{ "uniprot_canonical_ac": "A0A096MJS6-1", "uniprot_ac": "A0A096MJS6", "uniprot_id": "A0A096MJS6_RAT", "mass": { "chemical_mass": 18844.0, "monoisotopic_mass": 18844.0 }, "refseq": { "ac": "XP_006241819", "name": "lymphocyte antigen 6E isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006241819" }, "gene_names": [ { "name": "Ly6e", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A096MJS6", "id": "A0A096MJS6" }, { "name": "Ly6e", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006241821", "id": "XP_006241821" } ], "protein_names": [ { "name": "Lymphocyte antigen 6 family member E", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A096MJS6" }, { "name": "lymphocyte antigen 6E isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006241819", "id": "XP_006241819" }, { "name": "lymphocyte antigen 6E isoform X2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006241821", "id": "XP_006241821" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ly6e", "url": "https://www.uniprot.org/uniprot/A0A096MJS6", "locus": { "chromosome": "7", "start_pos": 106939689, "end_pos": 106935761, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000007091", "url": "https://www.ensembl.org/id/ENSRNOG00000007091" } ] } } ], "crossref": [ { "id": "ENSRNOG00000007091", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000007091", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00117", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00117", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "362934", "url": "https://www.ncbi.nlm.nih.gov/gene/362934", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR016054", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016054", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045860", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045860", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:362934", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:362934", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HSNWNCL", "url": "https://omabrowser.org/oma/group/HSNWNCL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4256072at2759", "url": "http://www.orthodb.org/?query=4256072at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16983", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16983", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16983:SF13", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16983:SF13", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00021", "url": "http://pfam.xfam.org/family/PF00021", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_006241819", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006241819", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1565342", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1565342", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A096MJS6-1", "url": "https://www.uniprot.org/uniprot/A0A096MJS6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6HS00", "url": "https://www.uniprot.org/uniprot/A6HS00", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6HS00-1", "url": "https://www.uniprot.org/uniprot/A6HS00-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRTGPTGLGTELGHLELPLPTTRCQQGSGQERPKASLACDLQQMSAASSMRVFLPVLLAALLGVEQVHSLMCFSCTDQKNNINCLWPVSCSSTDNYCITLSAAAGFGNVNLGYTLNKGCSPTCPRENININLGVASVNSYCCQSSFCNFSTAGLGLRASIPLLGLGLLLSLLAVLRLSP", "length": 179, "header": "tr|A0A096MJS6-1|A0A096MJS6_RAT Isoform 1 of Lymphocyte antigen 6 family member E OS=Rattus norvegicus OX=10116 GN=Ly6e PE=4 SV=2 CANONICAL=A0A096MJS6-1" }, "isoforms": [ { "isoform_ac": "A0A096MJS6-1", "url": "", "sequence": { "sequence": "MRTGPTGLGTELGHLELPLPTTRCQQGSGQERPKASLACDLQQMSAASSMRVFLPVLLAALLGVEQVHSLMCFSCTDQKNNINCLWPVSCSSTDNYCITLSAAAGFGNVNLGYTLNKGCSPTCPRENININLGVASVNSYCCQSSFCNFSTAGLGLRASIPLLGLGLLLSLLAVLRLSP", "length": 179, "header": "tr|A0A096MJS6-1|A0A096MJS6_RAT Isoform 1 of Lymphocyte antigen 6 family member E OS=Rattus norvegicus OX=10116 GN=Ly6e PE=4 SV=2 CANONICAL=A0A096MJS6-1" }, "locus": { "chromosome": "7", "start_pos": 106939070, "end_pos": 106936997, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000076790.3", "url": "https://www.ensembl.org/id/ENSRNOT00000076790.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000068244.2", "url": "https://www.ensembl.org/id/ENSRNOP00000068244.2" } ] } }, { "isoform_ac": "A6HS00-1", "url": "", "sequence": { "sequence": "MSAASSMRVFLPVLLAALLGVEQVHSLMCFSCTDQKNNINCLWPVSCSSTDNYCITLSAAAGFGNVNLGYTLNKGCSPTCPRENININLGVASVNSYCCQSSFCNFSTAGLGLRASIPLLGLGLLLSLLAVLRLSP", "length": 136, "header": "tr|A6HS00-1|A6HS00_RAT Computationally mapped isoform of Lymphocyte antigen 6 family member E OS=Rattus norvegicus OX=10116 GN=Ly6e PE=2 SV=1 CANONICAL=A0A096MJS6-1" }, "locus": { "chromosome": "7", "start_pos": 106939070, "end_pos": 106938165, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000009333.7", "url": "https://www.ensembl.org/id/ENSRNOT00000009333.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000009333.3", "url": "https://www.ensembl.org/id/ENSRNOP00000009333.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:362934", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:362934", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q64253-1", "protein_name": "Lymphocyte antigen 6E", "gene_name": "Ly6e", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP", "length": 136 }, "evidence": [ { "id": "45241983", "url": "http://www.informatics.jax.org/homology/45241983", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "epinephrine secretion", "id": "GO:0048242", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048242", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6" } ], "pmid": "" }, { "name": "in utero embryonic development", "id": "GO:0001701", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001701", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6" } ], "pmid": "" }, { "name": "acetylcholine receptor signaling pathway", "id": "GO:0095500", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0095500", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6" } ], "pmid": "" }, { "name": "norepinephrine metabolic process", "id": "GO:0042415", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042415", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6" } ], "pmid": "" }, { "name": "adrenal gland development", "id": "GO:0030325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030325", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6" } ], "pmid": "" }, { "name": "organ growth", "id": "GO:0035265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035265", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6" } ], "pmid": "" }, { "name": "ventricular cardiac muscle tissue morphogenesis", "id": "GO:0055010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055010", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6" } ], "pmid": "" }, { "name": "negative regulation of viral entry into host cell", "id": "GO:0046597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046597", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "acetylcholine receptor binding", "id": "GO:0033130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033130", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6" } ], "pmid": "" }, { "name": "acetylcholine receptor inhibitor activity", "id": "GO:0030550", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030550", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJS6", "url": "https://www.uniprot.org/uniprot/A0A096MJS6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 148, "end_pos": 150, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }