{ "uniprot_canonical_ac": "A0A087WSF2-1", "uniprot_ac": "A0A087WSF2", "uniprot_id": "A0A087WSF2_MOUSE", "mass": { "chemical_mass": 56509.0, "monoisotopic_mass": 56509.0 }, "refseq": { "ac": "NP_001297632", "name": "sperm motility kinase 3C", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297632" }, "gene_names": [ { "name": "Smok3c", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A087WSF2", "id": "A0A087WSF2" }, { "name": "EG622486", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297632", "id": "NP_001297632" }, { "name": "Smok3c", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297632", "id": "NP_001297632" } ], "protein_names": [ { "name": "Sperm motility kinase 3C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A087WSF2" }, { "name": "sperm motility kinase 3C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297632", "id": "NP_001297632" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A087WSF2", "url": "https://www.uniprot.org/uniprot/A0A087WSF2" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Smok3c", "url": "https://www.uniprot.org/uniprot/A0A087WSF2", "locus": { "chromosome": "5", "start_pos": 138064799, "end_pos": 138051456, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000075598", "url": "https://www.ensembl.org/id/ENSMUSG00000075598" } ] } } ], "crossref": [ { "id": "ENSMUSG00000075598", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000075598", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd14003", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14003", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd14337", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14337", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "622486", "url": "https://www.ncbi.nlm.nih.gov/gene/622486", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000719", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000719", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008271", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008271", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011009", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011009", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:622486", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:622486", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3647925", "url": "http://www.informatics.jax.org/marker/MGI:3647925", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "PQHAPMA", "url": "https://omabrowser.org/oma/group/PQHAPMA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1090327at2759", "url": "http://www.orthodb.org/?query=1090327at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24346", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24346", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24346:SF78", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24346:SF78", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00069", "url": "http://pfam.xfam.org/family/PF00069", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001297632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297632", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WSF2", "url": "https://www.uniprot.org/uniprot/A0A087WSF2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WSF2-1", "url": "https://www.uniprot.org/uniprot/A0A087WSF2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGPGSQQKSEKLRCKPPFSNMDGFHAQYVMLETIGHGGCATVKLAQHRLTGTHVAVKTIQKRGYWCILIMSEVDLLMMADHPNVISLLQVIETKKKVYLIMELCEGKSLYQHIRKAGYLQEHEARALFKQLLSAMNYCHNQGIVHRDLKPDNIMVEKDGKVKIIDFGLSTKVKPGQKLNLFCGTYPFSAPEVLLSTPYDGPKIDVWTLGVVLYFMVTGKIPFDACSIKRLVKRILAGKYSIPSRLSAELRDLLSLLMTANPKLRPTVAEVMVHPWVTEGSGVFPDPCEEQTPLKPDPAIVKAMGHIGFQAQDIEDSLRQRKFNQTMASYCLLKKQILKECDRPTRARPVNPSVTPFPSLVDTATTCLGLRRRENEPTCPWSSANRQVSVCGKSTSKKRDRRVSWPSVLGRPRHTAPTMDHTRTRTRSVPCICSMFCTVQPNSSEESTQGHTRASAADKPVRSRGWPRGIKGWTRMIGNAMRKLCCCIPSKETSHLGQNRVSPKK", "length": 504, "header": "tr|A0A087WSF2-1|A0A087WSF2_MOUSE Isoform 1 of Sperm motility kinase 3C OS=Mus musculus OX=10090 GN=Smok3c PE=4 SV=1 CANONICAL=A0A087WSF2-1" }, "isoforms": [ { "isoform_ac": "A0A087WSF2-1", "url": "", "sequence": { "sequence": "MGPGSQQKSEKLRCKPPFSNMDGFHAQYVMLETIGHGGCATVKLAQHRLTGTHVAVKTIQKRGYWCILIMSEVDLLMMADHPNVISLLQVIETKKKVYLIMELCEGKSLYQHIRKAGYLQEHEARALFKQLLSAMNYCHNQGIVHRDLKPDNIMVEKDGKVKIIDFGLSTKVKPGQKLNLFCGTYPFSAPEVLLSTPYDGPKIDVWTLGVVLYFMVTGKIPFDACSIKRLVKRILAGKYSIPSRLSAELRDLLSLLMTANPKLRPTVAEVMVHPWVTEGSGVFPDPCEEQTPLKPDPAIVKAMGHIGFQAQDIEDSLRQRKFNQTMASYCLLKKQILKECDRPTRARPVNPSVTPFPSLVDTATTCLGLRRRENEPTCPWSSANRQVSVCGKSTSKKRDRRVSWPSVLGRPRHTAPTMDHTRTRTRSVPCICSMFCTVQPNSSEESTQGHTRASAADKPVRSRGWPRGIKGWTRMIGNAMRKLCCCIPSKETSHLGQNRVSPKK", "length": 504, "header": "tr|A0A087WSF2-1|A0A087WSF2_MOUSE Isoform 1 of Sperm motility kinase 3C OS=Mus musculus OX=10090 GN=Smok3c PE=4 SV=1 CANONICAL=A0A087WSF2-1" }, "locus": { "chromosome": "5", "start_pos": 138064799, "end_pos": 138064516, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000110967.4", "url": "https://www.ensembl.org/id/ENSMUST00000110967.4" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000141020.2", "url": "https://www.ensembl.org/id/ENSMUSP00000141020.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:622486", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:622486", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "protein serine/threonine kinase activity", "id": "GO:0004674", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004674", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSF2", "url": "https://www.uniprot.org/uniprot/A0A087WSF2" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSF2", "url": "https://www.uniprot.org/uniprot/A0A087WSF2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "protein phosphorylation", "id": "GO:0006468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006468", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSF2", "url": "https://www.uniprot.org/uniprot/A0A087WSF2" } ], "pmid": "" }, { "name": "intracellular signal transduction", "id": "GO:0035556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035556", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSF2", "url": "https://www.uniprot.org/uniprot/A0A087WSF2" } ], "pmid": "" }, { "name": "negative regulation of TOR signaling", "id": "GO:0032007", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032007", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSF2", "url": "https://www.uniprot.org/uniprot/A0A087WSF2" } ], "pmid": "" }, { "name": "cellular response to glucose starvation", "id": "GO:0042149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042149", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSF2", "url": "https://www.uniprot.org/uniprot/A0A087WSF2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleotide-activated protein kinase complex", "id": "GO:0031588", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031588", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSF2", "url": "https://www.uniprot.org/uniprot/A0A087WSF2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 323, "end_pos": 325, "annotation": "n_glycosylation_sequon" }, { "start_pos": 441, "end_pos": 443, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }