{ "uniprot_canonical_ac": "A0A0A6YWS7-1", "uniprot_ac": "A0A0A6YWS7", "uniprot_id": "A0A0A6YWS7_MOUSE", "mass": { "chemical_mass": 35997.0, "monoisotopic_mass": 35997.0 }, "refseq": { "ac": "NP_001030032", "name": "TD and POZ domain containing-like isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030032" }, "gene_names": [ { "name": "Tdpoz8", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0A6YWS7", "id": "A0A0A6YWS7" }, { "name": "EG229571; Gm4858", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030032", "id": "NP_001030032" }, { "name": "EG229571", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0A6YWS7", "id": "A0A0A6YWS7" }, { "name": "Gm4858", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0A6YWS7", "id": "A0A0A6YWS7" }, { "name": "Tdpoz8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030032", "id": "NP_001030032" } ], "protein_names": [ { "name": "TD and POZ domain containing 8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0A6YWS7" }, { "name": "TD and POZ domain containing-like isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030032", "id": "NP_001030032" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A0A6YWS7", "url": "https://www.uniprot.org/uniprot/A0A0A6YWS7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Tdpoz8", "url": "https://www.uniprot.org/uniprot/A0A0A6YWS7", "locus": { "chromosome": "3", "start_pos": 92982812, "end_pos": 92976130, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000096879", "url": "https://www.ensembl.org/id/ENSMUSG00000096879" } ] } } ], "crossref": [ { "id": "ENSMUSG00000096879", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000096879", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "229571", "url": "https://www.ncbi.nlm.nih.gov/gene/229571", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000210", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000210", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008974", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008974", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011333", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011333", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:229571", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:229571", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3645677", "url": "http://www.informatics.jax.org/marker/MGI:3645677", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "REECKGF", "url": "https://omabrowser.org/oma/group/REECKGF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "337109at2759", "url": "http://www.orthodb.org/?query=337109at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24413", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24413", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24413:SF108", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24413:SF108", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00651", "url": "http://pfam.xfam.org/family/PF00651", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A0A6YWS7", "url": "https://www.uniprot.org/uniprot/A0A0A6YWS7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0A6YWS7-1", "url": "https://www.uniprot.org/uniprot/A0A0A6YWS7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3UT66", "url": "https://www.uniprot.org/uniprot/Q3UT66", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3UT66-1", "url": "https://www.uniprot.org/uniprot/Q3UT66-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTWCLRVYPTGVDEKNKDYVSLYLILLSCEKGSVWAKFEVCILNAKGEKCNTERIPSFSRILQYQALGFEKFIIRHTFLSLAQVLTPDDKFTVLCKVSVLQDSFSISGQNPRPAIKVTRCALEDDVGELWENSLFTDCCLLVAGHEFRAHKVILAARSPVFRAMFEHEMKVRLTNRVEIHDLDPQVFKEMMGFIYTGKASHLHSYSMASDVLAAADRCGLKGLKVMCEDALCRNLSVENAAHTLILADLHSIEHLKIQALDFITVYASEVSKTSGWMSMRESHPHLVAQAFHSLASTHRIFGALPFKQLKWSLRPTQL", "length": 318, "header": "tr|A0A0A6YWS7-1|A0A0A6YWS7_MOUSE Isoform 1 of TD and POZ domain containing 8 OS=Mus musculus OX=10090 GN=Tdpoz8 PE=3 SV=1 CANONICAL=A0A0A6YWS7-1" }, "isoforms": [ { "isoform_ac": "A0A0A6YWS7-1", "url": "", "sequence": { "sequence": "MTWCLRVYPTGVDEKNKDYVSLYLILLSCEKGSVWAKFEVCILNAKGEKCNTERIPSFSRILQYQALGFEKFIIRHTFLSLAQVLTPDDKFTVLCKVSVLQDSFSISGQNPRPAIKVTRCALEDDVGELWENSLFTDCCLLVAGHEFRAHKVILAARSPVFRAMFEHEMKVRLTNRVEIHDLDPQVFKEMMGFIYTGKASHLHSYSMASDVLAAADRCGLKGLKVMCEDALCRNLSVENAAHTLILADLHSIEHLKIQALDFITVYASEVSKTSGWMSMRESHPHLVAQAFHSLASTHRIFGALPFKQLKWSLRPTQL", "length": 318, "header": "tr|A0A0A6YWS7-1|A0A0A6YWS7_MOUSE Isoform 1 of TD and POZ domain containing 8 OS=Mus musculus OX=10090 GN=Tdpoz8 PE=3 SV=1 CANONICAL=A0A0A6YWS7-1" }, "locus": { "chromosome": "3", "start_pos": 92981937, "end_pos": 92980984, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000195847.2", "url": "https://www.ensembl.org/id/ENSMUST00000195847.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000141677.2", "url": "https://www.ensembl.org/id/ENSMUSP00000141677.2" } ] } }, { "isoform_ac": "Q3UT66-1", "url": "", "sequence": { "sequence": "MNRNCATAQVLTPDDKFTVLCKVSVLQDSFSISGQNPRPAIKVTRCALEDDVGELWENSLFTDCCLLVAGHEFRAHKVILAARSPVFRAMFEHEMKVRLTNRVEIHDLDPQVFKEMMGFIYTGKASHLHSYSMASDVLAAADRCGLKGLKVMCEDALCRNLSVENAAHTLILADLHSIEHLKIQALDFITVYASEVSKTSGWMSMRESHPHLVAQAFHSLASTHRIFGALPFKQLKWSLRPTQL", "length": 244, "header": "tr|Q3UT66-1|A0A0A6YWS7_MOUSE Computationally mapped isoform of TD and POZ domain containing 8 OS=Mus musculus OX=10090 GN=Tdpoz8 PE=3 SV=1 CANONICAL=A0A0A6YWS7-1" }, "locus": { "chromosome": "3", "start_pos": 92981937, "end_pos": 92980874, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000179064.2", "url": "https://www.ensembl.org/id/ENSMUST00000179064.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000136458.2", "url": "https://www.ensembl.org/id/ENSMUSP00000136458.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:229571", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:229571", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0A6YWS7", "url": "https://www.uniprot.org/uniprot/A0A0A6YWS7" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A0A6YWS7", "url": "https://www.uniprot.org/uniprot/A0A0A6YWS7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "A0A0A6YWS7", "url": "https://www.uniprot.org/uniprot/A0A0A6YWS7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "database": "UniProtKB", "id": "A0A0A6YWS7", "url": "https://www.uniprot.org/uniprot/A0A0A6YWS7" } ], "pmid": "" }, { "name": "regulation of proteolysis", "id": "GO:0030162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030162", "evidence": [ { "database": "UniProtKB", "id": "A0A0A6YWS7", "url": "https://www.uniprot.org/uniprot/A0A0A6YWS7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 234, "end_pos": 236, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }