://www.informatics.jax.org/homology/45224967", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "enteric nervous system development", "id": "GO:0048484", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048484", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "pmid": "" }, { "name": "negative regulation of dendrite morphogenesis", "id": "GO:0050774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050774", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "pmid": "" }, { "name": "mesoderm formation", "id": "GO:0001707", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001707", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "pmid": "" }, { "name": "animal organ development", "id": "GO:0048513", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048513", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "pmid": "" }, { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JVZ2", "url": "https://www.uniprot.org/uniprot/A0A0G2JVZ2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 151, "end_pos": 153, "annotation": "n_glycosylation_sequon" }, { "start_pos": 256, "end_pos": 258, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }