{ "uniprot_canonical_ac": "A0A087WPH4-1", "uniprot_ac": "A0A087WPH4", "uniprot_id": "A0A087WPH4_MOUSE", "mass": { "chemical_mass": 7994.0, "monoisotopic_mass": 7994.0 }, "refseq": { "ac": "XP_006523185", "name": "keratin-associated protein 20-2-like", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006523185" }, "gene_names": [ { "name": "Gm6358", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A087WPH4", "id": "A0A087WPH4" }, { "name": "Gm6358", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006523185", "id": "XP_006523185" } ], "protein_names": [ { "name": "Predicted gene 6358", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A087WPH4" }, { "name": "keratin-associated protein 20-2-like", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006523185", "id": "XP_006523185" } ], "function": [ { "annotation": "In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPH4", "url": "https://www.uniprot.org/uniprot/A0A087WPH4#function" }, { "database": "UniProtKB", "id": "ARBA00003327", "url": "https://www.uniprot.org/uniprot/ARBA00003327#function" }, { "database": "UniProtKB", "id": "D3YWL8", "url": "https://www.uniprot.org/uniprot/D3YWL8#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A087WPH4", "url": "https://www.uniprot.org/uniprot/A0A087WPH4" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gm6358", "url": "https://www.uniprot.org/uniprot/A0A087WPH4", "locus": { "chromosome": "16", "start_pos": 88938227, "end_pos": 88937739, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000068071", "url": "https://www.ensembl.org/id/ENSMUSG00000068071" } ] } } ], "crossref": [ { "id": "ENSMUSG00000068071", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000068071", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "102637070", "url": "https://www.ncbi.nlm.nih.gov/gene/102637070", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR021743", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021743", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:102637070", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:102637070", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3643237", "url": "http://www.informatics.jax.org/marker/MGI:3643237", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "DILIHYY", "url": "https://omabrowser.org/oma/group/DILIHYY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR39653", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR39653", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR39653:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR39653:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF11759", "url": "http://pfam.xfam.org/family/PF11759", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6805567", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "A0A087WPH4", "url": "https://www.uniprot.org/uniprot/A0A087WPH4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WPH4-1", "url": "https://www.uniprot.org/uniprot/A0A087WPH4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YWL8", "url": "https://www.uniprot.org/uniprot/D3YWL8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YWL8-1", "url": "https://www.uniprot.org/uniprot/D3YWL8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVTPRLKKPTACLSQTTSGTPDNMCYYGGYYGGLGYGYGGLGYGYGCGYGGYGGYGYGCCRPLCCRRYWSCGFY", "length": 74, "header": "tr|A0A087WPH4-1|A0A087WPH4_MOUSE Isoform 1 of Predicted gene 6358 OS=Mus musculus OX=10090 GN=Gm6358 PE=4 SV=1 CANONICAL=A0A087WPH4-1" }, "isoforms": [ { "isoform_ac": "A0A087WPH4-1", "url": "", "sequence": { "sequence": "MVTPRLKKPTACLSQTTSGTPDNMCYYGGYYGGLGYGYGGLGYGYGCGYGGYGGYGYGCCRPLCCRRYWSCGFY", "length": 74, "header": "tr|A0A087WPH4-1|A0A087WPH4_MOUSE Isoform 1 of Predicted gene 6358 OS=Mus musculus OX=10090 GN=Gm6358 PE=4 SV=1 CANONICAL=A0A087WPH4-1" }, "locus": { "chromosome": "16", "start_pos": 88937984, "end_pos": 88937763, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000187643.2", "url": "https://www.ensembl.org/id/ENSMUST00000187643.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000139779.2", "url": "https://www.ensembl.org/id/ENSMUSP00000139779.2" } ] } }, { "isoform_ac": "D3YWL8-1", "url": "", "sequence": { "sequence": "MCYYGGYYGGLGYGYGGLGYGYGCGYGGYGGYGYGCCRPLCCRRYWSCGFY", "length": 51, "header": "tr|D3YWL8-1|A0A087WPH4_MOUSE Computationally mapped isoform of Predicted gene 6358 OS=Mus musculus OX=10090 GN=Gm6358 PE=4 SV=1 CANONICAL=A0A087WPH4-1" }, "locus": { "chromosome": "16", "start_pos": 88937984, "end_pos": 88937832, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000089101.2", "url": "https://www.ensembl.org/id/ENSMUST00000089101.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000086502.2", "url": "https://www.ensembl.org/id/ENSMUSP00000086502.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:102637070", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:102637070", "resource": "KEGG Pathway" }, { "id": "R-MMU-6805567", "name": "Keratinization", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6805567", "resource": "Reactome", "description": "Keratinization" } ], "orthologs": [ { "uniprot_canonical_ac": "Q3LI61-1", "protein_name": "Keratin-associated protein 20-2", "gene_name": "KRTAP20-2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MCYYSNYYGGLRYGYGVLGGGYGCGCGYGHGYGGLGCGYGRGYGGYGYGCCRPSCYGRYWSCGFY", "length": 65 }, "evidence": [ { "id": "45241822", "url": "http://www.informatics.jax.org/homology/45241822", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "intermediate filament", "id": "GO:0005882", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005882", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPH4", "url": "https://www.uniprot.org/uniprot/A0A087WPH4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }