{ "uniprot_canonical_ac": "A0A0B4KF65-1", "uniprot_ac": "A0A0B4KF65", "uniprot_id": "A0A0B4KF65_DROME", "mass": { "chemical_mass": 44966.0, "monoisotopic_mass": 44966.0 }, "refseq": { "ac": "NP_001246906", "name": "uncharacterized protein, isoform F", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001246906" }, "gene_names": [ { "name": "BcDNA:GH22993", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "Dmel\\CG31522", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "anon-WO0118547.381", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "BcDNA:GH22993", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "BcDNA:LD10305", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "CG31522-RA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "CG31522", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262254", "id": "NP_001262254" }, { "name": "CG31522", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "CG9798", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "Dmel\\CG31522", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "Dmel_CG31522", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "anon-WO0118547.381; BcDNA:GH22993; BcDNA:LD10305; CG9798; Dmel\\CG31522", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262254", "id": "NP_001262254" }, { "name": "anon-WO0118547.381", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" } ], "protein_names": [ { "name": "Elongation of very long chain fatty acids protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0B4KF65" }, { "name": "2.3.1.199", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0B4KF65" }, { "name": "CG31522-PF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001246906", "id": "NP_001246906" }, { "name": "CG31522-PH", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001246905", "id": "NP_001246905" }, { "name": "CG31522-PI", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262254", "id": "NP_001262254" }, { "name": "Very-long-chain 3-oxoacyl-CoA synthase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0B4KF65" }, { "name": "uncharacterized protein, isoform F", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001246906", "id": "NP_001246906" }, { "name": "uncharacterized protein, isoform H", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001246905", "id": "NP_001246905" }, { "name": "uncharacterized protein, isoform I", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262254", "id": "NP_001262254" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "BcDNA:GH22993", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "locus": { "chromosome": "3R", "start_pos": 4441415, "end_pos": 4462883, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0051522", "url": "https://www.ensembl.org/id/FBgn0051522" } ] } } ], "crossref": [ { "id": "FBgn0051522", "url": "https://bgee.org/?page=gene&gene_id=FBgn0051522", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0051522", "url": "https://flybase.org/reports/FBgn0051522", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "40567", "url": "https://www.ncbi.nlm.nih.gov/gene/40567", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q8IPL8", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8IPL8*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002076", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002076", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG31522", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG31522", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HAMVNSM", "url": "https://omabrowser.org/oma/group/HAMVNSM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "168669at2759", "url": "http://www.orthodb.org/?query=168669at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11157", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11157:SF167", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157:SF167", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01151", "url": "http://pfam.xfam.org/family/PF01151", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-DME-2046105", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2046105", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2046106", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-75876", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001262254", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262254", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "32727", "url": "https://www.rhea-db.org/rhea/32727", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0B4KF65-1", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8IPL8", "url": "https://www.uniprot.org/uniprot/Q8IPL8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8IPL8-1", "url": "https://www.uniprot.org/uniprot/Q8IPL8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VN29", "url": "https://www.uniprot.org/uniprot/Q9VN29", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VN29-1", "url": "https://www.uniprot.org/uniprot/Q9VN29-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALIMKYIDSISRYMDSHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHSTFFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYPKAFVWWIGMHAVMFFFLFNEFYKAAYRSRMMKKNGALANGHAKPNGYCKSINAHDDLAMPQTTEATATATPASKANGSSTPPSNGHANGVENVYKQVANGSAHKGSNGGLSNGYATKLLDDASQELKQRKTPK", "length": 392, "header": "tr|A0A0B4KF65-1|A0A0B4KF65_DROME Isoform 1 of Elongation of very long chain fatty acids protein OS=Drosophila melanogaster OX=7227 GN=BcDNA:GH22993 PE=1 SV=1 CANONICAL=A0A0B4KF65-1" }, "isoforms": [ { "isoform_ac": "A0A0B4KF65-1", "url": "", "sequence": { "sequence": "MALIMKYIDSISRYMDSHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHSTFFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYPKAFVWWIGMHAVMFFFLFNEFYKAAYRSRMMKKNGALANGHAKPNGYCKSINAHDDLAMPQTTEATATATPASKANGSSTPPSNGHANGVENVYKQVANGSAHKGSNGGLSNGYATKLLDDASQELKQRKTPK", "length": 392, "header": "tr|A0A0B4KF65-1|A0A0B4KF65_DROME Isoform 1 of Elongation of very long chain fatty acids protein OS=Drosophila melanogaster OX=7227 GN=BcDNA:GH22993 PE=1 SV=1 CANONICAL=A0A0B4KF65-1" }, "locus": { "chromosome": "3R", "start_pos": 4447758, "end_pos": 4442750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0335432", "url": "https://www.ensembl.org/id/FBtr0335432" }, { "database": "Ensembl Peptide", "id": "FBpp0307413", "url": "https://www.ensembl.org/id/FBpp0307413" } ] } }, { "isoform_ac": "Q8IPL8-1", "url": "", "sequence": { "sequence": "MALIMKYIDSISRYMDSHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFYEIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHSTFFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYPKAFVWWIGMHAVMFFFLFNEFYKAAYRSRMMKKNGALANGHAKPNGYCKSINAHDDLAMPQTTEATATATPASKANGSSTPPSNGHANGVENVYKQVANGSAHKGSNGGLSNGYATKLLDDASQELKQRKTPK", "length": 365, "header": "tr|Q8IPL8-1|Q8IPL8_DROME Computationally mapped isoform of Elongation of very long chain fatty acids protein OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.381 PE=1 SV=2 CANONICAL=A0A0B4KF65-1" }, "locus": { "chromosome": "3R", "start_pos": 4447758, "end_pos": 4442750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0078939", "url": "https://www.ensembl.org/id/FBtr0078939" }, { "database": "Ensembl Peptide", "id": "FBpp0078579", "url": "https://www.ensembl.org/id/FBpp0078579" } ] } }, { "isoform_ac": "Q9VN29-1", "url": "", "sequence": { "sequence": "MALIMKYIDSISRYMDSHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHSTFFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYPKAFVWWIGMHAVMFFFLFNEFYKAAYRSRMMKKNGALANGHAKPNGYCKSINAHDDLAMPQTTEATATATPASKANGSSTPPSNGHANGVENVYKQVANGSAHKGSNGGLSNGYATKLLDDASQELKQRKTPK", "length": 364, "header": "tr|Q9VN29-1|A0A0B4KF65_DROME Computationally mapped isoform of Elongation of very long chain fatty acids protein OS=Drosophila melanogaster OX=7227 GN=BcDNA:GH22993 PE=1 SV=3 CANONICAL=A0A0B4KF65-1" }, "locus": { "chromosome": "3R", "start_pos": 4447758, "end_pos": 4442750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0078942", "url": "https://www.ensembl.org/id/FBtr0078942" }, { "database": "Ensembl Peptide", "id": "FBpp0078582", "url": "https://www.ensembl.org/id/FBpp0078582" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "dme:Dmel_CG31522", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG31522", "resource": "KEGG Pathway" }, { "id": "R-DME-2046105", "name": "Linoleic acid (LA) metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2046105", "resource": "Reactome", "description": "Linoleic acid (LA) metabolism" }, { "id": "R-DME-2046106", "name": "alpha-linolenic acid (ALA) metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2046106", "resource": "Reactome", "description": "alpha-linolenic acid (ALA) metabolism" }, { "id": "R-DME-75876", "name": "Synthesis of very long-chain fatty acyl-CoAs", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-75876", "resource": "Reactome", "description": "Synthesis of very long-chain fatty acyl-CoAs" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "sphingolipid biosynthetic process", "id": "GO:0030148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030148", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" }, { "name": "fatty acid elongation", "id": "GO:0030497", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030497", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" }, { "name": "fatty acid elongation, monounsaturated fatty acid", "id": "GO:0034625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034625", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" }, { "name": "fatty acid elongation, polyunsaturated fatty acid", "id": "GO:0034626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034626", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" }, { "name": "fatty acid elongation, saturated fatty acid", "id": "GO:0019367", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019367", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" }, { "name": "very long-chain fatty acid biosynthetic process", "id": "GO:0042761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042761", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "fatty acid elongase activity", "id": "GO:0009922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009922", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 335, "end_pos": 337, "annotation": "n_glycosylation_sequon" }, { "start_pos": 358, "end_pos": 360, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "32727", "name": "", "equation": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4A612-1", "D4ADY9-1", "Q920L7-1", "Q920L6-1", "A0A1B0GWP1-1", "D3ZPX9-1", "D4ACH5-1", "A1L3X0-1", "Q9H5J4-1", "Q9GZR5-1", "Q9NYP7-1", "Q9HB03-1", "Q9NXB9-1", "Q9BW60-1", "Q920L5-1", "Q8BHI7-1", "O35949-1", "Q9EQC4-1", "Q9D2Y9-1", "Q9JLJ4-1", "Q9JLJ5-1", "P25358-1", "P39540-1", "P40319-1", "Q55BY4-1", "C7FZW5-1", "Q54TC9-1", "Q555E8-1", "Q86JM5-1", "Q7KWQ5-1", "Q54CJ4-1", "A8JNR0-1", "Q9VHX7-1", "A0A0B4KF65-1", "Q9VH58-1", "Q9VV87-1", "Q6NN18-1", "Q4V3H4-1", "A1ZBD2-1", "Q9VCY6-1", "Q5JZZ4-1", "Q9VH59-1", "Q9VCT3-1", "Q95T98-1", "Q9VCY5-1", "Q9VH57-1", "Q8SXD1-1", "Q8IMY2-1", "Q9VCY7-1", "Q9VCZ0-1", "Q9VH55-1" ], "evidence": [ { "id": "32727", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/32727" } ] }, { "id": "R-DME-2046088", "name": "Elongation of stearidonoyl-CoA to eicosatetraenoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-2046052", "R-ALL-2046066" ], "output_participant_list": [ "R-ALL-162743", "R-ALL-2046051" ], "enzyme_list": [ "Q9VCT3-1", "A0A0B4KF65-1", "Q8SXD1-1", "Q9VCY6-1", "Q9VH58-1", "Q9VV87-1", "Q9VH59-1", "A1ZBD2-1", "Q6NN18-1", "Q8IMY2-1", "Q9VCY7-1", "Q9VCZ0-1", "Q9VH55-1", "Q9VHX7-1", "Q4V3H4-1", "Q95T98-1", "Q9VCY5-1", "Q9VH57-1" ], "evidence": [ { "id": "R-DME-2046088", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2046088" } ] }, { "id": "R-DME-2046094", "name": "Elongation of gamma-lenolenoyl-CoA to dihomo-gamma-lenolenoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-2046042" ], "output_participant_list": [ "R-ALL-2046045" ], "enzyme_list": [ "Q9VCT3-1", "A0A0B4KF65-1", "Q8SXD1-1", "Q9VCY6-1", "Q9VH58-1", "Q9VV87-1", "Q9VH59-1", "A1ZBD2-1", "Q6NN18-1", "Q8IMY2-1", "Q9VCY7-1", "Q9VCZ0-1", "Q9VH55-1", "Q9VHX7-1", "Q4V3H4-1", "Q95T98-1", "Q9VCY5-1", "Q9VH57-1" ], "evidence": [ { "id": "R-DME-2046094", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2046094" } ] }, { "id": "R-DME-548800", "name": "ELOVL1,2,3,5 elongate AA-CoA and Mal-CoA to 3ODCT-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-548819" ], "output_participant_list": [ "R-ALL-548816" ], "enzyme_list": [ "Q9VCT3-1", "A0A0B4KF65-1", "Q8SXD1-1", "Q9VCY6-1", "Q9VH58-1", "Q9VV87-1", "Q9VH59-1", "A1ZBD2-1", "Q6NN18-1", "Q8IMY2-1", "Q9VCY7-1", "Q9VCZ0-1", "Q9VH55-1", "Q9VHX7-1", "Q4V3H4-1", "Q95T98-1", "Q9VCY5-1", "Q9VH57-1" ], "evidence": [ { "id": "R-DME-548800", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-548800" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-162743", "participant_name": "CoA-SH [endoplasmic reticulum lumen]", "crossref": [ { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" }, { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" }, { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" }, { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-2046042", "participant_name": "GLA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-2046045", "participant_name": "DGL-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "27979", "database": "ChEBI", "url": "" }, { "id": "C03595", "database": "COMPOUND", "url": "" }, { "id": "HMDB0003947", "database": "HMDB Metabolite", "url": "" }, { "id": "27979", "database": "ChEBI", "url": "" }, { "id": "C03595", "database": "COMPOUND", "url": "" }, { "id": "HMDB0003947", "database": "HMDB Metabolite", "url": "" }, { "id": "27979", "database": "ChEBI", "url": "" }, { "id": "C03595", "database": "COMPOUND", "url": "" }, { "id": "HMDB0003947", "database": "HMDB Metabolite", "url": "" }, { "id": "27979", "database": "ChEBI", "url": "" }, { "id": "HMDB0003947", "database": "HMDB Metabolite", "url": "" }, { "id": "C03595", "database": "COMPOUND", "url": "" }, { "id": "27979", "database": "ChEBI", "url": "" }, { "id": "C03595", "database": "COMPOUND", "url": "" }, { "id": "HMDB0003947", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-2046051", "participant_name": "ETA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "63542", "database": "ChEBI", "url": "" }, { "id": "63542", "database": "ChEBI", "url": "" }, { "id": "63542", "database": "ChEBI", "url": "" }, { "id": "63542", "database": "ChEBI", "url": "" }, { "id": "63542", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2046052", "participant_name": "SDA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2046066", "participant_name": "Malonyl-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "C00083", "database": "COMPOUND", "url": "" }, { "id": "000008551112", "database": "ZINC", "url": "" }, { "id": "57384", "database": "ChEBI", "url": "" }, { "id": "57384", "database": "ChEBI", "url": "" }, { "id": "000008551112", "database": "ZINC", "url": "" }, { "id": "C00083", "database": "COMPOUND", "url": "" }, { "id": "57384", "database": "ChEBI", "url": "" }, { "id": "000008551112", "database": "ZINC", "url": "" }, { "id": "C00083", "database": "COMPOUND", "url": "" }, { "id": "C00083", "database": "COMPOUND", "url": "" }, { "id": "57384", "database": "ChEBI", "url": "" }, { "id": "000008551112", "database": "ZINC", "url": "" }, { "id": "57384", "database": "ChEBI", "url": "" }, { "id": "C00083", "database": "COMPOUND", "url": "" }, { "id": "000008551112", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-548816", "participant_name": "3ODCT-CoA [cytosol]", "crossref": [ { "id": "63821", "database": "ChEBI", "url": "" }, { "id": "63821", "database": "ChEBI", "url": "" }, { "id": "63821", "database": "ChEBI", "url": "" }, { "id": "63821", "database": "ChEBI", "url": "" }, { "id": "63821", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-548819", "participant_name": "AA-CoA [cytosol]", "crossref": [ { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0B4KF65", "gene_name": "BcDNA:GH22993", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A0A0B4KF65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A0A0B4KF65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ] } ] }, { "uniprot_ac": "A0A1B0GWP1", "gene_name": "Elovl1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A0A1B0GWP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GWP1" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A0A1B0GWP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GWP1" } ] } ] }, { "uniprot_ac": "A1L3X0", "gene_name": "ELOVL7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A1L3X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A1L3X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ] } ] }, { "uniprot_ac": "A1ZBD2", "gene_name": "Dmel\\CG17821", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A1ZBD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBD2" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A1ZBD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBD2" } ] } ] }, { "uniprot_ac": "A8JNR0", "gene_name": "Elo68beta", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A8JNR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A8JNR0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A8JNR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A8JNR0" } ] } ] }, { "uniprot_ac": "C7FZW5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "C7FZW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "C7FZW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ] } ] }, { "uniprot_ac": "D3ZPX9", "gene_name": "Elovl3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D3ZPX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZPX9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D3ZPX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZPX9" } ] } ] }, { "uniprot_ac": "D4A612", "gene_name": "Elovl2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D4A612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A612" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D4A612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A612" } ] } ] }, { "uniprot_ac": "D4ACH5", "gene_name": "Elovl4", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D4ACH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACH5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D4ACH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACH5" } ] } ] }, { "uniprot_ac": "D4ADY9", "gene_name": "Elovl7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D4ADY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D4ADY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ] } ] }, { "uniprot_ac": "O35949", "gene_name": "Elovl3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "O35949", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35949" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "O35949", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35949" } ] } ] }, { "uniprot_ac": "P25358", "gene_name": "ELO2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "P25358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25358" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "P25358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25358" } ] } ] }, { "uniprot_ac": "P39540", "gene_name": "ELO1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "P39540", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39540" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "P39540", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39540" } ] } ] }, { "uniprot_ac": "P40319", "gene_name": "ELO3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "P40319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40319" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "P40319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40319" } ] } ] }, { "uniprot_ac": "Q4V3H4", "gene_name": "Dmel\\CG9459", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q4V3H4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V3H4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q4V3H4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V3H4" } ] } ] }, { "uniprot_ac": "Q54CJ4", "gene_name": "eloA", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q54CJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CJ4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q54CJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CJ4" } ] } ] }, { "uniprot_ac": "Q54TC9", "gene_name": "sre1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q54TC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q54TC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC9" } ] } ] }, { "uniprot_ac": "Q555E8", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q555E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555E8" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q555E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555E8" } ] } ] }, { "uniprot_ac": "Q55BY4", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q55BY4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BY4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q55BY4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BY4" } ] } ] }, { "uniprot_ac": "Q5JZZ4", "gene_name": "Elo68alpha", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q5JZZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JZZ4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q5JZZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JZZ4" } ] } ] }, { "uniprot_ac": "Q6NN18", "gene_name": "CT42569", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q6NN18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN18" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q6NN18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN18" } ] } ] }, { "uniprot_ac": "Q7KWQ5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q7KWQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KWQ5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q7KWQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KWQ5" } ] } ] }, { "uniprot_ac": "Q86JM5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q86JM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86JM5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q86JM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86JM5" } ] } ] }, { "uniprot_ac": "Q8BHI7", "gene_name": "Elovl5", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8BHI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BHI7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8BHI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BHI7" } ] } ] }, { "uniprot_ac": "Q8IMY2", "gene_name": "Dmel\\CG31141", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8IMY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IMY2" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8IMY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IMY2" } ] } ] }, { "uniprot_ac": "Q8SXD1", "gene_name": "CG12138", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8SXD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXD1" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8SXD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXD1" } ] } ] }, { "uniprot_ac": "Q920L5", "gene_name": "Elovl6", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q920L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q920L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L5" } ] } ] }, { "uniprot_ac": "Q920L6", "gene_name": "Elovl6", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q920L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L6" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q920L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L6" } ] } ] }, { "uniprot_ac": "Q920L7", "gene_name": "Elovl5", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q920L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q920L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L7" } ] } ] }, { "uniprot_ac": "Q95T98", "gene_name": "CG9798", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q95T98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95T98" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q95T98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95T98" } ] } ] }, { "uniprot_ac": "Q9BW60", "gene_name": "ELOVL1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9BW60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BW60" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9BW60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BW60" } ] } ] }, { "uniprot_ac": "Q9D2Y9", "gene_name": "Elovl7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9D2Y9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2Y9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9D2Y9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2Y9" } ] } ] }, { "uniprot_ac": "Q9EQC4", "gene_name": "Elovl4", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9EQC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQC4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9EQC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQC4" } ] } ] }, { "uniprot_ac": "Q9GZR5", "gene_name": "ELOVL4", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9GZR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GZR5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9GZR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GZR5" } ] } ] }, { "uniprot_ac": "Q9H5J4", "gene_name": "ELOVL6", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9H5J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H5J4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9H5J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H5J4" } ] } ] }, { "uniprot_ac": "Q9HB03", "gene_name": "ELOVL3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9HB03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HB03" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9HB03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HB03" } ] } ] }, { "uniprot_ac": "Q9JLJ4", "gene_name": "Elovl2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9JLJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9JLJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ4" } ] } ] }, { "uniprot_ac": "Q9JLJ5", "gene_name": "Elovl1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9JLJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9JLJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ5" } ] } ] }, { "uniprot_ac": "Q9NXB9", "gene_name": "ELOVL2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9NXB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NXB9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9NXB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NXB9" } ] } ] }, { "uniprot_ac": "Q9NYP7", "gene_name": "ELOVL5", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9NYP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYP7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9NYP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYP7" } ] } ] }, { "uniprot_ac": "Q9VCT3", "gene_name": "Dmel\\CG6660", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCT3" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCT3" } ] } ] }, { "uniprot_ac": "Q9VCY5", "gene_name": "CG13844", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY5" } ] } ] }, { "uniprot_ac": "Q9VCY6", "gene_name": "sit", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY6" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY6" } ] } ] }, { "uniprot_ac": "Q9VCY7", "gene_name": "bond", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY7" } ] } ] }, { "uniprot_ac": "Q9VCZ0", "gene_name": "Dmel\\CG5326", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCZ0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCZ0" } ] } ] }, { "uniprot_ac": "Q9VH55", "gene_name": "CT26802", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH55" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH55" } ] } ] }, { "uniprot_ac": "Q9VH57", "gene_name": "Dmel\\CG16904", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH57" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH57" } ] } ] }, { "uniprot_ac": "Q9VH58", "gene_name": "eloF", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH58" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH58" } ] } ] }, { "uniprot_ac": "Q9VH59", "gene_name": "Dmel\\CG8534", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH59", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH59" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH59", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH59" } ] } ] }, { "uniprot_ac": "Q9VHX7", "gene_name": "Elovl7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VHX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHX7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VHX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHX7" } ] } ] }, { "uniprot_ac": "Q9VV87", "gene_name": "Baldspot", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VV87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VV87" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VV87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VV87" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }