{ "uniprot_canonical_ac": "A0A087WNP0-1", "uniprot_ac": "A0A087WNP0", "uniprot_id": "A0A087WNP0_MOUSE", "mass": { "chemical_mass": 26870.0, "monoisotopic_mass": 26870.0 }, "refseq": {}, "gene_names": [ { "name": "4931428L18Rik", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A087WNP0", "id": "A0A087WNP0" } ], "protein_names": [ { "name": "RIKEN cDNA 4931428L18 gene", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A087WNP0" } ], "function": [], "disease": [ { "disease_id": "DOID:1574", "recommended_name": { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol use disorder", "description": "A substance abuse that involves the recurring use of alcoholic beverages despite negative consequences." }, "synonyms": [ { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "Ethanol abuse", "description": "" }, { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol abuse", "description": "" } ], "evidence": [ { "id": "1574", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1574" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "common_name": "Mouse" } ], "gene": [ { "name": "4931428L18Rik", "url": "https://www.uniprot.org/uniprot/A0A087WNP0", "locus": { "chromosome": "1", "start_pos": 31036933, "end_pos": 31261765, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000086727", "url": "https://www.ensembl.org/id/ENSMUSG00000086727" } ] } } ], "crossref": [ { "id": "ENSMUSG00000086727", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000086727", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd12680", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12680", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025715", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025715", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "1918238", "url": "http://www.informatics.jax.org/marker/MGI:1918238", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "NYHKEAM", "url": "https://omabrowser.org/oma/group/NYHKEAM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR19965", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19965", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19965:SF82", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19965:SF82", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00076", "url": "http://pfam.xfam.org/family/PF00076", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13865", "url": "http://pfam.xfam.org/family/PF13865", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WNP0-1", "url": "https://www.uniprot.org/uniprot/A0A087WNP0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MADKMGLSLEDIIKLNKIQQGCHNRPDSRVNRGTGPKRYKPGITNSGRNRLPPYRRPKQLQDKGQHDHFVGSFRAGNHMDTGGKLLLSNLHFGVSDADIQKLFAEFGTLRKSAVHYDRSGQSLGTAHVHFERKADALKAMREYNGVPLDGRPMNIQLVTSTIDTRPRPAQSRNRGGMPRNPGSGGYGGGGTRRETLEDSQGRGGTSRNSKKKQQQQQQQQQLSAEELDAQLDTYWEMMDTS", "length": 241, "header": "tr|A0A087WNP0-1|A0A087WNP0_MOUSE Isoform 1 of RIKEN cDNA 4931428L18 gene OS=Mus musculus OX=10090 GN=4931428L18Rik PE=4 SV=2 CANONICAL=A0A087WNP0-1" }, "isoforms": [ { "isoform_ac": "A0A087WNP0-1", "url": "", "sequence": { "sequence": "MADKMGLSLEDIIKLNKIQQGCHNRPDSRVNRGTGPKRYKPGITNSGRNRLPPYRRPKQLQDKGQHDHFVGSFRAGNHMDTGGKLLLSNLHFGVSDADIQKLFAEFGTLRKSAVHYDRSGQSLGTAHVHFERKADALKAMREYNGVPLDGRPMNIQLVTSTIDTRPRPAQSRNRGGMPRNPGSGGYGGGGTRRETLEDSQGRGGTSRNSKKKQQQQQQQQQLSAEELDAQLDTYWEMMDTS", "length": 241, "header": "tr|A0A087WNP0-1|A0A087WNP0_MOUSE Isoform 1 of RIKEN cDNA 4931428L18 gene OS=Mus musculus OX=10090 GN=4931428L18Rik PE=4 SV=2 CANONICAL=A0A087WNP0-1" }, "locus": { "chromosome": "1", "start_pos": 31037989, "end_pos": 31037267, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000152491.4", "url": "https://www.ensembl.org/id/ENSMUST00000152491.4" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000156852.2", "url": "https://www.ensembl.org/id/ENSMUSP00000156852.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "viral mRNA export from host cell nucleus", "id": "GO:0046784", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046784", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" }, { "name": "regulation of DNA recombination", "id": "GO:0000018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000018", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" }, { "name": "mRNA export from nucleus", "id": "GO:0006406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006406", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" }, { "name": "replication fork processing", "id": "GO:0031297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031297", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" }, { "name": "RNA export from nucleus", "id": "GO:0006405", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006405", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription, elongation", "id": "GO:0032786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032786", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "mRNA binding", "id": "GO:0003729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003729", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" }, { "name": "C5-methylcytidine-containing RNA binding", "id": "GO:0062153", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062153", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" }, { "name": "catalytic step 2 spliceosome", "id": "GO:0071013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071013", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" }, { "name": "transcription export complex", "id": "GO:0000346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000346", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" }, { "name": "chromosome, telomeric region", "id": "GO:0000781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000781", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" }, { "name": "exon-exon junction complex", "id": "GO:0035145", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035145", "evidence": [ { "database": "UniProtKB", "id": "A0A087WNP0", "url": "https://www.uniprot.org/uniprot/A0A087WNP0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }