{ "uniprot_canonical_ac": "A0A087WPA9-1", "uniprot_ac": "A0A087WPA9", "uniprot_id": "A0A087WPA9_MOUSE", "mass": { "chemical_mass": 12624.0, "monoisotopic_mass": 12624.0 }, "refseq": { "ac": "NP_001297550", "name": "secretoglobin, family 2B, member 18 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297550" }, "gene_names": [ { "name": "Scgb2b18", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A087WPA9", "id": "A0A087WPA9" }, { "name": "100043856; Abpbg18; Gm4692", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297550", "id": "NP_001297550" }, { "name": "Abpbg18", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A087WPA9", "id": "A0A087WPA9" }, { "name": "Scgb2b18", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297550", "id": "NP_001297550" } ], "protein_names": [ { "name": "ABPBG18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A087WPA9" }, { "name": "Secretoglobin, family 2B, member 18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A087WPA9" }, { "name": "secretoglobin, family 2B, member 18 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297550", "id": "NP_001297550" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A087WPA9", "url": "https://www.uniprot.org/uniprot/A0A087WPA9" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Scgb2b18", "url": "https://www.uniprot.org/uniprot/A0A087WPA9", "locus": { "chromosome": "7", "start_pos": 32871317, "end_pos": 32873289, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000100058", "url": "https://www.ensembl.org/id/ENSMUSG00000100058" } ] } } ], "crossref": [ { "id": "cd00633", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00633", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100043856", "url": "https://www.ncbi.nlm.nih.gov/gene/100043856", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR015332", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015332", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016126", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016126", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035960", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035960", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:100043856", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:100043856", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3782872", "url": "http://www.informatics.jax.org/marker/MGI:3782872", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "4840376at2759", "url": "http://www.orthodb.org/?query=4840376at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR31708", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31708", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR31708:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31708:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF09252", "url": "http://pfam.xfam.org/family/PF09252", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001297550", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297550", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WPA9", "url": "https://www.uniprot.org/uniprot/A0A087WPA9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WPA9-1", "url": "https://www.uniprot.org/uniprot/A0A087WPA9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKGTLLLLGLLVTGELSFQTSEACVSFFEGYASVLSGSRVWLYQELQAFDATAEEKVALEKIQSCYSEERIRNILLEPKIMEAMVASPECRSYHSFNNFRSILDFISNLLGE", "length": 112, "header": "tr|A0A087WPA9-1|A0A087WPA9_MOUSE Isoform 1 of ABPBG18 OS=Mus musculus OX=10090 GN=Scgb2b18 PE=3 SV=1 CANONICAL=A0A087WPA9-1" }, "isoforms": [ { "isoform_ac": "A0A087WPA9-1", "url": "", "sequence": { "sequence": "MKGTLLLLGLLVTGELSFQTSEACVSFFEGYASVLSGSRVWLYQELQAFDATAEEKVALEKIQSCYSEERIRNILLEPKIMEAMVASPECRSYHSFNNFRSILDFISNLLGE", "length": 112, "header": "tr|A0A087WPA9-1|A0A087WPA9_MOUSE Isoform 1 of ABPBG18 OS=Mus musculus OX=10090 GN=Scgb2b18 PE=3 SV=1 CANONICAL=A0A087WPA9-1" }, "locus": { "chromosome": "7", "start_pos": 32873267, "end_pos": 32871482, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000186529.2", "url": "https://www.ensembl.org/id/ENSMUST00000186529.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000139701.2", "url": "https://www.ensembl.org/id/ENSMUSP00000139701.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Selection shaped the evolution of mouse androgen-binding protein (ABP) function and promoted the duplication of Abp genes.", "journal": "Biochem. Soc. Trans.", "date": "2014", "authors": "Karn RC, Laukaitis CM", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPA9", "url": "https://www.uniprot.org/uniprot/A0A087WPA9" } ], "reference": [ { "type": "PubMed", "id": "25109968", "url": "https://glygen.org/publication/PubMed/25109968" } ] }, { "title": "Did androgen-binding protein paralogs undergo neo- and/or Subfunctionalization as the Abp gene region expanded in the mouse genome?", "journal": "PLoS ONE", "date": "2014", "authors": "Karn Robert C, Chung Amanda G, Laukaitis Christina M", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPA9", "url": "https://www.uniprot.org/uniprot/A0A087WPA9" } ], "reference": [ { "type": "PubMed", "id": "25531410", "url": "https://glygen.org/publication/PubMed/25531410" } ] } ], "pathway": [ { "id": "mmu:100043856", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:100043856", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D2XZ44-1", "protein_name": "Androgen-binding protein", "gene_name": "Scgb2b24", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKGTLLLLTLLVIGELGFQTTEACLPFFTAYGGVLSGSKLWLNHELDAYNATTGEREAYEKIQQCFREGGLKAKFLEPKILKAMVISPECLSYYGNEIVAEITALLSKLQLR", "length": 112 }, "evidence": [ { "id": "45245619", "url": "http://www.informatics.jax.org/homology/45245619", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A087WPA9", "url": "https://www.uniprot.org/uniprot/A0A087WPA9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }