{ "uniprot_canonical_ac": "A0A077S6M4-1", "uniprot_ac": "A0A077S6M4", "uniprot_id": "A0A077S6M4_RAT", "mass": { "chemical_mass": 17159.0, "monoisotopic_mass": 17159.0 }, "refseq": { "ac": "NP_001129305", "name": "lysozyme-like protein 6 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129305" }, "gene_names": [ { "name": "Lyzl6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A077S6M4", "id": "A0A077S6M4" }, { "name": "Lyzb; RGD1306968", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129305", "id": "NP_001129305" }, { "name": "Lyzl6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129305", "id": "NP_001129305" } ], "protein_names": [ { "name": "Lysozyme-like 6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A077S6M4" }, { "name": "lysozyme-like protein 6 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129305", "id": "NP_001129305" }, { "name": "lysozyme-like protein 6; lysozyme b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129305", "id": "NP_001129305" } ], "function": [ { "annotation": "This study indicates a role for LYZL6 protein in sperm function", "evidence": [ { "database": "RefSeq", "id": "NP_001129305", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129305" }, { "database": "PubMed", "id": "27821286", "url": "https://glygen.org/publication/PubMed/27821286" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A077S6M4", "url": "https://www.uniprot.org/uniprot/A0A077S6M4" } ], "common_name": "Rat" } ], "gene": [ { "name": "Lyzl6", "url": "https://www.uniprot.org/uniprot/A0A077S6M4", "locus": { "chromosome": "10", "start_pos": 88544342, "end_pos": 88549177, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000003501", "url": "https://www.ensembl.org/id/ENSRNOG00000003501" } ] } } ], "crossref": [ { "id": "ENSRNOG00000003501", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000003501", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16897", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16897", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "287751", "url": "https://www.ncbi.nlm.nih.gov/gene/287751", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000974", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000974", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001916", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001916", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019799", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019799", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023346", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023346", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:287751", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:287751", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "EWRLHCA", "url": "https://omabrowser.org/oma/group/EWRLHCA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5344399at2759", "url": "http://www.orthodb.org/?query=5344399at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11407", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11407", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11407:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11407:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00062", "url": "http://pfam.xfam.org/family/PF00062", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001129305", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129305", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1306968", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1306968", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A077S6M4", "url": "https://www.uniprot.org/uniprot/A0A077S6M4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A077S6M4-1", "url": "https://www.uniprot.org/uniprot/A0A077S6M4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMMRVLFICVVSCLLVVNDGSIINRCTLARILYQEDLDGFEGYSLPHWLCLAFVESKFNISKVTENADGTFDYGIFQINSRYWCNDYQSHSENFCRLDCEELLNPNLIPSIHCAKMIVSGSGGMKNWVDWRLHCLGRPLSYWLTGCRLV", "length": 149, "header": "tr|A0A077S6M4-1|A0A077S6M4_RAT Isoform 1 of Lysozyme-like 6 OS=Rattus norvegicus OX=10116 GN=Lyzl6 PE=3 SV=1 CANONICAL=A0A077S6M4-1" }, "isoforms": [ { "isoform_ac": "A0A077S6M4-1", "url": "", "sequence": { "sequence": "MMMRVLFICVVSCLLVVNDGSIINRCTLARILYQEDLDGFEGYSLPHWLCLAFVESKFNISKVTENADGTFDYGIFQINSRYWCNDYQSHSENFCRLDCEELLNPNLIPSIHCAKMIVSGSGGMKNWVDWRLHCLGRPLSYWLTGCRLV", "length": 149, "header": "tr|A0A077S6M4-1|A0A077S6M4_RAT Isoform 1 of Lysozyme-like 6 OS=Rattus norvegicus OX=10116 GN=Lyzl6 PE=3 SV=1 CANONICAL=A0A077S6M4-1" }, "locus": { "chromosome": "10", "start_pos": 88548767, "end_pos": 88544619, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000004650.5", "url": "https://www.ensembl.org/id/ENSRNOT00000004650.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000004650.5", "url": "https://www.ensembl.org/id/ENSRNOP00000004650.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Immunization against lysozyme-like proteins affect sperm function and fertility in the rat.", "journal": "Journal of reproductive immunology", "date": "2016", "authors": "Narmadha G, Yenugu S", "evidence": [ { "database": "RefSeq", "id": "NP_001129305", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129305" } ], "reference": [ { "type": "PubMed", "id": "27821286", "url": "https://glygen.org/publication/PubMed/27821286" } ] } ], "pathway": [ { "id": "rno:287751", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:287751", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O75951-1", "protein_name": "Lysozyme-like protein 6", "gene_name": "LYZL6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR", "length": 148 }, "evidence": [ { "id": "45224152", "url": "http://www.informatics.jax.org/homology/45224152", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9DA11-1", "protein_name": "Lysozyme-like protein 6", "gene_name": "Lyzl6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLKALFICVASCLLVVNDGNIIHRCSLAKILYEEDLDGFEGYSLPDWLCLAFVESNFNISKVNENVDGSFDYGIFQINSRYWCNDYQSHSENFCHVDCQELLSPNLISTIHCAKKIVSGPGGMKNWVEWKLHCLGRPLSYWMTGCHLG", "length": 148 }, "evidence": [ { "id": "45224152", "url": "http://www.informatics.jax.org/homology/45224152", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "fusion of sperm to egg plasma membrane involved in single fertilization", "id": "GO:0007342", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007342", "evidence": [ { "database": "UniProtKB", "id": "A0A077S6M4", "url": "https://www.uniprot.org/uniprot/A0A077S6M4" } ], "pmid": "" }, { "name": "fertilization", "id": "GO:0009566", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009566", "evidence": [ { "database": "UniProtKB", "id": "A0A077S6M4", "url": "https://www.uniprot.org/uniprot/A0A077S6M4" } ], "pmid": "" }, { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "A0A077S6M4", "url": "https://www.uniprot.org/uniprot/A0A077S6M4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "acrosomal vesicle", "id": "GO:0001669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001669", "evidence": [ { "database": "UniProtKB", "id": "A0A077S6M4", "url": "https://www.uniprot.org/uniprot/A0A077S6M4" } ], "pmid": "" }, { "name": "sperm flagellum", "id": "GO:0036126", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036126", "evidence": [ { "database": "UniProtKB", "id": "A0A077S6M4", "url": "https://www.uniprot.org/uniprot/A0A077S6M4" } ], "pmid": "" }, { "name": "sperm plasma membrane", "id": "GO:0097524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097524", "evidence": [ { "database": "UniProtKB", "id": "A0A077S6M4", "url": "https://www.uniprot.org/uniprot/A0A077S6M4" } ], "pmid": "" }, { "name": "sperm midpiece", "id": "GO:0097225", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097225", "evidence": [ { "database": "UniProtKB", "id": "A0A077S6M4", "url": "https://www.uniprot.org/uniprot/A0A077S6M4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "lysozyme activity", "id": "GO:0003796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003796", "evidence": [ { "database": "UniProtKB", "id": "A0A077S6M4", "url": "https://www.uniprot.org/uniprot/A0A077S6M4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 59, "end_pos": 61, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }