{ "uniprot_canonical_ac": "A0A087WPC3-1", "uniprot_ac": "A0A087WPC3", "uniprot_id": "A0A087WPC3_MOUSE", "mass": { "chemical_mass": 58594.0, "monoisotopic_mass": 58594.0 }, "refseq": {}, "gene_names": [ { "name": "Cyp4a29", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A087WPC3", "id": "A0A087WPC3" } ], "protein_names": [ { "name": "Cytochrome P450, family 4, subfamily a, polypeptide 29", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A087WPC3" } ], "function": [], "disease": [ { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Cyp4a29", "url": "https://www.uniprot.org/uniprot/A0A087WPC3", "locus": { "chromosome": "4", "start_pos": 115111754, "end_pos": 115099281, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000083138", "url": "https://www.ensembl.org/id/ENSMUSG00000083138" } ] } } ], "crossref": [ { "id": "ENSMUSG00000083138", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000083138", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd20678", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20678", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001128", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001128", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002401", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002401", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017972", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017972", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036396", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036396", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:230639", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:230639", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3717143", "url": "http://www.informatics.jax.org/marker/MGI:3717143", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "IACQDIT", "url": "https://omabrowser.org/oma/group/IACQDIT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1611592at2759", "url": "http://www.orthodb.org/?query=1611592at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24291", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24291", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24291:SF165", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24291:SF165", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00067", "url": "http://pfam.xfam.org/family/PF00067", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WPC3-1", "url": "https://www.uniprot.org/uniprot/A0A087WPC3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSISALSPIRFLECVSGFLQVIFLIGLLLLLFKAAQHYLRRQWLLRALYQFPSPPSHWLFGHCLQFKVDEELRWILRYLEKFPGAFLHWIWGSHVFIKVCDPDYMKVILGRADPKASLYRFLTPWLGHGLFFLNGDEWFQHRRLLTPAFHYDILKPYVGIMADSVQVMLEKWEQIACQDITLEIFHPISLMMLDTIMKYAFSYQGSVQLDRSSQAYLQAVSDLNNLVTSRMKNVFLHNDIIYNLTSHSRRTNSACQIAHEHTDRVVKLRKAQLQDNKSMKKLRGKRCLDFLDILLLSRMDDGSSLSDKALRAEVDSLMFGGHDTPASGISWVFYALATHPDHQQRCREEVQSLLGDGSPITWDHLHQMPYTTMCIKEALRLYPPIPSVGRKLSTPVTFPDGRSLPKGITVLLHFYALHHNPKVWPNPEVFDPSRFAMNSVQHSHAFLPFSGGSRNCIGKHLAMNVLKVAVALTLLRFELLPDPSRVPIPTQQLVLKSKNGIYLHLRKLQ", "length": 509, "header": "tr|A0A087WPC3-1|A0A087WPC3_MOUSE Isoform 1 of Cytochrome P450, family 4, subfamily a, polypeptide 29 OS=Mus musculus OX=10090 GN=Cyp4a29 PE=3 SV=1 CANONICAL=A0A087WPC3-1" }, "isoforms": [ { "isoform_ac": "A0A087WPC3-1", "url": "", "sequence": { "sequence": "MSISALSPIRFLECVSGFLQVIFLIGLLLLLFKAAQHYLRRQWLLRALYQFPSPPSHWLFGHCLQFKVDEELRWILRYLEKFPGAFLHWIWGSHVFIKVCDPDYMKVILGRADPKASLYRFLTPWLGHGLFFLNGDEWFQHRRLLTPAFHYDILKPYVGIMADSVQVMLEKWEQIACQDITLEIFHPISLMMLDTIMKYAFSYQGSVQLDRSSQAYLQAVSDLNNLVTSRMKNVFLHNDIIYNLTSHSRRTNSACQIAHEHTDRVVKLRKAQLQDNKSMKKLRGKRCLDFLDILLLSRMDDGSSLSDKALRAEVDSLMFGGHDTPASGISWVFYALATHPDHQQRCREEVQSLLGDGSPITWDHLHQMPYTTMCIKEALRLYPPIPSVGRKLSTPVTFPDGRSLPKGITVLLHFYALHHNPKVWPNPEVFDPSRFAMNSVQHSHAFLPFSGGSRNCIGKHLAMNVLKVAVALTLLRFELLPDPSRVPIPTQQLVLKSKNGIYLHLRKLQ", "length": 509, "header": "tr|A0A087WPC3-1|A0A087WPC3_MOUSE Isoform 1 of Cytochrome P450, family 4, subfamily a, polypeptide 29 OS=Mus musculus OX=10090 GN=Cyp4a29 PE=3 SV=1 CANONICAL=A0A087WPC3-1" }, "locus": { "chromosome": "4", "start_pos": 115111751, "end_pos": 115099281, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000118278.2", "url": "https://www.ensembl.org/id/ENSMUST00000118278.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000139717.2", "url": "https://www.ensembl.org/id/ENSMUSP00000139717.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:230639", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:230639", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "icosanoid biosynthetic process", "id": "GO:0046456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046456", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "kidney development", "id": "GO:0001822", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001822", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "linoleic acid metabolic process", "id": "GO:0043651", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043651", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "arachidonic acid metabolic process", "id": "GO:0019369", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019369", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "lauric acid metabolic process", "id": "GO:0048252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048252", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 9, "go_terms": [ { "name": "iron ion binding", "id": "GO:0005506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "heme binding", "id": "GO:0020037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "arachidonic acid epoxygenase activity", "id": "GO:0008392", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008392", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "leukotriene-B4 20-monooxygenase activity", "id": "GO:0050051", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050051", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "16-hydroxypalmitate dehydrogenase activity", "id": "GO:0103002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0103002", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "alkane 1-monooxygenase activity", "id": "GO:0018685", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018685", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "arachidonic acid monooxygenase activity", "id": "GO:0008391", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008391", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "long-chain fatty acid omega-hydroxylase activity", "id": "GO:0102033", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102033", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "medium-chain fatty acid omega-hydroxylase activity", "id": "GO:0140981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140981", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPC3", "url": "https://www.uniprot.org/uniprot/A0A087WPC3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 243, "end_pos": 245, "annotation": "n_glycosylation_sequon" }, { "start_pos": 276, "end_pos": 278, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }