{ "uniprot_canonical_ac": "A0A0C4DH27-1", "uniprot_ac": "A0A0C4DH27", "uniprot_id": "TRGV8_HUMAN", "mass": { "chemical_mass": 13335.0, "monoisotopic_mass": 13335.0 }, "refseq": {}, "gene_names": [ { "name": "TRGV8", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0C4DH27", "id": "A0A0C4DH27" }, { "name": "TCRGV8", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0C4DH27", "id": "A0A0C4DH27" } ], "protein_names": [ { "name": "T cell receptor gamma variable 8", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0C4DH27" } ], "function": [ { "annotation": "V region of the variable domain of T cell receptor (TR) gamma chain that participates in the antigen recognition (PubMed:24600447). Gamma-delta TRs recognize a variety of self and foreign non-peptide antigens frequently expressed at the epithelial boundaries between the host and external environment, including endogenous lipids presented by MH-like protein CD1D and phosphoantigens presented by butyrophilin-like molecule BTN3A1. Upon antigen recognition induces rapid, innate-like immune responses involved in pathogen clearance and tissue repair (PubMed:23348415, PubMed:28920588). Binding of gamma-delta TR complex to antigen triggers phosphorylation of immunoreceptor tyrosine-based activation motifs (ITAMs) in the CD3 chains by the LCK and FYN kinases, allowing the recruitment, phosphorylation, and activation of ZAP70 that facilitates phosphorylation of the scaffolding proteins LCP2 and LAT. This lead to the formation of a supramolecular signalosome that recruits the phospholipase PLCG1, resulting in calcium mobilization and ERK activation, ultimately leading to T cell expansion and differentiation into effector cells (PubMed:25674089). Gamma-delta TRs are produced through somatic rearrangement of a limited repertoire of variable (V), diversity (D), and joining (J) genes. The potential diversity of gamma-delta TRs is conferred by the unique ability to rearrange (D) genes in tandem and to utilize all three reading frames. The combinatorial diversity is considerably increased by the sequence exonuclease trimming and random nucleotide (N) region additions which occur during the V-(D)-J rearrangements (PubMed:24387714).", "evidence": [ { "database": "UniProtKB", "id": "A0A0C4DH27", "url": "https://www.uniprot.org/uniprot/A0A0C4DH27#function" }, { "database": "PubMed", "id": "25674089", "url": "https://glygen.org/publication/PubMed/25674089" }, { "database": "PubMed", "id": "28920588", "url": "https://glygen.org/publication/PubMed/28920588" }, { "database": "PubMed", "id": "24387714", "url": "https://glygen.org/publication/PubMed/24387714" }, { "database": "PubMed", "id": "23348415", "url": "https://glygen.org/publication/PubMed/23348415" }, { "database": "PubMed", "id": "24600447", "url": "https://glygen.org/publication/PubMed/24600447" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "32.83", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000211696", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211696" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "68.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211696", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211696" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "52.97", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000211696", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211696" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "64.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211696", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211696" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "25.05", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000211696", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211696" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "36.93", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000211696", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211696" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "27.16", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000211696", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211696" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "60.75", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000211696", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211696" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "55.28", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000211696", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211696" } ] } ], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A0C4DH27", "url": "https://www.uniprot.org/uniprot/A0A0C4DH27" } ], "common_name": "Human" } ], "gene": [ { "name": "TRGV8", "url": "https://www.uniprot.org/uniprot/A0A0C4DH27", "locus": { "chromosome": "7", "start_pos": 38330343, "end_pos": 38330935, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000211696", "url": "https://www.ensembl.org/id/ENSG00000211696" } ] } } ], "crossref": [ { "id": "ENSG00000211696", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211696", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "TRGV8", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TRGV8", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "12294", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12294", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_A0A0C4DH27", "url": "https://www.nextprot.org/entry/NX_A0A0C4DH27", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "ISREKYH", "url": "https://omabrowser.org/oma/group/ISREKYH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR19256", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19256", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19256:SF54", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19256:SF54", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "7LLI", "url": "https://www.rcsb.org/structure/7LLI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF07686", "url": "http://pfam.xfam.org/family/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A0C4DH27", "url": "http://purl.obolibrary.org/obo/PR_A0A0C4DH27", "database": "PRO", "categories": [ "Protein" ] }, { "id": "A0A0C4DH27", "url": "https://www.uniprot.org/uniprot/A0A0C4DH27", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0C4DH27-1", "url": "https://www.uniprot.org/uniprot/A0A0C4DH27-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLLALALLLAFLPPASQKSSNLEGRTKSVTRPTGSSAVITCDLPVENAVYTHWYLHQEGKAPQRLLYYDSYNSRVVLESGISREKYHTYASTGKSLKFILENLIERDSGVYYCATWDR", "length": 118, "header": "sp|A0A0C4DH27-1|TRGV8_HUMAN Isoform 1 of T cell receptor gamma variable 8 OS=Homo sapiens OX=9606 GN=TRGV8 PE=1 SV=1 CANONICAL=A0A0C4DH27-1" }, "isoforms": [ { "isoform_ac": "A0A0C4DH27-1", "url": "", "sequence": { "sequence": "MLLALALLLAFLPPASQKSSNLEGRTKSVTRPTGSSAVITCDLPVENAVYTHWYLHQEGKAPQRLLYYDSYNSRVVLESGISREKYHTYASTGKSLKFILENLIERDSGVYYCATWDR", "length": 118, "header": "sp|A0A0C4DH27-1|TRGV8_HUMAN Isoform 1 of T cell receptor gamma variable 8 OS=Homo sapiens OX=9606 GN=TRGV8 PE=1 SV=1 CANONICAL=A0A0C4DH27-1" }, "locus": { "chromosome": "7", "start_pos": 38330821, "end_pos": 38330343, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000390343.2", "url": "https://www.ensembl.org/id/ENST00000390343.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000374866.2", "url": "https://www.ensembl.org/id/ENSP00000374866.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "T cell receptor complex", "id": "GO:0042101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042101", "evidence": [ { "database": "UniProtKB", "id": "A0A0C4DH27", "url": "https://www.uniprot.org/uniprot/A0A0C4DH27" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "A0A0C4DH27", "url": "https://www.uniprot.org/uniprot/A0A0C4DH27" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "A0A0C4DH27", "url": "https://www.uniprot.org/uniprot/A0A0C4DH27" } ], "pmid": "" }, { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "A0A0C4DH27", "url": "https://www.uniprot.org/uniprot/A0A0C4DH27" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }