{ "uniprot_canonical_ac": "A0A096MJS9-1", "uniprot_ac": "A0A096MJS9", "uniprot_id": "A0A096MJS9_RAT", "mass": { "chemical_mass": 67698.0, "monoisotopic_mass": 67698.0 }, "refseq": { "ac": "XP_003751543", "name": "N-acetyltransferase ESCO2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003751543" }, "gene_names": [ { "name": "Esco2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A096MJS9", "id": "A0A096MJS9" }, { "name": "Esco2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003751543", "id": "XP_003751543" } ], "protein_names": [ { "name": "Establishment of sister chromatid cohesion N-acetyltransferase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A096MJS9" }, { "name": "N-acetyltransferase ESCO2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003751543", "id": "XP_003751543" } ], "function": [], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ], "evidence": [ { "id": "1324", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] }, { "disease_id": "DOID:3910", "recommended_name": { "id": "DOID:3910", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3910", "name": "lung adenocarcinoma", "description": "A lung non-small cell carcinoma that derives_from epithelial cells of glandular origin." }, "synonyms": [ { "id": "DOID:3910", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3910", "name": "bronchogenic lung adenocarcinoma", "description": "" }, { "id": "DOID:3910", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3910", "name": "nonsmall cell adenocarcinoma", "description": "" } ], "evidence": [ { "id": "3910", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3910" } ] }, { "disease_id": "DOID:5325", "recommended_name": { "id": "DOID:5325", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5325", "name": "Roberts syndrome", "description": "A syndrome characterized by tetraphocomelia, craniofacial anomalies, growth retardation, intellectual disability, and cardiac and renal abnormalities that has_material_basis_in homozygous or compound heterozygous mutation in the ESCO2 gene on chromosome 8p21.1." }, "synonyms": [ { "id": "DOID:5325", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5325", "name": "SC phocomelia syndrome", "description": "" }, { "id": "DOID:5325", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5325", "name": "RBS", "description": "" }, { "id": "DOID:5325", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5325", "name": "LONG BONE DEFICIENCIES ASSOCIATED WITH CLEFT LIP-PALATE", "description": "" }, { "id": "DOID:5325", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5325", "name": "Roberts-Sc Phocomelia Syndrome", "description": "" }, { "id": "MONDO:0100253", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100253", "name": "Roberts-SC phocomelia syndrome", "description": "A rare genetic syndrome with an autosomal recessive pattern of inheritance. It is caused by a mutation in the ESCO2 gene. Clinical signs at birth include multiple limb and facial abnormalities." }, { "id": "MONDO:0100253", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100253", "name": "RBS", "description": "" }, { "id": "MONDO:0100253", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100253", "name": "Roberts-SC phocomelia syndrome", "description": "" }, { "id": "MONDO:0100253", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100253", "name": "long bone deficiencies associated with cleft lip-palate", "description": "" }, { "id": "MONDO:0100253", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100253", "name": "phocomelia-pseudothalidomide syndrome", "description": "" }, { "id": "MONDO:0100253", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100253", "name": "pseudothalidomide syndrome", "description": "" }, { "id": "MIM:268300", "resource": "MIM", "url": "https://www.omim.org/entry/268300", "name": "Roberts-SC phocomelia syndrome", "description": "Roberts-SC phocomelia syndrome" } ], "evidence": [ { "id": "5325", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5325" } ] }, { "disease_id": "DOID:7148", "recommended_name": { "id": "DOID:7148", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7148", "name": "rheumatoid arthritis", "description": "An arthritis that is an autoimmune disease which attacks healthy cells and tissue located_in joint." }, "synonyms": [ { "id": "DOID:7148", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7148", "name": "Arthritis or polyarthritis, rheumatic", "description": "" }, { "id": "DOID:7148", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7148", "name": "atrophic Arthritis", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "rheumatoid arthritis", "description": "A chronic, systemic autoimmune disorder characterized by inflammation in the synovial membranes and articular surfaces. It manifests primarily as a symmetric, erosive polyarthritis that spares the axial skeleton and is typically associated with the presence in the serum of rheumatoid factor." }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "atrophic arthritis", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "RA", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "arthritis or polyarthritis, rheumatic", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "arthritis, rheumatoid", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "autoimmune arthritis", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "rheumatoid arthritis", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "rheumatoid arthritis, progression of", "description": "" }, { "id": "MONDO:0008383", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008383", "name": "rheumatoid arthritis, susceptibility to", "description": "" }, { "id": "MIM:180300", "resource": "MIM", "url": "https://www.omim.org/entry/180300", "name": "Rheumatoid arthritis", "description": "Rheumatoid arthritis" } ], "evidence": [ { "id": "7148", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:7148" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "common_name": "Rat" } ], "gene": [ { "name": "Esco2", "url": "https://www.uniprot.org/uniprot/A0A096MJS9", "locus": { "chromosome": "15", "start_pos": 40034568, "end_pos": 40055306, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000015921", "url": "https://www.ensembl.org/id/ENSRNOG00000015921" } ] } } ], "crossref": [ { "id": "ENSRNOG00000015921", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000015921", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "691979", "url": "https://www.ncbi.nlm.nih.gov/gene/691979", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR028005", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028005", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028009", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028009", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:691979", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:691979", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HIQYHHR", "url": "https://omabrowser.org/oma/group/HIQYHHR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "22809at2759", "url": "http://www.orthodb.org/?query=22809at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45884", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45884", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45884:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45884:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13878", "url": "http://pfam.xfam.org/family/PF13878", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13880", "url": "http://pfam.xfam.org/family/PF13880", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2468052", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2468052", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_003751543", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003751543", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1593313", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1593313", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "45948", "url": "https://www.rhea-db.org/rhea/45948", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A096MJS9-1", "url": "https://www.uniprot.org/uniprot/A0A096MJS9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMMATFTPRKRKRHTLKADNDDSLLTDISSSKLRFAENLYSSPNKKHNCQSSVQKEEKPCSHQRHFSSSPLKTTENNMLSFANHSSLFKPVVSTVSFYNKNKHYLNPLERKLIRECKSICLATKNEDKPFPSVTEKIQRKPVCTKNKKRQKSLTANHQPNYKHVKSISRNLKNSKPSQVTYKPVVDKENSCFPPENPPNSPPRVLSQKIRPRVTLQGGAAFFVRKRNFLKKSPLEDKPLPILLQKNEPEVTEDALEAKQVPKSLLVGEKSNVELLDARSESEEKLGKNSSGAVVSSKECKLGKHNFPSEKSLENKTISSESVYSIFSVSSTNTKRSPSEEQSSVGSTACTNFLKQTNVQKNINFRDTNKGGKDQLVIDAGQKHFGTTMCKSCGMIYTASNPEDEIQHLQHHHRFLEGIKYVGWKRERIVAEFWDGKIVLVLPRDPSYAIKKVEDVQELVDLELGFQQVVPMCPNKTKTFLFIDEKRVVGCLIAEPIKQAFRVLSEPSTTKECSRAWRCSDVPEPAICGISRIWVFKLKRRKRIARRLVDTVRNCFMFGCFLSINEIAFSDPTPDGKLFATKYCNTPNFLVYNFHS", "length": 595, "header": "tr|A0A096MJS9-1|A0A096MJS9_RAT Isoform 1 of Establishment of sister chromatid cohesion N-acetyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Esco2 PE=4 SV=1 CANONICAL=A0A096MJS9-1" }, "isoforms": [ { "isoform_ac": "A0A096MJS9-1", "url": "", "sequence": { "sequence": "MMMATFTPRKRKRHTLKADNDDSLLTDISSSKLRFAENLYSSPNKKHNCQSSVQKEEKPCSHQRHFSSSPLKTTENNMLSFANHSSLFKPVVSTVSFYNKNKHYLNPLERKLIRECKSICLATKNEDKPFPSVTEKIQRKPVCTKNKKRQKSLTANHQPNYKHVKSISRNLKNSKPSQVTYKPVVDKENSCFPPENPPNSPPRVLSQKIRPRVTLQGGAAFFVRKRNFLKKSPLEDKPLPILLQKNEPEVTEDALEAKQVPKSLLVGEKSNVELLDARSESEEKLGKNSSGAVVSSKECKLGKHNFPSEKSLENKTISSESVYSIFSVSSTNTKRSPSEEQSSVGSTACTNFLKQTNVQKNINFRDTNKGGKDQLVIDAGQKHFGTTMCKSCGMIYTASNPEDEIQHLQHHHRFLEGIKYVGWKRERIVAEFWDGKIVLVLPRDPSYAIKKVEDVQELVDLELGFQQVVPMCPNKTKTFLFIDEKRVVGCLIAEPIKQAFRVLSEPSTTKECSRAWRCSDVPEPAICGISRIWVFKLKRRKRIARRLVDTVRNCFMFGCFLSINEIAFSDPTPDGKLFATKYCNTPNFLVYNFHS", "length": 595, "header": "tr|A0A096MJS9-1|A0A096MJS9_RAT Isoform 1 of Establishment of sister chromatid cohesion N-acetyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Esco2 PE=4 SV=1 CANONICAL=A0A096MJS9-1" }, "locus": { "chromosome": "15", "start_pos": 40050819, "end_pos": 40036087, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000076451.3", "url": "https://www.ensembl.org/id/ENSRNOT00000076451.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000068247.1", "url": "https://www.ensembl.org/id/ENSRNOP00000068247.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:691979", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:691979", "resource": "KEGG Pathway" }, { "id": "R-RNO-2468052", "name": "Establishment of Sister Chromatid Cohesion", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2468052", "resource": "Reactome", "description": "Establishment of Sister Chromatid Cohesion" } ], "orthologs": [ { "uniprot_canonical_ac": "Q56NI9-1", "protein_name": "N-acetyltransferase ESCO2", "gene_name": "ESCO2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAALTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGSPFKSALSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDKSFPIVTEKMQGKPVCSKKNNKKPQKSLTAKYQPKYRHIKPVSRNSRNSKQNRVIYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLRKSSLENEPSLGRTQKSKSEVIEDSDVETVSEKKTFATRQVPKCLVLEEKLKIGLLSASSKNKEKLIKDSSDDRVSSKEHKVDKNEAFSSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSVNFMKQTNIQKNTNTRDTSKKTKDQLIIDAGQKHFGATVCKSCGMIYTASNPEDEMQHVQHHHRFLEGIKYVGWKKERVVAEFWDGKIVLVLPHDPSFAIKKVEDVQELVDNELGFQQVVPKCPNKIKTFLFISDEKRVVGCLIAEPIKQAFRVLSEPIGPESPSSTECPRAWQCSDVPEPAVCGISRIWVFRLKRRKRIARRLVDTLRNCFMFGCFLSTDEIAFSDPTPDGKLFATKYCNTPNFLVYNFNS", "length": 601 }, "evidence": [ { "id": "45233880", "url": "http://www.informatics.jax.org/homology/45233880", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8CIB9-1", "protein_name": "N-acetyltransferase ESCO2", "gene_name": "Esco2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMATCTPRKRKRYTLNADNDDSLLTDISSSKLRCAENLFPSPNKKHNYQSSVQKEDKSCSHQLHFPSSPLKTTENSRFSFANHSSLFKPAMSTVSFYSKEKYYLNPLERKLIRECRSICLATESGDKPIPSVTENIQRKPVCTKKNKKKQKSLTAKYQPNYKHIKSKSRNLKNSKPNQVTYKPVVDQENSCFPAKNYPNSPPRVLSQKIKPQVTLQGGAAFFVRKRNSLKKLPLEDKPLLLQKNLPEVPEGAPEAKQIPKSLLVDEKSSVKVQNARSKNEEKLRKNPSGAVVSSKECNLDKHDFPSENSLDENKTISPESVYPIFNVSSVNTKRPEEQSSVGSTACTNFLKQTNVPKNINSRDTNKGGKDQLVIDAGQKHFGTTVCKSCGMIYTASNPEDEIQHLQHHHRFLEGIKFVGWKRERVVAEFWDGKIVLVLPRDPSYAIKKVEDVQELVDLELGFQQTVPVCPDKTKTFLFIDEKRVVGCLIAEPIKQAFRVLSEPSASKECSRAWRCSDVPEPAICGISRIWVFRLKRRKRIARRLVDTVRNCFMFGCFLSTNEIAFSDPTPDGKLFATKYCNTPNFLVYNFHN", "length": 592 }, "evidence": [ { "id": "45233880", "url": "http://www.informatics.jax.org/homology/45233880", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "peptide-lysine-N-acetyltransferase activity", "id": "GO:0061733", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061733", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "acetyltransferase activity", "id": "GO:0016407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016407", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "lysine N-acetyltransferase activity, acting on acetyl phosphate as donor", "id": "GO:0004468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004468", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "site of double-strand break", "id": "GO:0035861", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035861", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "chromosome", "id": "GO:0005694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005694", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "pericentric heterochromatin", "id": "GO:0005721", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005721", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "chromocenter", "id": "GO:0010369", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010369", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "XY body", "id": "GO:0001741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001741", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "chromosome segregation", "id": "GO:0007059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007059", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "double-strand break repair", "id": "GO:0006302", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006302", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "regulation of DNA replication", "id": "GO:0006275", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006275", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "hematopoietic progenitor cell differentiation", "id": "GO:0002244", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002244", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "mitotic sister chromatid cohesion", "id": "GO:0007064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007064", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "protein localization to chromatin", "id": "GO:0071168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071168", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" }, { "name": "post-translational protein acetylation", "id": "GO:0034421", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034421", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS9", "url": "https://www.uniprot.org/uniprot/A0A096MJS9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 288, "end_pos": 290, "annotation": "n_glycosylation_sequon" }, { "start_pos": 314, "end_pos": 316, "annotation": "n_glycosylation_sequon" }, { "start_pos": 474, "end_pos": 476, "annotation": "n_glycosylation_sequon" }, { "start_pos": 83, "end_pos": 85, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "45948", "name": "", "equation": "acetyl-CoA + L-lysyl-[protein] = CoA + H(+) + N(6)-acetyl-L-lysyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6JHU9-1", "Q9WVS9-1", "Q9EPU2-1", "Q9QXS4-1", "Q3MHC1-1", "Q5TKR9-1", "Q5XI06-1", "P62916-1", "Q5M939-1", "A0A8I6GLZ3-1", "D4ACX5-1", "Q99MK2-1", "Q00972-1", "A0A8I5Y222-1", "Q6DGG1-1", "Q92793-1", "Q9Y6F8-1", "O15516-1", "Q9H7Z6-1", "Q9Y6F7-1", "Q56NI9-1", "Q5FWF5-1", "Q09472-1", "O14929-1", "Q92831-1", "Q8WYB5-1", "Q92794-1", "Q92830-1", "Q15788-1", "Q9Y6Q9-1", "Q9H7X0-1", "Q9UKN8-1", "Q92993-1", "Q00403-1", "P21675-1", "Q96IU4-1", "Q9JIY8-1", "Q9DBU2-1", "O08785-1", "P45481-1", "Q9WTK2-1", "Q8CIB9-1", "B2RWS6-1", "Q69Z69-1", "Q8CHK4-1", "Q9JHD2-1", "Q8BY71-1", "Q8BZ21-1", "Q8BRB7-1", "Q5SVQ0-1", "Q9JHD1-1", "Q9D1P2-1", "P70365-1", "O09000-1", "P62915-1", "Q8BMQ2-1", "Q80UV9-1", "E0CYR6-1", "Q8VCR7-1", "P46677-1", "Q07794-1", "Q08649-1", "P39979-1", "Q06592-1", "Q12341-1", "P34218-1", "P40963-1", "Q03330-1", "B0G130-1", "Q869X7-1", "Q86J12-1", "Q869X5-1", "Q960X4-1", "Q95SX8-1", "Q9W1A9-1", "O02193-1", "Q0KIB3-1", "Q9VAV6-1" ], "evidence": [ { "id": "45948", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45948" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A8I5Y222", "gene_name": "Kat2b", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "A0A8I5Y222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5Y222" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "A0A8I5Y222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5Y222" } ] } ] }, { "uniprot_ac": "A0A8I6GLZ3", "gene_name": "Kat6b", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "A0A8I6GLZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6GLZ3" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "A0A8I6GLZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6GLZ3" } ] } ] }, { "uniprot_ac": "B0G130", "gene_name": "", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "B0G130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0G130" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "B0G130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0G130" } ] } ] }, { "uniprot_ac": "B2RWS6", "gene_name": "Ep300", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "B2RWS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RWS6" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "B2RWS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RWS6" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "B2RWS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RWS6" } ] } ] }, { "uniprot_ac": "D4ACX5", "gene_name": "Kat2a", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "D4ACX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACX5" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "D4ACX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACX5" } ] } ] }, { "uniprot_ac": "E0CYR6", "gene_name": "Nat8f7", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "E0CYR6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E0CYR6" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "E0CYR6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E0CYR6" } ] } ] }, { "uniprot_ac": "O02193", "gene_name": "mof", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "O02193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O02193" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "O02193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O02193" } ] } ] }, { "uniprot_ac": "O08785", "gene_name": "Clock", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "O08785", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08785" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "O08785", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08785" } ] } ] }, { "uniprot_ac": "O09000", "gene_name": "Ncoa3", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "O09000", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09000" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "O09000", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09000" } ] } ] }, { "uniprot_ac": "O14929", "gene_name": "HAT1", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "O14929", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14929" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "O14929", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14929" } ] } ] }, { "uniprot_ac": "O15516", "gene_name": "CLOCK", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "O15516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15516" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "O15516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15516" } ] } ] }, { "uniprot_ac": "P21675", "gene_name": "TAF1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P21675", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21675" } ] }, { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "P21675", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21675" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P21675", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21675" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "P21675", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21675" } ] } ] }, { "uniprot_ac": "P34218", "gene_name": "SAS3", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "P34218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34218" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "P34218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34218" } ] } ] }, { "uniprot_ac": "P39979", "gene_name": "HPA3", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "P39979", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39979" } ] }, { "ec_number": "2.3.1.36", "activity": "a D-alpha-amino acid + acetyl-CoA = an N-acetyl-D-amino acid + CoA + H(+).", "evidence": [ { "id": "P39979", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39979" } ] }, { "ec_number": "2.3.1.36", "activity": "", "evidence": [ { "id": "P39979", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39979" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "P39979", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39979" } ] } ] }, { "uniprot_ac": "P40963", "gene_name": "SAS2", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "P40963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40963" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "P40963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40963" } ] } ] }, { "uniprot_ac": "P45481", "gene_name": "Crebbp", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "P45481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45481" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "P45481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45481" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "P45481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45481" } ] } ] }, { "uniprot_ac": "P46677", "gene_name": "TAF1", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "P46677", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46677" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "P46677", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46677" } ] } ] }, { "uniprot_ac": "P62915", "gene_name": "Gtf2b", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "P62915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62915" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "P62915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62915" } ] } ] }, { "uniprot_ac": "P62916", "gene_name": "Gtf2b", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "P62916", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62916" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "P62916", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62916" } ] } ] }, { "uniprot_ac": "P70365", "gene_name": "Ncoa1", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "P70365", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70365" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "P70365", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70365" } ] } ] }, { "uniprot_ac": "Q00403", "gene_name": "GTF2B", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q00403", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00403" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q00403", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00403" } ] } ] }, { "uniprot_ac": "Q00972", "gene_name": "Bckdk", "activity": [ { "ec_number": "2.7.11.4", "activity": "ATP + L-seryl-[3-methyl-2-oxobutanoate dehydrogenase] = ADP + H(+) + O-phospho-L-seryl-[3-methyl-2-oxobutanoate dehydrogenase].", "evidence": [ { "id": "Q00972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00972" } ] }, { "ec_number": "2.7.11.4", "activity": "", "evidence": [ { "id": "Q00972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00972" } ] }, { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q00972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00972" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q00972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00972" } ] } ] }, { "uniprot_ac": "Q03330", "gene_name": "GCN5", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q03330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03330" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q03330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03330" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q03330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03330" } ] } ] }, { "uniprot_ac": "Q06592", "gene_name": "HPA2", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q06592", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06592" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q06592", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06592" } ] } ] }, { "uniprot_ac": "Q07794", "gene_name": "RTT109", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q07794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07794" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q07794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07794" } ] } ] }, { "uniprot_ac": "Q08649", "gene_name": "ESA1", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q08649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08649" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q08649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08649" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q08649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08649" } ] } ] }, { "uniprot_ac": "Q09472", "gene_name": "EP300", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q09472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09472" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q09472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09472" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q09472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09472" } ] } ] }, { "uniprot_ac": "Q0KIB3", "gene_name": "Hat1", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q0KIB3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0KIB3" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q0KIB3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0KIB3" } ] } ] }, { "uniprot_ac": "Q12341", "gene_name": "HAT1", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q12341", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12341" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q12341", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12341" } ] } ] }, { "uniprot_ac": "Q15788", "gene_name": "NCOA1", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q15788", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15788" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q15788", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15788" } ] } ] }, { "uniprot_ac": "Q3MHC1", "gene_name": "Naa60", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q3MHC1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MHC1" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q3MHC1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MHC1" } ] }, { "ec_number": "2.3.1.259", "activity": "acetyl-CoA + N-terminal L-methionyl-[transmembrane protein] = CoA + H(+) + N-terminal N(alpha)-acetyl-L-methionyl-[transmembrane protein].", "evidence": [ { "id": "Q3MHC1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MHC1" } ] }, { "ec_number": "2.3.1.259", "activity": "", "evidence": [ { "id": "Q3MHC1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MHC1" } ] } ] }, { "uniprot_ac": "Q56NI9", "gene_name": "ESCO2", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q56NI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q56NI9" } ] } ] }, { "uniprot_ac": "Q5FWF5", "gene_name": "ESCO1", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q5FWF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FWF5" } ] } ] }, { "uniprot_ac": "Q5M939", "gene_name": "Hat1", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q5M939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5M939" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q5M939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5M939" } ] } ] }, { "uniprot_ac": "Q5SVQ0", "gene_name": "Kat7", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q5SVQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SVQ0" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q5SVQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SVQ0" } ] } ] }, { "uniprot_ac": "Q5TKR9", "gene_name": "Kat6a", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q5TKR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TKR9" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q5TKR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TKR9" } ] } ] }, { "uniprot_ac": "Q5XI06", "gene_name": "Kat8", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q5XI06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI06" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q5XI06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI06" } ] } ] }, { "uniprot_ac": "Q69Z69", "gene_name": "Esco1", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q69Z69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69Z69" } ] } ] }, { "uniprot_ac": "Q6DGG1", "gene_name": "Abhd14b", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q6DGG1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6DGG1" } ] } ] }, { "uniprot_ac": "Q6JHU9", "gene_name": "Crebbp", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q6JHU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6JHU9" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q6JHU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6JHU9" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q6JHU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6JHU9" } ] } ] }, { "uniprot_ac": "Q80UV9", "gene_name": "Taf1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80UV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UV9" } ] }, { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q80UV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UV9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q80UV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UV9" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q80UV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UV9" } ] } ] }, { "uniprot_ac": "Q869X5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q869X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869X5" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q869X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869X5" } ] } ] }, { "uniprot_ac": "Q869X7", "gene_name": "", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q869X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869X7" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q869X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869X7" } ] } ] }, { "uniprot_ac": "Q86J12", "gene_name": "", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q86J12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86J12" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q86J12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86J12" } ] } ] }, { "uniprot_ac": "Q8BMQ2", "gene_name": "Gtf3c4", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q8BMQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BMQ2" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q8BMQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BMQ2" } ] } ] }, { "uniprot_ac": "Q8BRB7", "gene_name": "Kat6b", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q8BRB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BRB7" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q8BRB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BRB7" } ] } ] }, { "uniprot_ac": "Q8BY71", "gene_name": "Hat1", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q8BY71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BY71" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q8BY71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BY71" } ] } ] }, { "uniprot_ac": "Q8BZ21", "gene_name": "Kat6a", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q8BZ21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ21" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q8BZ21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ21" } ] } ] }, { "uniprot_ac": "Q8CHK4", "gene_name": "Kat5", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q8CHK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHK4" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q8CHK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHK4" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8CHK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHK4" } ] } ] }, { "uniprot_ac": "Q8CIB9", "gene_name": "Esco2", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8CIB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIB9" } ] } ] }, { "uniprot_ac": "Q8VCR7", "gene_name": "Abhd14b", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8VCR7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCR7" } ] } ] }, { "uniprot_ac": "Q8WYB5", "gene_name": "KAT6B", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q8WYB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WYB5" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q8WYB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WYB5" } ] } ] }, { "uniprot_ac": "Q92793", "gene_name": "CREBBP", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q92793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92793" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q92793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92793" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q92793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92793" } ] } ] }, { "uniprot_ac": "Q92794", "gene_name": "KAT6A", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q92794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92794" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q92794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92794" } ] } ] }, { "uniprot_ac": "Q92830", "gene_name": "KAT2A", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q92830", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92830" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q92830", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92830" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q92830", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92830" } ] } ] }, { "uniprot_ac": "Q92831", "gene_name": "KAT2B", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q92831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92831" } ] }, { "ec_number": "2.3.1.57", "activity": "acetyl-CoA + an alkane-alpha,omega-diamine = an N-acetylalkane-alpha,omega-diamine + CoA + H(+).", "evidence": [ { "id": "Q92831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92831" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q92831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92831" } ] } ] }, { "uniprot_ac": "Q92993", "gene_name": "KAT5", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q92993", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92993" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q92993", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92993" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q92993", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92993" } ] } ] }, { "uniprot_ac": "Q95SX8", "gene_name": "Naa60", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q95SX8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95SX8" } ] }, { "ec_number": "2.3.1.259", "activity": "acetyl-CoA + N-terminal L-methionyl-[transmembrane protein] = CoA + H(+) + N-terminal N(alpha)-acetyl-L-methionyl-[transmembrane protein].", "evidence": [ { "id": "Q95SX8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95SX8" } ] }, { "ec_number": "2.3.1.259", "activity": "", "evidence": [ { "id": "Q95SX8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95SX8" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q95SX8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95SX8" } ] } ] }, { "uniprot_ac": "Q960X4", "gene_name": "Tip60", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q960X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q960X4" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q960X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q960X4" } ] } ] }, { "uniprot_ac": "Q96IU4", "gene_name": "ABHD14B", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q96IU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96IU4" } ] } ] }, { "uniprot_ac": "Q99MK2", "gene_name": "Kat5", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q99MK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MK2" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q99MK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MK2" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q99MK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MK2" } ] } ] }, { "uniprot_ac": "Q9D1P2", "gene_name": "Kat8", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9D1P2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1P2" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9D1P2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1P2" } ] } ] }, { "uniprot_ac": "Q9DBU2", "gene_name": "Naa60", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9DBU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBU2" } ] }, { "ec_number": "2.3.1.259", "activity": "acetyl-CoA + N-terminal L-methionyl-[transmembrane protein] = CoA + H(+) + N-terminal N(alpha)-acetyl-L-methionyl-[transmembrane protein].", "evidence": [ { "id": "Q9DBU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBU2" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9DBU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBU2" } ] }, { "ec_number": "2.3.1.259", "activity": "", "evidence": [ { "id": "Q9DBU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBU2" } ] } ] }, { "uniprot_ac": "Q9EPU2", "gene_name": "Ncoa3", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9EPU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EPU2" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9EPU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EPU2" } ] } ] }, { "uniprot_ac": "Q9H7X0", "gene_name": "NAA60", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9H7X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H7X0" } ] }, { "ec_number": "2.3.1.259", "activity": "acetyl-CoA + N-terminal L-methionyl-[transmembrane protein] = CoA + H(+) + N-terminal N(alpha)-acetyl-L-methionyl-[transmembrane protein].", "evidence": [ { "id": "Q9H7X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H7X0" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9H7X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H7X0" } ] }, { "ec_number": "2.3.1.259", "activity": "", "evidence": [ { "id": "Q9H7X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H7X0" } ] } ] }, { "uniprot_ac": "Q9H7Z6", "gene_name": "KAT8", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9H7Z6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H7Z6" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9H7Z6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H7Z6" } ] } ] }, { "uniprot_ac": "Q9JHD1", "gene_name": "Kat2b", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9JHD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHD1" } ] }, { "ec_number": "2.3.1.57", "activity": "acetyl-CoA + an alkane-alpha,omega-diamine = an N-acetylalkane-alpha,omega-diamine + CoA + H(+).", "evidence": [ { "id": "Q9JHD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHD1" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9JHD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHD1" } ] } ] }, { "uniprot_ac": "Q9JHD2", "gene_name": "Kat2a", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9JHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHD2" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9JHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHD2" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9JHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHD2" } ] } ] }, { "uniprot_ac": "Q9JIY8", "gene_name": "Nat8f3", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9JIY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIY8" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9JIY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIY8" } ] } ] }, { "uniprot_ac": "Q9QXS4", "gene_name": "Nat8f3", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9QXS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXS4" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9QXS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXS4" } ] } ] }, { "uniprot_ac": "Q9UKN8", "gene_name": "GTF3C4", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9UKN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UKN8" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9UKN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UKN8" } ] } ] }, { "uniprot_ac": "Q9VAV6", "gene_name": "Dmel\\CG1894", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9VAV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VAV6" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9VAV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VAV6" } ] } ] }, { "uniprot_ac": "Q9W1A9", "gene_name": "enok", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9W1A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W1A9" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9W1A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W1A9" } ] } ] }, { "uniprot_ac": "Q9WTK2", "gene_name": "Cdyl", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9WTK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTK2" } ] }, { "ec_number": "4.2.1.-", "activity": "", "evidence": [ { "id": "Q9WTK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTK2" } ] } ] }, { "uniprot_ac": "Q9WVS9", "gene_name": "Clock", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9WVS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVS9" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9WVS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVS9" } ] } ] }, { "uniprot_ac": "Q9Y6F7", "gene_name": "CDY2A", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9Y6F7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6F7" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9Y6F7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6F7" } ] } ] }, { "uniprot_ac": "Q9Y6F8", "gene_name": "CDY1B", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9Y6F8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6F8" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9Y6F8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6F8" } ] } ] }, { "uniprot_ac": "Q9Y6Q9", "gene_name": "NCOA3", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q9Y6Q9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6Q9" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q9Y6Q9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6Q9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }