{ "uniprot_canonical_ac": "A0A8D9UGU6-1", "uniprot_ac": "A0A8D9UGU6", "uniprot_id": "YK14A_YEAST", "mass": { "chemical_mass": 9566.0, "monoisotopic_mass": 9566.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Uncharacterized protein YKL104W-A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A8D9UGU6" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "A0A8D9UGU6", "url": "https://www.uniprot.org/uniprot/A0A8D9UGU6" } ], "common_name": "Yeast" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/A0A8D9UGU6", "locus": {} } ], "crossref": [ { "id": "PR_A0A8D9UGU6", "url": "http://purl.obolibrary.org/obo/PR_A0A8D9UGU6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "S000303811", "url": "https://www.yeastgenome.org/locus/S000303811", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8D9UGU6", "url": "https://www.uniprot.org/uniprot/A0A8D9UGU6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8D9UGU6-1", "url": "https://www.uniprot.org/uniprot/A0A8D9UGU6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNDHKLVFWVRSLRVTVNLFWSTVSSPSSMRNTTMRDKSNVSVRILLSNLLFQSTHFTDLLIDESRISFVTIDSNTGGIIASIF", "length": 84, "header": "sp|A0A8D9UGU6-1|YK14A_YEAST Isoform 1 of Uncharacterized protein YKL104W-A OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=A0A8D9UGU6-1" }, "isoforms": [ { "isoform_ac": "A0A8D9UGU6-1", "url": "", "sequence": { "sequence": "MNDHKLVFWVRSLRVTVNLFWSTVSSPSSMRNTTMRDKSNVSVRILLSNLLFQSTHFTDLLIDESRISFVTIDSNTGGIIASIF", "length": 84, "header": "sp|A0A8D9UGU6-1|YK14A_YEAST Isoform 1 of Uncharacterized protein YKL104W-A OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=A0A8D9UGU6-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "A0A8D9UGU6", "url": "https://www.uniprot.org/uniprot/A0A8D9UGU6" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Enrichment-based proteogenomics identifies microproteins, missing proteins, and novel smORFs in Saccharomyces cerevisiae.", "journal": "J. Proteome Res.", "date": "2018", "authors": "Zhang Y., He C., Xu P., Jia C.", "evidence": [ { "database": "UniProtKB", "id": "A0A8D9UGU6", "url": "https://www.uniprot.org/uniprot/A0A8D9UGU6" } ], "reference": [ { "type": "PubMed", "id": "29897761", "url": "https://glygen.org/publication/PubMed/29897761" } ] }, { "title": "Complete DNA sequence of yeast chromosome XI.", "journal": "Nature", "date": "1994", "authors": "Ansorge W., Duesterhoeft A., Mewes H.-W., Obermaier B., Wiemann S., Legrain P., Zimmermann J., Xu G., Rose M., Planta R.J., Colleaux L., Rieger M., Fukuhara H., Portetelle D., Mueller S., Becker I., Feldmann H., Kleine K., Gonzalez A., Hewitt N., Schwager C., Voss H., Jimenez A., Erfle H., Jauniaux J.-C., Jacquier A., Dion C., Maia e Silva A., Pallier C., Stegemann J., Andre B., Cheret G., Sor F., Haasemann M., Koetter P., Entian K.-D., Baladron V., Vilela C., Thierry A., Louis E.J., Hollenberg C.P., Marck C., Santos M.A., Soares H., Philippsen P., Poehlmann R., Vandenbol M., Domdey H., Garcia-Ramirez J.J., Pohl T.M., James C.M., Pfeiffer F., Ghazvini M., Ballesta J.P.G., Bossier P., Daignan-Fornier B., Dujon B., Esteban P.F., Fernandes L., Goffeau A., Hegemann J.H., Hilger F., Oliver S.G., Remacha M.A., Revuelta J.L., Rodrigues-Pousada C., Vissers S., del Rey F., van Dyck L., Alexandraki D., Bolotin-Fukuhara M., Duesterhus S., Guerreiro P., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Tzermia M., Urrestarazu L.A., Banrevi A., Bolle P.-A., Bou G., Boyer J., Buitrago M.J., Fobo G.M., Fritz C., Gabel C., Gaillon L., Garcia-Cantalejo J.M., Gent M.E., Grothues D., Horaitis O., Indge K.J., Keuchel H., Liebl S., Moestl D., Monnier A.-L., Pascolo S., Pohl F.M., Puzos V., Rasmussen S.W., Richard G.-F., Rupp T., Sensen C., Tettelin H., Valens M., van Vliet-Reedijk J.C., von Wettstein D.", "evidence": [ { "database": "UniProtKB", "id": "A0A8D9UGU6", "url": "https://www.uniprot.org/uniprot/A0A8D9UGU6" } ], "reference": [ { "type": "PubMed", "id": "8196765", "url": "https://glygen.org/publication/PubMed/8196765" } ] } ], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [ { "start_pos": 32, "end_pos": 34, "annotation": "n_glycosylation_sequon" }, { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }