{
    "uniprot_canonical_ac": "Q9ZZW1-1",
    "uniprot_ac": "Q9ZZW1",
    "uniprot_id": "Q0182_YEAST",
    "mass": {
        "chemical_mass": 16269.0,
        "monoisotopic_mass": 16269.0
    },
    "refseq": {},
    "gene_names": [
        {
            "name": "ORF11",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9ZZW1",
            "id": "Q9ZZW1"
        }
    ],
    "protein_names": [
        {
            "name": "Putative uncharacterized protein Q0182, mitochondrial",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q9ZZW1"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9ZZW1",
                    "url": "https://www.uniprot.org/uniprot/Q9ZZW1"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "",
            "url": "https://www.uniprot.org/uniprot/Q9ZZW1",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "S000007280",
            "url": "https://www.yeastgenome.org/locus/S000007280",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "Q9ZZW1",
            "url": "https://www.uniprot.org/uniprot/Q9ZZW1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9ZZW1-1",
            "url": "https://www.uniprot.org/uniprot/Q9ZZW1-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MVSGPGHGSRNPERSFIINMKRVRMMMNSFNLFLMKYNFKMVFMVRPAPRGGADPEGVRSGINYNNYINIIIIYYIMMYLFMFYNINNYFMFNKYNMYIIFFNNYTINSYFGGIGRHDTTKMYYFTVWRFKSFK",
        "length": 134,
        "header": "sp|Q9ZZW1-1|Q0182_YEAST Isoform 1 of Putative uncharacterized protein Q0182, mitochondrial  OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=5 SV=1 CANONICAL=Q9ZZW1-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q9ZZW1-1",
            "url": "",
            "sequence": {
                "sequence": "MVSGPGHGSRNPERSFIINMKRVRMMMNSFNLFLMKYNFKMVFMVRPAPRGGADPEGVRSGINYNNYINIIIIYYIMMYLFMFYNINNYFMFNKYNMYIIFFNNYTINSYFGGIGRHDTTKMYYFTVWRFKSFK",
                "length": 134,
                "header": "sp|Q9ZZW1-1|Q0182_YEAST Isoform 1 of Putative uncharacterized protein Q0182, mitochondrial  OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=5 SV=1 CANONICAL=Q9ZZW1-1"
            },
            "locus": {
                "chromosome": "Mitochondrion",
                "start_pos": 66171,
                "end_pos": 65770,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "Q0182_mRNA",
                        "url": "https://www.ensembl.org/id/Q0182_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "Q0182",
                        "url": "https://www.ensembl.org/id/Q0182"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9ZZW1",
                    "url": "https://www.uniprot.org/uniprot/Q9ZZW1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "The complete sequence of the mitochondrial genome of Saccharomyces cerevisiae.",
            "journal": "FEBS Lett.",
            "date": "1998",
            "authors": "Foury F., Purnelle B., Lecrenier N., Roganti T.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9ZZW1",
                    "url": "https://www.uniprot.org/uniprot/Q9ZZW1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9872396",
                    "url": "https://glygen.org/publication/PubMed/9872396"
                }
            ]
        }
    ],
    "pathway": [],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "mitochondrion",
                        "id": "GO:0005739",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9ZZW1",
                                "url": "https://www.uniprot.org/uniprot/Q9ZZW1"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 104,
            "end_pos": 106,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}