{ "uniprot_canonical_ac": "A0A096MKC2-1", "uniprot_ac": "A0A096MKC2", "uniprot_id": "A0A096MKC2_RAT", "mass": { "chemical_mass": 14171.0, "monoisotopic_mass": 14171.0 }, "refseq": {}, "gene_names": [ { "name": "RGD1563818", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A096MKC2", "id": "A0A096MKC2" }, { "name": "Slpil2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A096MKC2", "id": "A0A096MKC2" }, { "name": "Slpil3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A096MKC2", "id": "A0A096MKC2" }, { "name": "Slpi", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A096MKC2", "id": "A0A096MKC2" }, { "name": "LOC103690289", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A096MKC2", "id": "A0A096MKC2" }, { "name": "LOC103694893", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A096MKC2", "id": "A0A096MKC2" }, { "name": "Slpil3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A096MKC2", "id": "A0A096MKC2" }, { "name": "Slpi", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A096MKC2", "id": "A0A096MKC2" } ], "protein_names": [ { "name": "Antileukoproteinase-like 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A096MKC2" } ], "function": [], "disease": [ { "disease_id": "DOID:11612", "recommended_name": { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "polycystic ovary syndrome", "description": "An ovarian dysfunction that is characterized by hyperandrogenism, polycystic ovaries, hirsutism, oligomenorrhea or amenorrhea, anovulation and excessive body weight." }, "synonyms": [ { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Multicystic ovaries", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "PCOS", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Polycystic Ovarian disease", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Polycystic ovaries", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Stein-Leventhal synd.", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Stein-Leventhal syndrome", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "polycystic ovary", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary syndrome", "description": "A disorder that manifests as multiple cysts on the ovaries. It results in hormonal imbalances and leads to irregular and abnormal menstrual periods, excess growth of hair, acne eruptions and obesity." }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "PCOS", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "Stein-Leventhal synd.", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "Stein-Leventhal syndrome", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "multicystic ovaries", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovarian disease", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovaries", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary syndrome", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "PCOS1", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary syndrome 1", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "PCO1", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "hyperandrogenemia", "description": "" } ], "evidence": [ { "id": "11612", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11612" } ] }, { "disease_id": "DOID:2945", "recommended_name": { "id": "DOID:2945", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2945", "name": "severe acute respiratory syndrome", "description": "A Coronavirus infection that results_in infection located_in respiratory tract, has_material_basis_in SARS coronavirus (SARS-CoV), which is transmitted_by droplet spread of respiratory secretions, transmitted_by ingestion of contaminated food, or transmitted_by fomites. The infection has_symptom fever, has_symptom headache, has_symptom body aches, has_symptom dry cough, and has_symptom hypoxia." }, "synonyms": [ { "id": "DOID:2945", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2945", "name": "SARS", "description": "" }, { "id": "DOID:2945", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2945", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "severe acute respiratory syndrome", "description": "A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death." }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus caused disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus disease or disorder", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS coronavirus infectious disease", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "SARS-CoV infection", "description": "" }, { "id": "MONDO:0005091", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005091", "name": "acute respiratory coronavirus infection", "description": "" } ], "evidence": [ { "id": "2945", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2945" } ] }, { "disease_id": "DOID:3083", "recommended_name": { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "chronic obstructive pulmonary disease", "description": "An obstructive lung disease that is a chronic and progressive disorder of small airways in the lungs and that is characterized by irreversible airflow obstruction, typically identified by reductions in quantitative spirometric indices, induced forced expiratory volume at 1 second (FEV1) and the ratio of FEV1 to forced vital capacity (less than 0.7 is diagnostic of COPD). Lung volume is increased and pulmonary hypertension may occur. The pathologic changes result in the disruption of the airflow in the bronchial airways. Signs and symptoms include shortness of breath, wheezing, productive cough and chest tightness. COPD is a consequence (an end result) of chronic bronchitis, emphysema or both." }, "synonyms": [ { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "COLD", "description": "" }, { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "COPD", "description": "" }, { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "chronic obstructive airway disease", "description": "" }, { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "chronic obstructive lung disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive pulmonary disease", "description": "A chronic and progressive lung disorder characterized by the loss of elasticity of the bronchial tree and the air sacs, destruction of the air sacs wall, thickening of the bronchial wall, and mucous accumulation in the bronchial tree. The pathologic changes result in the disruption of the air flow in the bronchial airways. Signs and symptoms include shortness of breath, wheezing, productive cough, and chest tightness. The two main types of chronic obstructive pulmonary disease are chronic obstructive bronchitis and emphysema." }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "COPD", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "COPD, chronic obstructive pulmonary disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive airway disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive airways disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive lung disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive pulmonary disease (COPD)", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive pulmonary disease, (COPD)", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "cold", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "cold (chronic obstructive lung disease)", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "disease (COPD), chronic obstructive", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "obstructive lung disease, chronic", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "obstructive pulmonary disease (COPD), chronic", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "pulmonary disease (COPD), chronic obstructive", "description": "" } ], "evidence": [ { "id": "3083", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3083" } ] }, { "disease_id": "DOID:3525", "recommended_name": { "id": "DOID:3525", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3525", "name": "middle cerebral artery infarction", "description": "" }, "synonyms": [], "evidence": [ { "id": "3525", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3525" } ] }, { "disease_id": "DOID:4692", "recommended_name": { "id": "DOID:4692", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4692", "name": "endophthalmitis", "description": "A globe disease that is characterized by inflammation of the inside of the eye." }, "synonyms": [], "evidence": [ { "id": "4692", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4692" } ] }, { "disease_id": "DOID:5844", "recommended_name": { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "myocardial infarction", "description": "A coronary artery disease characterized by myocardial cell death (myocardial necrosis) due to prolonged ischaemia." }, "synonyms": [ { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "Myocardial infarct", "description": "" }, { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "heart attack", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, type 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "Mci2", "description": "" } ], "evidence": [ { "id": "5844", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5844" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2" } ], "common_name": "Rat" } ], "gene": [ { "name": "RGD1563818", "url": "https://www.uniprot.org/uniprot/A0A096MKC2", "locus": {} } ], "crossref": [ { "id": "ENSRNOG00000029508", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000029508", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ENSRNOG00000046350", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000046350", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ENSRNOG00000046699", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000046699", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ENSRNOG00000049280", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000049280", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00199", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00199", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR008197", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008197", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036645", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036645", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "CCETICG", "url": "https://omabrowser.org/oma/group/CCETICG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "KSCVEPE", "url": "https://omabrowser.org/oma/group/KSCVEPE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "NLKCCKG", "url": "https://omabrowser.org/oma/group/NLKCCKG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "TQKCCPD", "url": "https://omabrowser.org/oma/group/TQKCCPD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5472168at2759", "url": "http://www.orthodb.org/?query=5472168at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR19441", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19441", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19441:SF44", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19441:SF44", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00095", "url": "http://pfam.xfam.org/family/PF00095", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_006224800", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006224800", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1302977", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1302977", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "1303102", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1303102", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "1563818", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1563818", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "621768", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=621768", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "9143414", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=9143414", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "9161787", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=9161787", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A096MJ68", "url": "https://www.uniprot.org/uniprot/A0A096MJ68", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A096MJ68-1", "url": "https://www.uniprot.org/uniprot/A0A096MJ68-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A096MKC2-1", "url": "https://www.uniprot.org/uniprot/A0A096MKC2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1LM48", "url": "https://www.uniprot.org/uniprot/F1LM48", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1LM48-1", "url": "https://www.uniprot.org/uniprot/F1LM48-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7FFI9", "url": "https://www.uniprot.org/uniprot/F7FFI9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7FFI9-1", "url": "https://www.uniprot.org/uniprot/F7FFI9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V9C3", "url": "https://www.uniprot.org/uniprot/G3V9C3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V9C3-1", "url": "https://www.uniprot.org/uniprot/G3V9C3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0RCZ7", "url": "https://www.uniprot.org/uniprot/M0RCZ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0RCZ7-1", "url": "https://www.uniprot.org/uniprot/M0RCZ7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNFSGLVHLMVLLALGILVPWSVEGGNNDAIKIGACPDRKPAQCLKGEKPECGTDWECPGKQRCCQDTCGFKCLNPVPIPRPVKKKSGSCLKFQGKCLMLNPSNKCQNDGQCDGKYKCCEGMCGKFCLPAV", "length": 131, "header": "tr|A0A096MKC2-1|A0A096MKC2_RAT Isoform 1 of Antileukoproteinase-like 3 OS=Rattus norvegicus OX=10116 GN=RGD1563818 PE=4 SV=1 CANONICAL=A0A096MKC2-1" }, "isoforms": [ { "isoform_ac": "A0A096MJ68-1", "url": "", "sequence": { "sequence": "MRLQDAIKIGACPARKPAQCLKREKPECGTDWECPGKQRCCQDTCGFKCLNPVPIRGPVKKKPGRCLKFQGKCLMLNPPNKCQNDGQCDGKYKCCEGMCGKVCLPPV", "length": 107, "header": "tr|A0A096MJ68-1|A0A096MKC2_RAT Computationally mapped isoform of Antileukoproteinase-like 3 OS=Rattus norvegicus OX=10116 GN=RGD1563818 PE=4 SV=2 CANONICAL=A0A096MKC2-1" }, "locus": { "chromosome": "3", "start_pos": 153084225, "end_pos": 153083005, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000076191.2", "url": "https://www.ensembl.org/id/ENSRNOT00000076191.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000068012.2", "url": "https://www.ensembl.org/id/ENSRNOP00000068012.2" } ] } }, { "isoform_ac": "A0A096MKC2-1", "url": "", "sequence": { "sequence": "MNFSGLVHLMVLLALGILVPWSVEGGNNDAIKIGACPDRKPAQCLKGEKPECGTDWECPGKQRCCQDTCGFKCLNPVPIPRPVKKKSGSCLKFQGKCLMLNPSNKCQNDGQCDGKYKCCEGMCGKFCLPAV", "length": 131, "header": "tr|A0A096MKC2-1|A0A096MKC2_RAT Isoform 1 of Antileukoproteinase-like 3 OS=Rattus norvegicus OX=10116 GN=RGD1563818 PE=4 SV=1 CANONICAL=A0A096MKC2-1" }, "locus": { "chromosome": "3", "start_pos": 153012559, "end_pos": 153011111, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000075864.2", "url": "https://www.ensembl.org/id/ENSRNOT00000075864.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000068459.1", "url": "https://www.ensembl.org/id/ENSRNOP00000068459.1" } ] } }, { "isoform_ac": "F1LM48-1", "url": "", "sequence": { "sequence": "MKSSGLFPFMVLLALGILAPWRVEGNNNDAVKIGACPARKPTQCLKPQKSQCINDWDCAGKEKCCDVTCDLKCLKPLPIGRPVMKKSGSCLKFQGKCLMLPPLNQCQNDGQCDGKYKCCESMCGKFCLLPM", "length": 131, "header": "tr|F1LM48-1|F1LM48_RAT Computationally mapped isoform of Similar to secretory leukocyte protease inhibitor OS=Rattus norvegicus OX=10116 GN=Slpil3 PE=4 SV=1 CANONICAL=A0A096MKC2-1" }, "locus": { "chromosome": "3", "start_pos": 153059457, "end_pos": 153058041, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000076624.2", "url": "https://www.ensembl.org/id/ENSRNOT00000076624.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000068452.1", "url": "https://www.ensembl.org/id/ENSRNOP00000068452.1" } ] } }, { "isoform_ac": "F7FFI9-1", "url": "", "sequence": { "sequence": "MNFSGLFPHLVLLALGILAPWGVEGEKSGAIKAGACPARKPVQCLKREKPECSTDWGCPGKQRCCQDTCGFKCLNPVPIPRPVKKKSGSCLRFAVPCRPLPPLSQCQNDGQCDGKYKCCQRICGKFCFPPK", "length": 131, "header": "tr|F7FFI9-1|A0A096MKC2_RAT Computationally mapped isoform of Antileukoproteinase-like 3 OS=Rattus norvegicus OX=10116 GN=RGD1563818 PE=4 SV=1 CANONICAL=A0A096MKC2-1" }, "locus": { "chromosome": "3", "start_pos": 153021351, "end_pos": 153019904, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000043470.3", "url": "https://www.ensembl.org/id/ENSRNOT00000043470.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000047661.2", "url": "https://www.ensembl.org/id/ENSRNOP00000047661.2" } ] } }, { "isoform_ac": "G3V9C3-1", "url": "", "sequence": { "sequence": "MKSSGLFPFMVLLALGILAPWRVEGNNNDAVKIGACPARKPTQCLKPQKSQCINDWDCAGKEKCCDVTCDLKCLKPLPIGRPVKKSGSCLKFQGKCLMLPPLNQCQNDGQCDGKYKCCESMCGKFCLLPM", "length": 130, "header": "tr|G3V9C3-1|A0A096MKC2_RAT Computationally mapped isoform of Antileukoproteinase-like 3 OS=Rattus norvegicus OX=10116 GN=RGD1563818 PE=4 SV=3 CANONICAL=A0A096MKC2-1" }, "locus": { "chromosome": "3", "start_pos": 153059457, "end_pos": 153058041, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000074757.3", "url": "https://www.ensembl.org/id/ENSRNOT00000074757.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000066055.3", "url": "https://www.ensembl.org/id/ENSRNOP00000066055.3" } ] } }, { "isoform_ac": "M0RCZ7-1", "url": "", "sequence": { "sequence": "MKSSGLFPLMVLLALGVLAPWSVEGGKNDAIKIGACPARKPAQCLKREKPECGTDWECPGKQRCCQDTCGFKCLNPVPIRGPVKKKPGRCLKFQGKCLMLNPPNKCQNDGQCDGKYKCCEGMCGKVCLPPV", "length": 131, "header": "tr|M0RCZ7-1|M0RCZ7_RAT Computationally mapped isoform of Secretory leukocyte peptidase inhibitor OS=Rattus norvegicus OX=10116 GN=RGD1563818 PE=4 SV=2 CANONICAL=A0A096MKC2-1" }, "locus": { "chromosome": "3", "start_pos": 153084445, "end_pos": 153083005, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000078398.2", "url": "https://www.ensembl.org/id/ENSRNOT00000078398.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000070977.2", "url": "https://www.ensembl.org/id/ENSRNOP00000070977.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "R-RNO-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "serine-type endopeptidase inhibitor activity", "id": "GO:0004867", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004867", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2" } ], "pmid": "" }, { "name": "mRNA binding", "id": "GO:0003729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003729", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2" } ], "pmid": "" }, { "name": "endopeptidase inhibitor activity", "id": "GO:0004866", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004866", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "antibacterial humoral response", "id": "GO:0019731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019731", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2" } ], "pmid": "" }, { "name": "response to lipopolysaccharide", "id": "GO:0032496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032496", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2" } ], "pmid": "" }, { "name": "negative regulation of protein binding", "id": "GO:0032091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032091", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2" } ], "pmid": "" }, { "name": "negative regulation of viral genome replication", "id": "GO:0045071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045071", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKC2", "url": "https://www.uniprot.org/uniprot/A0A096MKC2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 2, "end_pos": 4, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }