{ "uniprot_canonical_ac": "A0A0B4LF36-1", "uniprot_ac": "A0A0B4LF36", "uniprot_id": "A0A0B4LF36_DROME", "mass": { "chemical_mass": 8357.0, "monoisotopic_mass": 8357.0 }, "refseq": { "ac": "NP_001286270", "name": "cytochrome c oxidase subunit 7C-like", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001286270" }, "gene_names": [ { "name": "COX7CL", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0B4LF36", "id": "A0A0B4LF36" }, { "name": "CG44296; Dmel\\CG44296", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001286270", "id": "NP_001286270" }, { "name": "CG44296", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4LF36", "id": "A0A0B4LF36" }, { "name": "COX7CL", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001286270", "id": "NP_001286270" }, { "name": "Dmel\\CG44296", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4LF36", "id": "A0A0B4LF36" }, { "name": "Dmel_CG44296", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4LF36", "id": "A0A0B4LF36" } ], "protein_names": [ { "name": "CG44296-PA; COX7CL-PA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001286270", "id": "NP_001286270" }, { "name": "Uncharacterized protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0B4LF36" }, { "name": "cytochrome c oxidase subunit 7C-like", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001286270", "id": "NP_001286270" } ], "function": [], "disease": [ { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "A0A0B4LF36", "url": "https://www.uniprot.org/uniprot/A0A0B4LF36" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "COX7CL", "url": "https://www.uniprot.org/uniprot/A0A0B4LF36", "locus": { "chromosome": "2R", "start_pos": 10050874, "end_pos": 10050348, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0265342", "url": "https://www.ensembl.org/id/FBgn0265342" } ] } } ], "crossref": [ { "id": "FBgn0265342", "url": "https://bgee.org/?page=gene&gene_id=FBgn0265342", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0265342", "url": "https://flybase.org/reports/FBgn0265342", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "19835750", "url": "https://www.ncbi.nlm.nih.gov/gene/19835750", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR004202", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004202", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036636", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036636", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG44296", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG44296", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "RSCHHGY", "url": "https://omabrowser.org/oma/group/RSCHHGY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3121972at2759", "url": "http://www.orthodb.org/?query=3121972at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13313", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13313", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13313:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13313:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02935", "url": "http://pfam.xfam.org/family/PF02935", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001286270", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001286270", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0B4LF36", "url": "https://www.uniprot.org/uniprot/A0A0B4LF36", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0B4LF36-1", "url": "https://www.uniprot.org/uniprot/A0A0B4LF36-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MWPTLRKPIGKFSGPLMRYGSGYPGGSPGANLPFGLDSPMRFTLFYLIAGVVGFGAPFLVIRHQMLRNVTNDPKDE", "length": 76, "header": "tr|A0A0B4LF36-1|A0A0B4LF36_DROME Isoform 1 of Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=COX7CL PE=3 SV=1 CANONICAL=A0A0B4LF36-1" }, "isoforms": [ { "isoform_ac": "A0A0B4LF36-1", "url": "", "sequence": { "sequence": "MWPTLRKPIGKFSGPLMRYGSGYPGGSPGANLPFGLDSPMRFTLFYLIAGVVGFGAPFLVIRHQMLRNVTNDPKDE", "length": 76, "header": "tr|A0A0B4LF36-1|A0A0B4LF36_DROME Isoform 1 of Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=COX7CL PE=3 SV=1 CANONICAL=A0A0B4LF36-1" }, "locus": { "chromosome": "2R", "start_pos": 10050815, "end_pos": 10050471, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0339413", "url": "https://www.ensembl.org/id/FBtr0339413" }, { "database": "Ensembl Peptide", "id": "FBpp0308503", "url": "https://www.ensembl.org/id/FBpp0308503" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "dme:Dmel_CG44296", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG44296", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "mitochondrial electron transport, cytochrome c to oxygen", "id": "GO:0006123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006123", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4LF36", "url": "https://www.uniprot.org/uniprot/A0A0B4LF36" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrial respiratory chain complex IV", "id": "GO:0005751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005751", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4LF36", "url": "https://www.uniprot.org/uniprot/A0A0B4LF36" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 68, "end_pos": 70, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }