{ "uniprot_canonical_ac": "A0A077KA19-1", "uniprot_ac": "A0A077KA19", "uniprot_id": "A0A077KA19_MOUSE", "mass": { "chemical_mass": 35676.0, "monoisotopic_mass": 35676.0 }, "refseq": {}, "gene_names": [ { "name": "Cd200l2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A077KA19", "id": "A0A077KA19" }, { "name": "Gm17783", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A077KA19", "id": "A0A077KA19" }, { "name": "isec2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A077KA19", "id": "A0A077KA19" } ], "protein_names": [ { "name": "CD200 molecule like 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A077KA19" }, { "name": "ISEC2 protein, intestinal secretory cell protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A077KA19" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprot/A0A077KA19" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Cd200l2", "url": "https://www.uniprot.org/uniprot/A0A077KA19", "locus": { "chromosome": "16", "start_pos": 45332154, "end_pos": 45352413, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000116542", "url": "https://www.ensembl.org/id/ENSMUSG00000116542" } ] } } ], "crossref": [ { "id": "ENSMUSG00000116542", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000116542", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05846", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05846", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033321", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033321", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "5009947", "url": "http://www.informatics.jax.org/marker/MGI:5009947", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "TWQKIQN", "url": "https://omabrowser.org/oma/group/TWQKIQN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR46841", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46841", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46841:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46841:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "http://pfam.xfam.org/family/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprot/A0A077KA19", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A077KA19-1", "url": "https://www.uniprot.org/uniprot/A0A077KA19-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDFLLHCILHLLMLPPCAQESGSLQRIRHKNYETAVLGRNVTLFCNFSSLANVLQITWQKIQGSLPHNIGTYSHTYGEKILPPYVNRLQCKTLEPSASFMTIQGVTFEDEACYKCLFNIFPRGSHGGQTCLTILTVSELVTELQSAPGSEDLHSLLCSAVGKPAPGISIYPSQVTVQAPQEYFVQNANATVTVTKIYNISLKTARSLGLQNLVVSMTHPVRNEEKIVHLPVNQGGTTNPCLNWMITAIAFIILFFVSCIISAVLYIYFQKKRSEKVPKPSPTQDPYKTSTLMPPPPSTESENLITHTTRQILEVYMFLCH", "length": 320, "header": "tr|A0A077KA19-1|A0A077KA19_MOUSE Isoform 1 of ISEC2 protein, intestinal secretory cell protein 2 OS=Mus musculus OX=10090 GN=Cd200l2 PE=1 SV=1 CANONICAL=A0A077KA19-1" }, "isoforms": [ { "isoform_ac": "A0A077KA19-1", "url": "", "sequence": { "sequence": "MDFLLHCILHLLMLPPCAQESGSLQRIRHKNYETAVLGRNVTLFCNFSSLANVLQITWQKIQGSLPHNIGTYSHTYGEKILPPYVNRLQCKTLEPSASFMTIQGVTFEDEACYKCLFNIFPRGSHGGQTCLTILTVSELVTELQSAPGSEDLHSLLCSAVGKPAPGISIYPSQVTVQAPQEYFVQNANATVTVTKIYNISLKTARSLGLQNLVVSMTHPVRNEEKIVHLPVNQGGTTNPCLNWMITAIAFIILFFVSCIISAVLYIYFQKKRSEKVPKPSPTQDPYKTSTLMPPPPSTESENLITHTTRQILEVYMFLCH", "length": 320, "header": "tr|A0A077KA19-1|A0A077KA19_MOUSE Isoform 1 of ISEC2 protein, intestinal secretory cell protein 2 OS=Mus musculus OX=10090 GN=Cd200l2 PE=1 SV=1 CANONICAL=A0A077KA19-1" }, "locus": { "chromosome": "16", "start_pos": 45352350, "end_pos": 45332213, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000232600.2", "url": "https://www.ensembl.org/id/ENSMUST00000232600.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000155928.2", "url": "https://www.ensembl.org/id/ENSMUSP00000155928.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprot/A0A077KA19" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprot/A0A077KA19" } ], "pmid": "" }, { "name": "axon", "id": "GO:0030424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030424", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprot/A0A077KA19" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprot/A0A077KA19" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "regulation of immune response", "id": "GO:0050776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050776", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprot/A0A077KA19" } ], "pmid": "" }, { "name": "negative regulation of macrophage activation", "id": "GO:0043031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043031", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprot/A0A077KA19" } ], "pmid": "" }, { "name": "heterotypic cell-cell adhesion", "id": "GO:0034113", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034113", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprot/A0A077KA19" } ], "pmid": "" }, { "name": "negative regulation of neuroinflammatory response", "id": "GO:0150079", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150079", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprot/A0A077KA19" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "cell-cell adhesion mediator activity", "id": "GO:0098632", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098632", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprot/A0A077KA19" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 188, "end_pos": 190, "annotation": "n_glycosylation_sequon" }, { "start_pos": 198, "end_pos": 200, "annotation": "n_glycosylation_sequon" }, { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" }, { "start_pos": 46, "end_pos": 48, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }