{ "uniprot_canonical_ac": "A0A087WP50-1", "uniprot_ac": "A0A087WP50", "uniprot_id": "A0A087WP50_MOUSE", "mass": { "chemical_mass": 10328.0, "monoisotopic_mass": 10328.0 }, "refseq": {}, "gene_names": [ { "name": "Scgb1b17", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A087WP50", "id": "A0A087WP50" }, { "name": "Abpa15_a17", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A087WP50", "id": "A0A087WP50" }, { "name": "Scgb1b15", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A087WP50", "id": "A0A087WP50" } ], "protein_names": [ { "name": "ABPA15_a17", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A087WP50" }, { "name": "Secretoglobin, family 1B, member 15", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A087WP50" }, { "name": "Secretoglobin, family 1B, member 17", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A087WP50" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A087WP50", "url": "https://www.uniprot.org/uniprot/A0A087WP50" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Scgb1b17", "url": "https://www.uniprot.org/uniprot/A0A087WP50", "locus": { "chromosome": "7", "start_pos": 32764190, "end_pos": 32762874, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000099898", "url": "https://www.ensembl.org/id/ENSMUSG00000099898" } ] } } ], "crossref": [ { "id": "cd00633", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00633", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR006178", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006178", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016126", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016126", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035960", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035960", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "3782584", "url": "http://www.informatics.jax.org/marker/MGI:3782584", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "3809666", "url": "http://www.informatics.jax.org/marker/MGI:3809666", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "4640157at2759", "url": "http://www.orthodb.org/?query=4640157at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21226", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21226", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21226:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21226:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01099", "url": "http://pfam.xfam.org/family/PF01099", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_006540557", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006540557", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WP50", "url": "https://www.uniprot.org/uniprot/A0A087WP50", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WP50-1", "url": "https://www.uniprot.org/uniprot/A0A087WP50-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMLAGAVVIFGVALLLLSSWGDCGICPAMKEDVHLFLNGTSEEYVEYVKQYKDDPEILENTEKIKQCVDSTLMEEDKAHANGFIEKIEASPLC", "length": 93, "header": "tr|A0A087WP50-1|A0A087WP50_MOUSE Isoform 1 of Secretoglobin, family 1B, member 17 OS=Mus musculus OX=10090 GN=Scgb1b17 PE=4 SV=1 CANONICAL=A0A087WP50-1" }, "isoforms": [ { "isoform_ac": "A0A087WP50-1", "url": "", "sequence": { "sequence": "MMLAGAVVIFGVALLLLSSWGDCGICPAMKEDVHLFLNGTSEEYVEYVKQYKDDPEILENTEKIKQCVDSTLMEEDKAHANGFIEKIEASPLC", "length": 93, "header": "tr|A0A087WP50-1|A0A087WP50_MOUSE Isoform 1 of Secretoglobin, family 1B, member 17 OS=Mus musculus OX=10090 GN=Scgb1b17 PE=4 SV=1 CANONICAL=A0A087WP50-1" }, "locus": { "chromosome": "7", "start_pos": 32764068, "end_pos": 32762890, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000187081.2", "url": "https://www.ensembl.org/id/ENSMUST00000187081.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000139627.2", "url": "https://www.ensembl.org/id/ENSMUSP00000139627.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0A087WP50", "url": "https://www.uniprot.org/uniprot/A0A087WP50" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "steroid binding", "id": "GO:0005496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005496", "evidence": [ { "database": "UniProtKB", "id": "A0A087WP50", "url": "https://www.uniprot.org/uniprot/A0A087WP50" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 38, "end_pos": 40, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }