{ "uniprot_canonical_ac": "Q9Z2M4-1", "uniprot_ac": "Q9Z2M4", "uniprot_id": "DECR2_RAT", "mass": { "chemical_mass": 31292.0, "monoisotopic_mass": 31292.0 }, "refseq": { "ac": "NP_001102948", "name": "nucleoside diphosphate kinase, mitochondrial", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102948" }, "gene_names": [ { "name": "Decr2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9Z2M4", "id": "Q9Z2M4" }, { "name": "Nme4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9Z2M4", "id": "Q9Z2M4" }, { "name": "Rab11fip3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9Z2M4", "id": "Q9Z2M4" }, { "name": "Decr2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9Z2M4", "id": "Q9Z2M4" }, { "name": "Nme4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102948", "id": "NP_001102948" }, { "name": "Nme4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9Z2M4", "id": "Q9Z2M4" }, { "name": "Rab11fip3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9Z2M4", "id": "Q9Z2M4" } ], "protein_names": [ { "name": "Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9Z2M4" }, { "name": "1.3.1.124", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2M4" }, { "name": "2,4-dienoyl-CoA reductase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2M4" }, { "name": "DCR-AKL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2M4" }, { "name": "expressed in non-metastatic cells 4, protein; nucleoside diphosphate kinase 4; non-metastatic cells 4, protein expressed in", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102948", "id": "NP_001102948" }, { "name": "nucleoside diphosphate kinase, mitochondrial", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102948", "id": "NP_001102948" }, { "name": "pVI-AKL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2M4" }, { "name": "peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006246086", "id": "XP_006246086" } ], "function": [ { "annotation": "Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4#function" }, { "database": "PubMed", "id": "10333503", "url": "https://glygen.org/publication/PubMed/10333503" }, { "database": "PubMed", "id": "11514237", "url": "https://glygen.org/publication/PubMed/11514237" } ] }, { "annotation": "NM23-H4 binds the inner mitochondrial membrane with high affinity to cardiolipin and couples nucleotide transfer with respiration", "evidence": [ { "database": "RefSeq", "id": "NP_001102948", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102948" }, { "database": "PubMed", "id": "18635542", "url": "https://glygen.org/publication/PubMed/18635542" } ] }, { "annotation": "Nm23-H4 acts as a lipid-dependent mitochondrial switch with dual function in phosphotransfer serving local GTP supply and cardiolipin transfer for apoptotic signaling and putative other functions", "evidence": [ { "database": "RefSeq", "id": "NP_001102948", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102948" }, { "database": "PubMed", "id": "23150663", "url": "https://glygen.org/publication/PubMed/23150663" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "common_name": "Rat" } ], "gene": [ { "name": "Decr2", "url": "https://www.uniprot.org/uniprot/Q9Z2M4", "locus": {} } ], "crossref": [ { "id": "ENSRNOG00000050424", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000050424", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "1.3.1.124", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.3.1.124&UniProtAcc=Q9Z2M4", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd00051", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00051", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd04413", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04413", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd05369", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05369", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "303002", "url": "https://www.ncbi.nlm.nih.gov/gene/303002", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "64461", "url": "https://www.ncbi.nlm.nih.gov/gene/64461", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "685679", "url": "https://www.ncbi.nlm.nih.gov/gene/685679", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9Z2M4", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9Z2M4*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000597", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000597", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001564", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001564", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009000", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009000", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019018", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019018", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019926", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019926", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023005", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023005", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034907", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034907", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036291", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036291", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036850", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036850", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037245", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037245", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045017", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045017", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045077", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045077", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:303002", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:303002", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "rno:64461", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:64461", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "rno:685679", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:685679", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MQAHVCA", "url": "https://omabrowser.org/oma/group/MQAHVCA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2092693at2759", "url": "http://www.orthodb.org/?query=2092693at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "3075753at2759", "url": "http://www.orthodb.org/?query=3075753at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11349", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11349", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11349:SF49", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11349:SF49", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11363", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11363", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11363:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11363:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15726", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15726", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15726:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15726:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43296", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43296", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43296:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43296:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00297", "url": "http://pfam.xfam.org/family/PF00297", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00334", "url": "http://pfam.xfam.org/family/PF00334", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF09457", "url": "http://pfam.xfam.org/family/PF09457", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13561", "url": "http://pfam.xfam.org/family/PF13561", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9Z2M4", "url": "http://purl.obolibrary.org/obo/PR_Q9Z2M4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-390247", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9033241", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_006246086", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006246086", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1308952", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1308952", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "1591334", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1591334", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "71002", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=71002", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "18113", "url": "https://www.rhea-db.org/rhea/18113", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "44640", "url": "https://www.rhea-db.org/rhea/44640", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "44912", "url": "https://www.rhea-db.org/rhea/44912", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "44916", "url": "https://www.rhea-db.org/rhea/44916", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "44920", "url": "https://www.rhea-db.org/rhea/44920", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "45912", "url": "https://www.rhea-db.org/rhea/45912", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "61892", "url": "https://www.rhea-db.org/rhea/61892", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A8I5ZQX0", "url": "https://www.uniprot.org/uniprot/A0A8I5ZQX0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZQX0-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZQX0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZUA1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZUA1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZUA1-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZUA1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AJE6", "url": "https://www.uniprot.org/uniprot/A0A8I6AJE6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AJE6-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AJE6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GLH8", "url": "https://www.uniprot.org/uniprot/A0A8I6GLH8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GLH8-1", "url": "https://www.uniprot.org/uniprot/A0A8I6GLH8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GLQ6", "url": "https://www.uniprot.org/uniprot/A0A8I6GLQ6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GLQ6-1", "url": "https://www.uniprot.org/uniprot/A0A8I6GLQ6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZMT9", "url": "https://www.uniprot.org/uniprot/D3ZMT9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZMT9-1", "url": "https://www.uniprot.org/uniprot/D3ZMT9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7F3L0", "url": "https://www.uniprot.org/uniprot/F7F3L0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7F3L0-1", "url": "https://www.uniprot.org/uniprot/F7F3L0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6TXF6", "url": "https://www.uniprot.org/uniprot/Q6TXF6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6TXF6-1", "url": "https://www.uniprot.org/uniprot/Q6TXF6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z2M4-1", "url": "https://www.uniprot.org/uniprot/Q9Z2M4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTQQPPDVEEDDCLSEYHHLFCPDLLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVSRSLPRVSEAAKKLVAATGKRCLPLSMDVRVPPAVMAAVDQALKEFGKIDILINCAAGNFLCPASALSFNAFKTVVDIDTLGTFNVSRVLYEKFFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLGGPKASSKFKYLSSPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTLPNDIGRLLEFESSSAKL", "length": 292, "header": "sp|Q9Z2M4-1|DECR2_RAT Isoform 1 of Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Rattus norvegicus OX=10116 GN=Decr2 PE=1 SV=1 CANONICAL=Q9Z2M4-1" }, "isoforms": [ { "isoform_ac": "A0A8I5ZQX0-1", "url": "", "sequence": { "sequence": "MELSQPTSLSDHDEPASGPQRGVKGLVGPDAPRGWSDEPEEHAQLQRWPEGPNAPICWPEEVEEPHAPRRWAEEPSASRCLSQEPYESCHLAKELEEPDAPRCSSQEPDAPCHLAKDLEETDSPRCWPLEPDAPCHLAKEWEEPDVPRCWPQEPDAPCHLAKYLEEPDAPLCWPQEPDAFCYLLKEVEEPDVPRCRPQEPDAPCHLAEELEDLDAPRCWTQEPNESCNLAKELDEPDTPRCLSQEPDAPCLLAKEWEESDAPSCWPQEPDVGPQEPDVGCHLAKEREESDAPCLLTEELKEPDALQCWPQESDAPCLLAEELEEPDAPHCCSQEVDTECLSAKESEEPDASHLWPGEPDAPCLLVKEPEEADAPHCWPEEPEEPDALNAPCFWANEPDEPDAPRCWSEEPQVLCLWPEEQNTTQCWQEEPDASCFWSEDREEPKVSCLQFKEPEKPKVACSWPEELEDCCPTRGLPLEPLLAEGELLQACPGPPPDPGLALSLPSEPGTAQEEGARLRTVFDALDRDGDGFVRIEDFIQFATVYGAEQVKDLTQYLDPSGLGVISFEDFYQGIVAIRNGDPDGQLYSVEPVQDEEPPACADEFDDFVTYEANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDVDSAGGSGVPSECLDTMEEPDHGALLLLPGRSRPHSQAVVMVIGSEEHFEDYGEGSEAELSPETLCNGELDCEDPAFLTPSPAKRLSSRKVARYLHQSGTLTMEALEDPPPEPVECPEEDIADKVIFLERRVSELEKDSAAAGEQHGRLRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQARLQQLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEEQENKRKMGDKLSHERHQFQRDKEATQELIEDLRKQLEHLQLLRLEMEQRRGRSSSLGLQEYNSRARESELEQEVRRLKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEVK", "length": 1065, "header": "tr|A0A8I5ZQX0-1|A0A8I5ZQX0_RAT Computationally mapped isoform of RAB11 family interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Rab11fip3 PE=4 SV=1 CANONICAL=Q9Z2M4-1" }, "locus": { "chromosome": "10", "start_pos": 15086346, "end_pos": 15004425, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000100345.1", "url": "https://www.ensembl.org/id/ENSRNOT00000100345.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000080945.1", "url": "https://www.ensembl.org/id/ENSRNOP00000080945.1" } ] } }, { "isoform_ac": "A0A8I5ZUA1-1", "url": "", "sequence": { "sequence": "MELSQPTSLSDHDEPASGPQRGVKGLVGPDAPRGWSDEPEEHAQLQRWPEGPNAPICWPEEVEEPHAPRRWAEEPSASRCLSQEPYESCHLAKELEEPDAPRCSSQEPDAPCHLAKDLEETDSPRCWPLEPDAPCHLAKEWEEPDVPRCWPQEPDAPCHLAKYLEEPDAPLCWPQEPDAFCYLLKEVEEPDVPRCRPQEPDAPCHLAEELEDLDAPRCWTQEPNESCNLAKELDEPDTPRCLSQEPDAPCLLAKEWEESDAPSCWPQEPDVGPQEPDVGCHLAKEREESDAPCLLTEELKEPDALQCWPQESDAPCLLAEELEEPDAPHCCSQEVDTECLSAKESEEPDASHLWPGEPDAPCLLVKEPEEADAPHCWPEEPEEPDALNAPCFWANEPDEPDAPRCWSEEPQVLCLWPEEQNTTQCWQEEPDASCFWSEDREEPKVSCLQFKEPEKPKVACSWPEELEDCCPTRGLPLEPLLAEGELLQACPGPPPDPGLALSLPSEPGTAQEEGARLRTVFDALDRDGDGFVRIEDFIQFATVYGAEQVKDLTQYLDPSGLGVISFEDFYQGIVAIRNGDPDGQLYSVEPVQDEEPPACADEFDDFVTYEANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDVDSAGGSGVPSECLDTMEEPDHGALLLLPGRSRPHSQAVVMVIGSEEHFEDYGEGSEAELSPETLCNGELDCEDPAFLTPRYLHQSGTLTMEALEDPPPEPVECPEEDIADKVIFLERRVSELEKDSAAAGEQHGRLRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQARLQQLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEEQENKRKMGDKLSHERHQFQRDKEATQELIEDLRKQLEHLQLLRLEMEQRRGRSSSLGLQEYNSRARESELEQEVRRLKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEVK", "length": 1053, "header": "tr|A0A8I5ZUA1-1|A0A8I5ZUA1_RAT Computationally mapped isoform of RAB11 family interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Rab11fip3 PE=4 SV=1 CANONICAL=Q9Z2M4-1" }, "locus": { "chromosome": "10", "start_pos": 15086346, "end_pos": 15004425, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000098691.1", "url": "https://www.ensembl.org/id/ENSRNOT00000098691.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000082618.1", "url": "https://www.ensembl.org/id/ENSRNOP00000082618.1" } ] } }, { "isoform_ac": "A0A8I6AJE6-1", "url": "", "sequence": { "sequence": "MTQQPPDVEEDDCLSEYHHLFLGARVKNESATGWCVPHTFLLRPAFSVCRHGCHTVIVSRSLPRVSEAAKKLVAATGKRCLPLSMDVRVPPAVMAAVDQALKEFGKIDILINCAAGNFLCPASALSFNAFKTVVDIDTLGTFNVSRVLYEKFFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLGGPKASSKFKYLSSPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTLPNDIGRLLEFESSSAKL", "length": 292, "header": "tr|A0A8I6AJE6-1|A0A8I6AJE6_RAT Computationally mapped isoform of Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Rattus norvegicus OX=10116 GN=Nme4 PE=1 SV=1 CANONICAL=Q9Z2M4-1" }, "locus": { "chromosome": "10", "start_pos": 15112864, "end_pos": 15106613, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000104441.1", "url": "https://www.ensembl.org/id/ENSRNOT00000104441.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000093315.1", "url": "https://www.ensembl.org/id/ENSRNOP00000093315.1" } ] } }, { "isoform_ac": "A0A8I6GLH8-1", "url": "", "sequence": { "sequence": "MELSQPTSLSDHDEPASGPQRGVKGLVGPDAPRGWSDEPEEHAQLQRWPEGPNAPICWPEEVEEPHAPRRWAEEPSASRCLSQEPYESCHLAKELEEPDAPRCSSQEPDAPCHLAKDLEETDSPRCWPLEPDAPCHLAKEWEEPDVPRCWPQEPDAPCHLAKYLEEPDAPLCWPQEPDAFCYLLKEVEEPDVPRCRPQEPDAPCHLAEELEDLDAPRCWTQEPNESCNLAKELDEPDTPRCLSQEPDAPCLLAKEWEESDAPSCWPQEPDVGPQEPDVGCHLAKEREESDAPCLLTEELKEPDALQCWPQESDAPCLLAEELEEPDAPHCCSQEVDTECLSAKESEEPDASHLWPGEPDAPCLLVKEPEEADAPHCWPEEPEEPDALNAPCFWANEPDEPDAPRCWSEEPQVLCLWPEEQNTTQCWQEEPDASCFWSEDREEPKVSCLQFKEPEKPKVACSWPEELEDCCPTRGLPLEPLLAEGELLQACPGPPPDPGLALSLPSEPGTAQEEGARLRTVFDALDRDGDGFVRIEDFIQFATVYGAEQVKDLTQYLDPSGLGVISFEDFYQGIVAIRNGDPDGQLYSVEPVQDEEPPACADEFDDFVTYEANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDVDSAGGSGVPSECLDTMEEPDHGALLLLPGRSRPHSQAVVMVIGSEEHFEDYGEGSEAELSPETLCNGELDCEDPAFLTPSSNPLASKLCTVLTDEAFEFYCSQCHKQINRLEDLSARLTDLEMNSPAKRLSSRKVARYLHQSGTLTMEALEDPPPEPVECPEEDIADKVIFLERRVSELEKDSAAAGEQHGRLRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQARLQQLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEEQENKRKMGDKLSHERHQFQRDKEATQELIEDLRKQLEHLQLLRLEMEQRRGRSSSLGLQEYNSRARESELEQEVRRLKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEVK", "length": 1110, "header": "tr|A0A8I6GLH8-1|A0A8I6GLH8_RAT Computationally mapped isoform of RAB11 family interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Rab11fip3 PE=4 SV=1 CANONICAL=Q9Z2M4-1" }, "locus": { "chromosome": "10", "start_pos": 15086346, "end_pos": 15004425, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000117914.1", "url": "https://www.ensembl.org/id/ENSRNOT00000117914.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000095174.1", "url": "https://www.ensembl.org/id/ENSRNOP00000095174.1" } ] } }, { "isoform_ac": "A0A8I6GLQ6-1", "url": "", "sequence": { "sequence": "MTVFLNTTTSSARTFSRCVPHTFLLRPAFSVCRHGCHTVIVSRSLPRVSEAAKKLVAATGKRCLPLSMDVRVPPAVMAAVDQALKEFGKIDILINCAAGNFLCPASALSFNAFKTVVDIDTLGTFNVSRVLYEKFFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLGGPKASSKFKYLSSPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTLPNDIGRLLEFESSSAKL", "length": 275, "header": "tr|A0A8I6GLQ6-1|A0A8I6GLQ6_RAT Computationally mapped isoform of Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Rattus norvegicus OX=10116 GN=Nme4 PE=1 SV=1 CANONICAL=Q9Z2M4-1" }, "locus": { "chromosome": "10", "start_pos": 15112833, "end_pos": 15106613, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000100008.1", "url": "https://www.ensembl.org/id/ENSRNOT00000100008.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000095636.1", "url": "https://www.ensembl.org/id/ENSRNOP00000095636.1" } ] } }, { "isoform_ac": "D3ZMT9-1", "url": "", "sequence": { "sequence": "MGCLFDRAALRALLCGPRFQCLLVRPSSGGPPWPQERTLVAVKPDGVQRRLVGTVIHRFERRGFKLVGMKMLQAPESILAEHYRDLQRKPFYPALISYMSSGPVVAMVWEGHNVVHISRAMIGHTDSTEAAPGTIRGDFSVHISRNVIHASDSVDGAQREIELWFQSSELLNWADGGHHSSCYPA", "length": 185, "header": "tr|D3ZMT9-1|D3ZMT9_RAT Computationally mapped isoform of Nucleoside diphosphate kinase OS=Rattus norvegicus OX=10116 GN=Nme4 PE=3 SV=1 CANONICAL=Q9Z2M4-1" }, "locus": { "chromosome": "10", "start_pos": 15118461, "end_pos": 15114924, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000027593.7", "url": "https://www.ensembl.org/id/ENSRNOT00000027593.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000027593.4", "url": "https://www.ensembl.org/id/ENSRNOP00000027593.4" } ] } }, { "isoform_ac": "F7F3L0-1", "url": "", "sequence": { "sequence": "MGSESTYSECETFTDEDTSTLVHPELQPEGDVDSAGGSGVPSECLDTMEEPDHGALLLLPGRSRPHSQAVVMVIGSEEHFEDYGEGSEAELSPETLCNGELDCEDPAFLTPSSNPLASKLCTVLTDEAFEFYCSQCHKQINRLEDLSARLTDLEMNSPAKRLSSRKVARYLHQSGTLTMEALEDPPPEPVECPEEDIADKVIFLERRVSELEKDSAAAGEQHGRLRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQARLQQLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEEQENKRKMGDKLSHERHQFQRDKEATQELIEDLRKQLEHLQLLRLEMEQRRGRSSSLGLQEYNSRARESELEQEVRRLKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEVK", "length": 491, "header": "tr|F7F3L0-1|DECR2_RAT Computationally mapped isoform of Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Rattus norvegicus OX=10116 GN=Decr2 PE=1 SV=1 CANONICAL=Q9Z2M4-1" }, "locus": { "chromosome": "10", "start_pos": 15029307, "end_pos": 15004425, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000027439.4", "url": "https://www.ensembl.org/id/ENSRNOT00000027439.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000027439.4", "url": "https://www.ensembl.org/id/ENSRNOP00000027439.4" } ] } }, { "isoform_ac": "Q6TXF6-1", "url": "", "sequence": { "sequence": "MGCLFDRAALRALLCGPRFQCLLVRPSSGGPPWPQERTLVAVKPDGVQRRLVGTVIHRFERRGFKLVGMKMLQAPESILAEHYRDLQRKPFYPALISYMSSGPVVAMVWEGHNVVHISRAMIGHTDSTEAAPGTIRGDFSVHISRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVSRSLPRVSEAAKKLVAATGKRCLPLSMDVRVPPAVMAAVDQALKEFGKIDILINYAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLGGPKASSKFKYLSSPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGEEGTPDGDPGEWGTVAEKLDWAREAAGAAGPLNQVFGQGEMIDVMGMTKGKGYKGVTSRWHTKKPPRKTHQGLRKVACIGAWLPAHVAFSVARAGQKGYHHQTETNKKIYKIGQGYLIKDGKLTKNNASTDYDLSDRSINPLGGFVHYGEVTNDFLMLEGCVVGTKKRVLTLRKSLLEPDAFCYLLKEVEEPDVPRCRPQEPDAPCHLAEELEDLDAPRCWTQEPNESCNLAKELDEPDTPRCLSQEPDAPCLLAKEWEESDAPSCWPQEPDVGPQEPDVGCHLAKEREESDAPCLLTEELKEPDALQCWPQESDAPCLLAEELEEPDAPHCCSQEVDTECLSAKESEEPDASHLWPGEPDAPCLLVKEPEEADAPHCWPEEPEEPDALNAPCFWANEPDEPDAPRCWSEEPQVLCLWPEEQNTTQCWQEEPDASCFWSEDREEPKVSCLQFKEPEKPKVACSWPEELEDCCPTRGLPLEPLLAEGELLQACPGPPPDPGLALSLPSEPGTAQEEGARLRTVFDALDRDGDGFVRIEDFIQFATVYGAEQVTN", "length": 867, "header": "tr|Q6TXF6-1|Q6TXF6_RAT Computationally mapped isoform of LRRGT00043 OS=Rattus norvegicus OX=10116 GN=Decr2 PE=1 SV=1 CANONICAL=Q9Z2M4-1" }, "locus": { "chromosome": "10", "start_pos": 15118461, "end_pos": 15084694, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000077826.2", "url": "https://www.ensembl.org/id/ENSRNOT00000077826.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000068775.1", "url": "https://www.ensembl.org/id/ENSRNOP00000068775.1" } ] } }, { "isoform_ac": "Q9Z2M4-1", "url": "", "sequence": { "sequence": "MTQQPPDVEEDDCLSEYHHLFCPDLLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVSRSLPRVSEAAKKLVAATGKRCLPLSMDVRVPPAVMAAVDQALKEFGKIDILINCAAGNFLCPASALSFNAFKTVVDIDTLGTFNVSRVLYEKFFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLGGPKASSKFKYLSSPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTLPNDIGRLLEFESSSAKL", "length": 292, "header": "sp|Q9Z2M4-1|DECR2_RAT Isoform 1 of Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Rattus norvegicus OX=10116 GN=Decr2 PE=1 SV=1 CANONICAL=Q9Z2M4-1" }, "locus": { "chromosome": "10", "start_pos": 15112864, "end_pos": 15106613, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000027518", "url": "https://www.ensembl.org/id/ENSRNOT00000027518" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000027518", "url": "https://www.ensembl.org/id/ENSRNOP00000027518" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 287, "end_pos": 287, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "site_lbl": "Ser287" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Identification of peroxisomal proteins by using M13 phage protein VI phage display: molecular evidence that mammalian peroxisomes contain a 2,4-dienoyl-CoA reductase.", "journal": "Biochem. J.", "date": "1999", "authors": "Fransen M, Van Veldhoven PP, Subramani S", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "reference": [ { "type": "PubMed", "id": "10333503", "url": "https://glygen.org/publication/PubMed/10333503" } ] }, { "title": "Characterisation of human peroxisomal 2,4-dienoyl-CoA reductase.", "journal": "Biochim. Biophys. Acta", "date": "2001", "authors": "De Nys K, Meyhi E, Mannaerts GP, Fransen M, Van Veldhoven PP", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "reference": [ { "type": "PubMed", "id": "11514237", "url": "https://glygen.org/publication/PubMed/11514237" } ] }, { "title": "The nucleoside diphosphate kinase D (NM23-H4) binds the inner mitochondrial membrane with high affinity to cardiolipin and couples nucleotide transfer with respiration.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Tokarska-Schlattner M, Boissan M, Munier A, Borot C, Mailleau C, Speer O, Schlattner U, Lacombe ML", "evidence": [ { "database": "RefSeq", "id": "NP_001102948", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102948" } ], "reference": [ { "type": "PubMed", "id": "18635542", "url": "https://glygen.org/publication/PubMed/18635542" } ] }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "F7F3L0", "url": "https://www.uniprot.org/uniprot/F7F3L0" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "title": "Dual function of mitochondrial Nm23-H4 protein in phosphotransfer and intermembrane lipid transfer: a cardiolipin-dependent switch.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Schlattner U, Tokarska-Schlattner M, Ramirez S, Tyurina YY, Amoscato AA, Mohammadyani D, Huang Z, Jiang J, Yanamala N, Seffouh A, Boissan M, Epand RF, Epand RM, Klein-Seetharaman J, Lacombe ML, Kagan VE", "evidence": [ { "database": "RefSeq", "id": "NP_001102948", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102948" } ], "reference": [ { "type": "PubMed", "id": "23150663", "url": "https://glygen.org/publication/PubMed/23150663" } ] } ], "pathway": [ { "id": "rno:303002", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:303002", "resource": "KEGG Pathway" }, { "id": "rno:64461", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:64461", "resource": "KEGG Pathway" }, { "id": "rno:685679", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:685679", "resource": "KEGG Pathway" }, { "id": "R-RNO-390247", "name": "Beta-oxidation of very long chain fatty acids", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-390247", "resource": "Reactome", "description": "Beta-oxidation of very long chain fatty acids" }, { "id": "R-RNO-9033241", "name": "Peroxisomal protein import", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9033241", "resource": "Reactome", "description": "Peroxisomal protein import" } ], "orthologs": [ { "uniprot_canonical_ac": "O75154-1", "protein_name": "Rab11 family-interacting protein 3", "gene_name": "RAB11FIP3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASAPPASPPGSEPPGPDPEPGGPDGPGAAQLAPGPAELRLGAPVGGPDPQSPGLDEPAPGAAADGGARWSAGPAPGLEGGPRDPGPSAPPPRSGPRGQLASPDAPGPGPRSEAPLPELDPLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQEDGPRLRAVFDALDGDGDGFVRIEDFIQFATVYGAEQVKDLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTYEANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAVPSECLDAMEEPDHGALLLLPGRPHPHGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLTPSPTKRLSSKKVARYLHQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDTAATGEQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHSRARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK", "length": 756 }, "evidence": [ { "id": "45227709", "url": "http://www.informatics.jax.org/homology/45227709", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8CHD8-1", "protein_name": "Rab11 family-interacting protein 3", "gene_name": "Rab11fip3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MELCQPTSLSDHDQPASGPQRGVMGLVGPDAPRGWSEEPEEHAQLQRWPEGPNAPICWPEEVEEPHAPSRWAKEPNAPRCSSQEPDESCHLAEELEESDSPRCWPQEPDTPCHLAKELEEPDAPRCLPQEPDTPCYLAKELEEPNIPRCWPQEPDVPCHLAKELEEPDAPRCWPQEPDAFCHLLKEVEEPDALRCWLQGPDAPCHLAKELEDLDSPRCWPQEPDESCHLAKELEEPDAPCHLAKELEEPDAPRCWPQEPDVPCLLAKKWEESDAPCLLTEELEEPDALHCWPQESEAPCLLAKELEEPDASHSCPQEADTGCLSAKEPEEPDVSHLWQGVPDAPCLLVKEPEEADALHCCWPEESEEPDALNPPCFWANEPDEPDPSRCWSEEPQVLCLWPEEQNTKRCWQEEPDAPCFWPEDREEPIVSCLQFKEPEKPKVRSSWPEELEDCCPTRGLPLEPLLADGELLQACPGPPSDPGPALSLPSEPGTAQEEGARLRAVFDALDRDGDGFVRIEDFIQFATVYGAEQVKDLTQYLDPSGLGVISFEDFYQGIVAIRNGDPDGQLYSVEPVQDEETPACADEFDDFVTYEANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDVDSAGGSGVPSECLDTMEEPDHGALLLLPGRSRPHSQAVVMVIGSEEHFEDYGEGNEAELSPETLCDGDGEDPAFLTPSPAKRLSSRKVARYLHQSGTLTMEALEDPPPEPVECPEEDIADKVIFLERRVSELEKDSAAAGEQHGRLRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQARLQQLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEEQENKRKMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQEYNSRARESELEQEVRRLKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEVK", "length": 1047 }, "evidence": [ { "id": "45227709", "url": "http://www.informatics.jax.org/homology/45227709", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NUI1-1", "protein_name": "Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]", "gene_name": "DECR2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL", "length": 292 }, "evidence": [ { "id": "45227710", "url": "http://www.informatics.jax.org/homology/45227710", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9WV68-1", "protein_name": "Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]", "gene_name": "Decr2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAQPPPDVEGDDCLPEYHHLFCPDLLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVGRSLQKVTTAAKKLVAATGKRCLPLSMDVRVPPEVMTAVDQALQEFGKINILINCAAGNFLCPASALSFNAFKTVVDIDTIGTFNVSSVLYKKFFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLRGSNASSKLKHFSNPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTFPNGIKQLLEFESFSAKL", "length": 292 }, "evidence": [ { "id": "45227710", "url": "http://www.informatics.jax.org/homology/45227710", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 12, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "GTPase binding", "id": "GO:0051020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051020", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "cardiolipin binding", "id": "GO:1901612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901612", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "nucleoside diphosphate kinase activity", "id": "GO:0004550", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004550", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "2,4-dienoyl-CoA reductase (NADPH) activity", "id": "GO:0008670", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008670", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "small GTPase binding", "id": "GO:0031267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031267", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "dynein light intermediate chain binding", "id": "GO:0051959", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051959", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "structural constituent of ribosome", "id": "GO:0003735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003735", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "trans-2-enoyl-CoA reductase (NADPH) activity", "id": "GO:0019166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019166", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 14, "go_terms": [ { "name": "mitochondrial intermembrane space", "id": "GO:0005758", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005758", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "recycling endosome", "id": "GO:0055037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055037", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "recycling endosome membrane", "id": "GO:0055038", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055038", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "cleavage furrow", "id": "GO:0032154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032154", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "endocytic vesicle", "id": "GO:0030139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030139", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "midbody", "id": "GO:0030496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030496", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "postsynaptic recycling endosome membrane", "id": "GO:0098944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098944", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "ribosome", "id": "GO:0005840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005840", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "peroxisome", "id": "GO:0005777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005777", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "peroxisomal membrane", "id": "GO:0005778", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005778", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 13, "go_terms": [ { "name": "lipid transport", "id": "GO:0006869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006869", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "GTP biosynthetic process", "id": "GO:0006183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006183", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "UTP biosynthetic process", "id": "GO:0006228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006228", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "CTP biosynthetic process", "id": "GO:0006241", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006241", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "negative regulation of adiponectin secretion", "id": "GO:0070164", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070164", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "fatty acid catabolic process", "id": "GO:0009062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009062", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "endocytic recycling", "id": "GO:0032456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032456", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "protein localization to cilium", "id": "GO:0061512", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061512", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "regulation of cytokinesis", "id": "GO:0032465", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032465", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "translation", "id": "GO:0006412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006412", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "fatty acid metabolic process", "id": "GO:0006631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006631", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" }, { "name": "unsaturated fatty acid biosynthetic process", "id": "GO:0006636", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006636", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2M4", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 143, "end_pos": 145, "annotation": "n_glycosylation_sequon" }, { "start_pos": 162, "end_pos": 164, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "18113", "name": "", "equation": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q05982-1", "Q9QXL7-1", "O88426-1", "Q68FP8-1", "Q4KM73-1", "P19804-1", "Q9WUS0-1", "P39069-1", "Q9Z2M4-1", "G3V816-1", "A0A8I6A4T4-1", "A0A8I6AII3-1", "Q5EBM0-1", "Q5TCS8-4", "P27144-1", "P30085-1", "Q9Y6K8-1", "P00568-1", "Q96MA6-1", "Q96M32-1", "Q13232-1", "Q9Y5B8-1", "P15531-1", "O60361-1", "O00746-1", "P22392-1", "O75414-1", "A0A8I5KW96-1", "Q3U5Q7-1", "Q9WUR9-1", "Q9R0Y5-1", "Q920P5-1", "Q32M07-1", "Q9D2H2-2", "Q9DBP5-1", "P15532-1", "Q9QXL8-1", "Q9WV84-1", "Q9WV85-1", "O88425-1", "Q01768-1", "P36010-1", "Q54CG9-1", "P22887-1", "P34093-1", "P08879-1" ], "evidence": [ { "id": "18113", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/18113" } ] }, { "id": "44640", "name": "", "equation": "a 2'-deoxyribonucleoside 5'-diphosphate + ATP = a 2'-deoxyribonucleoside 5'-triphosphate + ADP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q05982-1", "Q9QXL7-1", "O88426-1", "Q68FP8-1", "Q4KM73-1", "P19804-1", "Q9WUS0-1", "Q9Z2M4-1", "G3V816-1", "P39069-1", "A0A8I6A4T4-1", "A0A8I6AII3-1", "O00746-1", "O75414-1", "Q13232-1", "P22392-1", "Q5EBM0-1", "Q5TCS8-4", "P27144-1", "P30085-1", "Q9Y6K8-1", "P00568-1", "Q96MA6-1", "Q96M32-1", "Q9Y5B8-1", "P15531-1", "O60361-1", "A0A8I5KW96-1", "Q9WV84-1", "Q3U5Q7-1", "Q9WUR9-1", "Q9R0Y5-1", "Q920P5-1", "Q32M07-1", "Q9D2H2-2", "Q9DBP5-1", "P15532-1", "Q9QXL8-1", "Q9WV85-1", "O88425-1", "Q01768-1", "P36010-1", "Q54CG9-1", "P22887-1", "P34093-1", "P08879-1", "Q9VY27-1" ], "evidence": [ { "id": "44640", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/44640" } ] }, { "id": "44912", "name": "", "equation": "(2E,4E)-hexadienoyl-CoA + H(+) + NADPH = (3E)-hexenoyl-CoA + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64591-1", "Q9Z2M4-1", "Q16698-1", "Q9WV68-1", "Q9CQ62-1" ], "evidence": [ { "id": "44912", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/44912" } ] }, { "id": "44916", "name": "", "equation": "(2E,4E)-decadienoyl-CoA + H(+) + NADPH = (3E)-decenoyl-CoA + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z2M4-1", "Q9WV68-1" ], "evidence": [ { "id": "44916", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/44916" } ] }, { "id": "44920", "name": "", "equation": "(2E,4Z,7Z,10Z,13Z,16Z,19Z)-docosaheptaenoyl-CoA + H(+) + NADPH = (3E,7Z,10Z,13Z,16Z,19Z)-docosahexaenoyl-CoA + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z2M4-1", "Q9NUI1-1", "Q9WV68-1" ], "evidence": [ { "id": "44920", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/44920" } ] }, { "id": "45912", "name": "", "equation": "a (2E,4E)-dienoyl-CoA + H(+) + NADPH = a 4,5-saturated-(3E)-enoyl-CoA + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64591-1", "Q9Z2M4-1", "Q16698-1", "Q9NUI1-1", "Q9WV68-1", "Q9CQ62-1", "P32573-1" ], "evidence": [ { "id": "45912", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45912" } ] }, { "id": "61892", "name": "", "equation": "a (2E,4Z)-dienoyl-CoA + H(+) + NADPH = a 4,5-saturated-(3E)-enoyl-CoA + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64591-1", "Q9Z2M4-1", "Q16698-1", "Q9NUI1-1", "Q9WV68-1", "Q9CQ62-1", "P32573-1" ], "evidence": [ { "id": "61892", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/61892" } ] }, { "id": "R-RNO-6786720", "name": "DECR2 reduces LCtE-CoA to t3enoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "peroxisomal matrix, peroxisomal membrane", "input_participant_list": [ "R-ALL-113602", "R-ALL-6786723" ], "output_participant_list": [ "R-ALL-389556", "R-ALL-6786715" ], "enzyme_list": [ "Q9Z2M4-1" ], "evidence": [ { "id": "R-RNO-6786720", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6786720" } ] }, { "id": "R-RNO-9033235", "name": "Cargo of PEX5S,L translocates from the cytosol to the peroxisomal matrix", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "peroxisomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9ES71-1", "P07872-1", "P97562-1", "Q62651-1", "P11915-1", "Q06518-1", "Q8CHM7-1", "Q63276-1", "Q63448-1", "O88267-1", "Q5XIC0-1", "P09139-1", "Q3MIB4-1", "Q5I0K1-1", "P04762-1", "Q704S8-1", "Q920F5-1", "Q9Z2M4-1", "P24392-1", "P41562-1", "P97519-1", "B0BNF9-1", "B1H261-1", "O55171-1", "P70473-1", "Q8VHK0-1", "P97524-1", "Q6AYD9-1", "Q9WVK3-1", "O35078-1", "P11466-1", "P24473-1", "Q07523-1", "Q8VID1-1", "P35559-1", "D3ZDM7-1" ], "evidence": [ { "id": "R-RNO-9033235", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9033235" } ] }, { "id": "R-RNO-9033236", "name": "PEX5S,L:Cargo binds PEX13:PEX14:PEX2:PEX10:PEX12 (Docking and Translocation Module)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "peroxisomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9ES71-1", "P07872-1", "P97562-1", "Q62651-1", "P11915-1", "Q06518-1", "Q8CHM7-1", "Q63276-1", "Q63448-1", "O88267-1", "Q5XIC0-1", "P09139-1", "Q3MIB4-1", "Q5I0K1-1", "P04762-1", "Q704S8-1", "Q920F5-1", "Q9Z2M4-1", "P24392-1", "P41562-1", "P97519-1", "B0BNF9-1", "B1H261-1", "O55171-1", "P70473-1", "Q8VHK0-1", "P97524-1", "Q6AYD9-1", "Q9WVK3-1", "O35078-1", "P11466-1", "P24473-1", "Q07523-1", "Q8VID1-1", "P35559-1", "D3ZDM7-1" ], "evidence": [ { "id": "R-RNO-9033236", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9033236" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-113602", "participant_name": "NADPH [peroxisomal matrix]", "crossref": [ { "id": "8145663", "database": "PubChem Substance", "url": "" }, { "id": "C00005", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000221", "database": "HMDB Metabolite", "url": "" }, { "id": "000008215411", "database": "ZINC", "url": "" }, { "id": "3041", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "16474", "database": "ChEBI", "url": "" }, { "id": "C00005", "database": "COMPOUND", "url": "" }, { "id": "16474", "database": "ChEBI", "url": "" }, { "id": "HMDB0000221", "database": "HMDB Metabolite", "url": "" }, { "id": "3041", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8145663", "database": "PubChem Substance", "url": "" }, { "id": "000008215411", "database": "ZINC", "url": "" }, { "id": "C00005", "database": "COMPOUND", "url": "" }, { "id": "16474", "database": "ChEBI", "url": "" }, { "id": "HMDB0000221", "database": "HMDB Metabolite", "url": "" }, { "id": "3041", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8145663", "database": "PubChem Substance", "url": "" }, { "id": "000008215411", "database": "ZINC", "url": "" }, { "id": "8145663", "database": "PubChem Substance", "url": "" }, { "id": "C00005", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000221", "database": "HMDB Metabolite", "url": "" }, { "id": "000008215411", "database": "ZINC", "url": "" }, { "id": "3041", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "16474", "database": "ChEBI", "url": "" }, { "id": "HMDB0000221", "database": "HMDB Metabolite", "url": "" }, { "id": "8145663", "database": "PubChem Substance", "url": "" }, { "id": "C00005", "database": "COMPOUND", "url": "" }, { "id": "16474", "database": "ChEBI", "url": "" }, { "id": "000008215411", "database": "ZINC", "url": "" }, { "id": "3041", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "3041", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "16474", "database": "ChEBI", "url": "" }, { "id": "000008215411", "database": "ZINC", "url": "" }, { "id": "C00005", "database": "COMPOUND", "url": "" }, { "id": "8145663", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000221", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-389556", "participant_name": "NADP+ [peroxisomal matrix]", "crossref": [ { "id": "C00006", "database": "COMPOUND", "url": "" }, { "id": "18009", "database": "ChEBI", "url": "" }, { "id": "HMDB0304435", "database": "HMDB Metabolite", "url": "" }, { "id": "8145192", "database": "PubChem Substance", "url": "" }, { "id": "000008214733", "database": "ZINC", "url": "" }, { "id": "3045", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000008214733", "database": "ZINC", "url": "" }, { "id": "C00006", "database": "COMPOUND", "url": "" }, { "id": "HMDB0304435", "database": "HMDB Metabolite", "url": "" }, { "id": "3045", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8145192", "database": "PubChem Substance", "url": "" }, { "id": "18009", "database": "ChEBI", "url": "" }, { "id": "C00006", "database": "COMPOUND", "url": "" }, { "id": "18009", "database": "ChEBI", "url": "" }, { "id": "HMDB0304435", "database": "HMDB Metabolite", "url": "" }, { "id": "8145192", "database": "PubChem Substance", "url": "" }, { "id": "000008214733", "database": "ZINC", "url": "" }, { "id": "3045", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00006", "database": "COMPOUND", "url": "" }, { "id": "18009", "database": "ChEBI", "url": "" }, { "id": "HMDB0304435", "database": "HMDB Metabolite", "url": "" }, { "id": "8145192", "database": "PubChem Substance", "url": "" }, { "id": "000008214733", "database": "ZINC", "url": "" }, { "id": "3045", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00006", "database": "COMPOUND", "url": "" }, { "id": "18009", "database": "ChEBI", "url": "" }, { "id": "HMDB0304435", "database": "HMDB Metabolite", "url": "" }, { "id": "8145192", "database": "PubChem Substance", "url": "" }, { "id": "000008214733", "database": "ZINC", "url": "" }, { "id": "3045", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00006", "database": "COMPOUND", "url": "" }, { "id": "18009", "database": "ChEBI", "url": "" }, { "id": "HMDB0304435", "database": "HMDB Metabolite", "url": "" }, { "id": "8145192", "database": "PubChem Substance", "url": "" }, { "id": "000008214733", "database": "ZINC", "url": "" }, { "id": "3045", "database": "Guide to Pharmacology - Ligands", "url": "" } ] }, { "participant_id": "R-ALL-6786715", "participant_name": "t3enoyl-CoA [peroxisomal matrix]", "crossref": [ { "id": "27700", "database": "ChEBI", "url": "" }, { "id": "C05067", "database": "COMPOUND", "url": "" }, { "id": "27700", "database": "ChEBI", "url": "" }, { "id": "C05067", "database": "COMPOUND", "url": "" }, { "id": "27700", "database": "ChEBI", "url": "" }, { "id": "C05067", "database": "COMPOUND", "url": "" }, { "id": "27700", "database": "ChEBI", "url": "" }, { "id": "C05067", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-6786723", "participant_name": "LCtE-CoA [peroxisomal matrix]", "crossref": [ { "id": "83727", "database": "ChEBI", "url": "" }, { "id": "83727", "database": "ChEBI", "url": "" }, { "id": "83727", "database": "ChEBI", "url": "" }, { "id": "83727", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A8I5KW96", "gene_name": "AK4P3", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "A0A8I5KW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5KW96" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "A0A8I5KW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5KW96" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "A0A8I5KW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5KW96" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "A0A8I5KW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5KW96" } ] } ] }, { "uniprot_ac": "A0A8I6A4T4", "gene_name": "Nme2-ps1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "A0A8I6A4T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A4T4" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "A0A8I6A4T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A4T4" } ] } ] }, { "uniprot_ac": "A0A8I6AII3", "gene_name": "ENSRNOG00000062879", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "A0A8I6AII3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AII3" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "A0A8I6AII3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AII3" } ] } ] }, { "uniprot_ac": "B0BNF9", "gene_name": "Hao1", "activity": [ { "ec_number": "1.1.3.15", "activity": "glycolate + O2 = glyoxylate + H2O2.", "evidence": [ { "id": "B0BNF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0BNF9" } ] }, { "ec_number": "1.2.3.5", "activity": "glyoxylate + H2O + O2 = H(+) + H2O2 + oxalate.", "evidence": [ { "id": "B0BNF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0BNF9" } ] }, { "ec_number": "1.1.3.15", "activity": "", "evidence": [ { "id": "B0BNF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0BNF9" } ] } ] }, { "uniprot_ac": "B1H261", "gene_name": "Tysnd1", "activity": [ { "ec_number": "3.4.21.-", "activity": "", "evidence": [ { "id": "B1H261", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1H261" } ] } ] }, { "uniprot_ac": "D3ZDM7", "gene_name": "Ddo", "activity": [ { "ec_number": "1.4.3.1", "activity": "D-aspartate + H2O + O2 = H2O2 + NH4(+) + oxaloacetate.", "evidence": [ { "id": "D3ZDM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDM7" } ] } ] }, { "uniprot_ac": "G3V816", "gene_name": "Nme3", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "G3V816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V816" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "G3V816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V816" } ] } ] }, { "uniprot_ac": "O00746", "gene_name": "NME4", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "O00746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00746" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "O00746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00746" } ] } ] }, { "uniprot_ac": "O35078", "gene_name": "Dao", "activity": [ { "ec_number": "1.4.3.3", "activity": "a D-alpha-amino acid + H2O + O2 = a 2-oxocarboxylate + H2O2 + NH4(+).", "evidence": [ { "id": "O35078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35078" } ] }, { "ec_number": "1.4.3.3", "activity": "", "evidence": [ { "id": "O35078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35078" } ] } ] }, { "uniprot_ac": "O55171", "gene_name": "Acot2", "activity": [ { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "O55171", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55171" } ] }, { "ec_number": "3.1.2.2", "activity": "", "evidence": [ { "id": "O55171", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55171" } ] } ] }, { "uniprot_ac": "O60361", "gene_name": "NME2P1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "O60361", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60361" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "O60361", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60361" } ] } ] }, { "uniprot_ac": "O75414", "gene_name": "NME6", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "O75414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75414" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "O75414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75414" } ] } ] }, { "uniprot_ac": "O88267", "gene_name": "Acot1", "activity": [ { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "O88267", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88267" } ] }, { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "O88267", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88267" } ] } ] }, { "uniprot_ac": "O88425", "gene_name": "Nme6", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "O88425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88425" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "O88425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88425" } ] } ] }, { "uniprot_ac": "O88426", "gene_name": "Nme6", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "O88426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88426" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "O88426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88426" } ] } ] }, { "uniprot_ac": "P00568", "gene_name": "AK1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] } ] }, { "uniprot_ac": "P04762", "gene_name": "Cat", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "P04762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04762" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "P04762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04762" } ] } ] }, { "uniprot_ac": "P07872", "gene_name": "Acox1", "activity": [ { "ec_number": "1.3.3.6", "activity": "a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2.", "evidence": [ { "id": "P07872", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07872" } ] }, { "ec_number": "1.3.3.6", "activity": "", "evidence": [ { "id": "P07872", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07872" } ] } ] }, { "uniprot_ac": "P08879", "gene_name": "awd", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P08879", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08879" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P08879", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08879" } ] } ] }, { "uniprot_ac": "P09139", "gene_name": "Agxt", "activity": [ { "ec_number": "2.6.1.51", "activity": "L-serine + pyruvate = 3-hydroxypyruvate + L-alanine.", "evidence": [ { "id": "P09139", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09139" } ] }, { "ec_number": "2.6.1.44", "activity": "glyoxylate + L-alanine = glycine + pyruvate.", "evidence": [ { "id": "P09139", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09139" } ] }, { "ec_number": "2.6.1.44", "activity": "", "evidence": [ { "id": "P09139", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09139" } ] } ] }, { "uniprot_ac": "P11466", "gene_name": "Crot", "activity": [ { "ec_number": "2.3.1.137", "activity": "(R)-carnitine + octanoyl-CoA = CoA + O-octanoyl-(R)-carnitine.", "evidence": [ { "id": "P11466", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11466" } ] }, { "ec_number": "2.3.1.137", "activity": "", "evidence": [ { "id": "P11466", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11466" } ] } ] }, { "uniprot_ac": "P11915", "gene_name": "Scp2", "activity": [ { "ec_number": "2.3.1.176", "activity": "4,8,12-trimethyltridecanoyl-CoA + propanoyl-CoA = 3-oxopristanoyl-CoA + CoA.", "evidence": [ { "id": "P11915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11915" } ] }, { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "P11915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11915" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "P11915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11915" } ] }, { "ec_number": "2.3.1.155", "activity": "", "evidence": [ { "id": "P11915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11915" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "P11915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11915" } ] }, { "ec_number": "2.3.1.176", "activity": "", "evidence": [ { "id": "P11915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11915" } ] } ] }, { "uniprot_ac": "P15531", "gene_name": "NME1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P15531", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15531" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P15531", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15531" } ] } ] }, { "uniprot_ac": "P15532", "gene_name": "Nme1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P15532", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15532" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P15532", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15532" } ] } ] }, { "uniprot_ac": "P19804", "gene_name": "Nme2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P19804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19804" } ] }, { "ec_number": "2.7.13.3", "activity": "ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.", "evidence": [ { "id": "P19804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19804" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P19804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19804" } ] } ] }, { "uniprot_ac": "P22392", "gene_name": "NME2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] }, { "ec_number": "2.7.13.3", "activity": "ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] } ] }, { "uniprot_ac": "P22887", "gene_name": "ndkC-1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P22887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22887" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P22887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22887" } ] } ] }, { "uniprot_ac": "P24392", "gene_name": "Pex2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P24392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24392" } ] }, { "ec_number": "2.3.2.36", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-cysteine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-S-ubiquitinyl-L-cysteine.", "evidence": [ { "id": "P24392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24392" } ] }, { "ec_number": "2.3.2.36", "activity": "", "evidence": [ { "id": "P24392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24392" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P24392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24392" } ] } ] }, { "uniprot_ac": "P24473", "gene_name": "Gstk1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P24473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24473" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P24473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24473" } ] } ] }, { "uniprot_ac": "P27144", "gene_name": "AK4", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "P27144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27144" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P27144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27144" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P27144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27144" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "P27144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27144" } ] } ] }, { "uniprot_ac": "P30085", "gene_name": "CMPK1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P30085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30085" } ] }, { "ec_number": "2.7.4.14", "activity": "ATP + CMP = ADP + CDP.", "evidence": [ { "id": "P30085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30085" } ] }, { "ec_number": "2.7.4.14", "activity": "", "evidence": [ { "id": "P30085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30085" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P30085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30085" } ] } ] }, { "uniprot_ac": "P32573", "gene_name": "SPS19", "activity": [ { "ec_number": "1.3.1.124", "activity": "a (2E,4E)-dienoyl-CoA + H(+) + NADPH = a 4,5-saturated-(3E)-enoyl-CoA + NADP(+).", "evidence": [ { "id": "P32573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32573" } ] }, { "ec_number": "1.3.1.124", "activity": "", "evidence": [ { "id": "P32573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32573" } ] } ] }, { "uniprot_ac": "P34093", "gene_name": "ndkM", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P34093", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34093" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P34093", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34093" } ] } ] }, { "uniprot_ac": "P35559", "gene_name": "Ide", "activity": [ { "ec_number": "3.4.24.56", "activity": "Degradation of insulin, glucagon and other polypeptides. No action on proteins.", "evidence": [ { "id": "P35559", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35559" } ] }, { "ec_number": "3.4.24.56", "activity": "", "evidence": [ { "id": "P35559", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35559" } ] } ] }, { "uniprot_ac": "P36010", "gene_name": "YNK1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P36010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36010" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P36010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36010" } ] } ] }, { "uniprot_ac": "P39069", "gene_name": "Ak1", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] } ] }, { "uniprot_ac": "P41562", "gene_name": "Idh1", "activity": [ { "ec_number": "1.1.1.42", "activity": "D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH.", "evidence": [ { "id": "P41562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41562" } ] }, { "ec_number": "1.1.1.42", "activity": "", "evidence": [ { "id": "P41562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41562" } ] } ] }, { "uniprot_ac": "P70473", "gene_name": "Amacr", "activity": [ { "ec_number": "5.1.99.4", "activity": "a (2S)-2-methylacyl-CoA = a (2R)-2-methylacyl-CoA.", "evidence": [ { "id": "P70473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70473" } ] }, { "ec_number": "5.1.99.4", "activity": "", "evidence": [ { "id": "P70473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70473" } ] } ] }, { "uniprot_ac": "P97519", "gene_name": "Hmgcl", "activity": [ { "ec_number": "4.1.3.4", "activity": "(3S)-hydroxy-3-methylglutaryl-CoA = acetoacetate + acetyl-CoA.", "evidence": [ { "id": "P97519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97519" } ] }, { "ec_number": "4.1.3.4", "activity": "", "evidence": [ { "id": "P97519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97519" } ] } ] }, { "uniprot_ac": "P97524", "gene_name": "Slc27a2", "activity": [ { "ec_number": "6.2.1.3", "activity": "a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "P97524", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97524" } ] }, { "ec_number": "6.2.1.-", "activity": "", "evidence": [ { "id": "P97524", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97524" } ] }, { "ec_number": "6.2.1.7", "activity": "(25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oate + ATP + CoA = (25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "P97524", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97524" } ] }, { "ec_number": "6.2.1.24", "activity": "3,7,11,15-tetramethylhexadecanoate + ATP + CoA = AMP + diphosphate + phytanoyl-CoA.", "evidence": [ { "id": "P97524", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97524" } ] }, { "ec_number": "6.2.1.15", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + ATP + CoA = (5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "P97524", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97524" } ] } ] }, { "uniprot_ac": "P97562", "gene_name": "Acox2", "activity": [ { "ec_number": "1.17.99.3", "activity": "(25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA + A + H2O = (24R,25R)-3alpha,7alpha,12alpha,24-tetrahydroxy-5beta-cholestan-26-oyl-CoA + AH2.", "evidence": [ { "id": "P97562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97562" } ] }, { "ec_number": "1.17.99.3", "activity": "", "evidence": [ { "id": "P97562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97562" } ] } ] }, { "uniprot_ac": "Q01768", "gene_name": "Nme2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q01768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01768" } ] }, { "ec_number": "2.7.13.3", "activity": "ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.", "evidence": [ { "id": "Q01768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01768" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q01768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01768" } ] } ] }, { "uniprot_ac": "Q05982", "gene_name": "Nme1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q05982", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05982" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q05982", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05982" } ] } ] }, { "uniprot_ac": "Q06518", "gene_name": "Nos2", "activity": [ { "ec_number": "1.14.13.39", "activity": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide.", "evidence": [ { "id": "Q06518", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06518" } ] }, { "ec_number": "1.14.13.39", "activity": "", "evidence": [ { "id": "Q06518", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06518" } ] } ] }, { "uniprot_ac": "Q07523", "gene_name": "Hao2", "activity": [ { "ec_number": "1.1.3.15", "activity": "glycolate + O2 = glyoxylate + H2O2.", "evidence": [ { "id": "Q07523", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07523" } ] }, { "ec_number": "1.1.3.15", "activity": "", "evidence": [ { "id": "Q07523", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07523" } ] } ] }, { "uniprot_ac": "Q13232", "gene_name": "NME3", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q13232", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13232" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q13232", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13232" } ] } ] }, { "uniprot_ac": "Q16698", "gene_name": "DECR1", "activity": [ { "ec_number": "1.3.1.124", "activity": "a (2E,4E)-dienoyl-CoA + H(+) + NADPH = a 4,5-saturated-(3E)-enoyl-CoA + NADP(+).", "evidence": [ { "id": "Q16698", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16698" } ] }, { "ec_number": "1.3.1.124", "activity": "", "evidence": [ { "id": "Q16698", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16698" } ] } ] }, { "uniprot_ac": "Q32M07", "gene_name": "Ak8", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q32M07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32M07" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q32M07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32M07" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q32M07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32M07" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q32M07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32M07" } ] } ] }, { "uniprot_ac": "Q3MIB4", "gene_name": "Lonp2", "activity": [ { "ec_number": "3.4.21.-", "activity": "", "evidence": [ { "id": "Q3MIB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MIB4" } ] }, { "ec_number": "3.4.21.53", "activity": "Hydrolysis of proteins in presence of ATP.", "evidence": [ { "id": "Q3MIB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MIB4" } ] }, { "ec_number": "3.4.21.53", "activity": "", "evidence": [ { "id": "Q3MIB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MIB4" } ] } ] }, { "uniprot_ac": "Q3U5Q7", "gene_name": "Cmpk2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q3U5Q7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U5Q7" } ] }, { "ec_number": "2.7.4.14", "activity": "ATP + CMP = ADP + CDP.", "evidence": [ { "id": "Q3U5Q7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U5Q7" } ] }, { "ec_number": "2.7.4.14", "activity": "", "evidence": [ { "id": "Q3U5Q7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U5Q7" } ] } ] }, { "uniprot_ac": "Q4KM73", "gene_name": "Cmpk1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q4KM73", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM73" } ] }, { "ec_number": "2.7.4.14", "activity": "ATP + CMP = ADP + CDP.", "evidence": [ { "id": "Q4KM73", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM73" } ] }, { "ec_number": "2.7.4.14", "activity": "", "evidence": [ { "id": "Q4KM73", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM73" } ] } ] }, { "uniprot_ac": "Q54CG9", "gene_name": "", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q54CG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CG9" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q54CG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CG9" } ] } ] }, { "uniprot_ac": "Q5EBM0", "gene_name": "CMPK2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q5EBM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EBM0" } ] }, { "ec_number": "2.7.4.14", "activity": "ATP + CMP = ADP + CDP.", "evidence": [ { "id": "Q5EBM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EBM0" } ] }, { "ec_number": "2.7.4.14", "activity": "", "evidence": [ { "id": "Q5EBM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EBM0" } ] } ] }, { "uniprot_ac": "Q5I0K1", "gene_name": "Pipox", "activity": [ { "ec_number": "1.5.3.1", "activity": "H2O + O2 + sarcosine = formaldehyde + glycine + H2O2.", "evidence": [ { "id": "Q5I0K1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5I0K1" } ] }, { "ec_number": "1.5.3.1", "activity": "", "evidence": [ { "id": "Q5I0K1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5I0K1" } ] } ] }, { "uniprot_ac": "Q5TCS8", "gene_name": "AK9", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q5TCS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TCS8" } ] }, { "ec_number": "2.7.4.4", "activity": "a ribonucleoside 5'-phosphate + ATP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q5TCS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TCS8" } ] }, { "ec_number": "2.7.4.4", "activity": "", "evidence": [ { "id": "Q5TCS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TCS8" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q5TCS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TCS8" } ] } ] }, { "uniprot_ac": "Q5XIC0", "gene_name": "Eci2", "activity": [ { "ec_number": "5.3.3.8", "activity": "a (3Z)-enoyl-CoA = a 4-saturated (2E)-enoyl-CoA.", "evidence": [ { "id": "Q5XIC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIC0" } ] }, { "ec_number": "5.3.3.8", "activity": "", "evidence": [ { "id": "Q5XIC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIC0" } ] } ] }, { "uniprot_ac": "Q62651", "gene_name": "Ech1", "activity": [ { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "Q62651", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62651" } ] } ] }, { "uniprot_ac": "Q63276", "gene_name": "Baat", "activity": [ { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "Q63276", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63276" } ] }, { "ec_number": "3.1.2.27", "activity": "(3S)-hydroxy-3-methylglutaryl-CoA + H2O = 3-hydroxy-3-methylglutarate + CoA + H(+).", "evidence": [ { "id": "Q63276", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63276" } ] }, { "ec_number": "2.3.1.65", "activity": "choloyl-CoA + glycine = CoA + glycocholate + H(+).", "evidence": [ { "id": "Q63276", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63276" } ] }, { "ec_number": "2.3.1.65", "activity": "", "evidence": [ { "id": "Q63276", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63276" } ] } ] }, { "uniprot_ac": "Q63448", "gene_name": "Acox3", "activity": [ { "ec_number": "1.3.3.6", "activity": "a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2.", "evidence": [ { "id": "Q63448", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63448" } ] }, { "ec_number": "1.3.3.6", "activity": "", "evidence": [ { "id": "Q63448", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63448" } ] } ] }, { "uniprot_ac": "Q64591", "gene_name": "Decr1", "activity": [ { "ec_number": "1.3.1.124", "activity": "a (2E,4E)-dienoyl-CoA + H(+) + NADPH = a 4,5-saturated-(3E)-enoyl-CoA + NADP(+).", "evidence": [ { "id": "Q64591", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64591" } ] }, { "ec_number": "1.3.1.124", "activity": "", "evidence": [ { "id": "Q64591", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64591" } ] } ] }, { "uniprot_ac": "Q68FP8", "gene_name": "Ak8", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q68FP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FP8" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q68FP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FP8" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q68FP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FP8" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q68FP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FP8" } ] } ] }, { "uniprot_ac": "Q6AYD9", "gene_name": "Nudt19", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q6AYD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYD9" } ] } ] }, { "uniprot_ac": "Q704S8", "gene_name": "Crat", "activity": [ { "ec_number": "2.3.1.137", "activity": "(R)-carnitine + octanoyl-CoA = CoA + O-octanoyl-(R)-carnitine.", "evidence": [ { "id": "Q704S8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q704S8" } ] }, { "ec_number": "2.3.1.7", "activity": "(R)-carnitine + acetyl-CoA = CoA + O-acetyl-(R)-carnitine.", "evidence": [ { "id": "Q704S8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q704S8" } ] }, { "ec_number": "2.3.1.137", "activity": "", "evidence": [ { "id": "Q704S8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q704S8" } ] }, { "ec_number": "2.3.1.7", "activity": "", "evidence": [ { "id": "Q704S8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q704S8" } ] } ] }, { "uniprot_ac": "Q8CHM7", "gene_name": "Hacl1", "activity": [ { "ec_number": "4.1.2.63", "activity": "2-hydroxy-3-methylhexadecanoyl-CoA = 2-methylpentadecanal + formyl-CoA.", "evidence": [ { "id": "Q8CHM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHM7" } ] }, { "ec_number": "4.1.2.63", "activity": "", "evidence": [ { "id": "Q8CHM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHM7" } ] } ] }, { "uniprot_ac": "Q8VHK0", "gene_name": "Acot8", "activity": [ { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "Q8VHK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHK0" } ] }, { "ec_number": "3.1.2.27", "activity": "(3S)-hydroxy-3-methylglutaryl-CoA + H2O = 3-hydroxy-3-methylglutarate + CoA + H(+).", "evidence": [ { "id": "Q8VHK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHK0" } ] }, { "ec_number": "3.1.2.1", "activity": "acetyl-CoA + H2O = acetate + CoA + H(+).", "evidence": [ { "id": "Q8VHK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHK0" } ] }, { "ec_number": "3.1.2.11", "activity": "acetoacetyl-CoA + H2O = acetoacetate + CoA + H(+).", "evidence": [ { "id": "Q8VHK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHK0" } ] }, { "ec_number": "3.1.2.3", "activity": "H2O + succinyl-CoA = CoA + H(+) + succinate.", "evidence": [ { "id": "Q8VHK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHK0" } ] }, { "ec_number": "3.1.2.5", "activity": "(3S)-hydroxy-3-methylglutaryl-CoA + H2O = 3-hydroxy-3-methylglutarate + CoA + H(+).", "evidence": [ { "id": "Q8VHK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHK0" } ] }, { "ec_number": "3.1.2.11", "activity": "", "evidence": [ { "id": "Q8VHK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHK0" } ] }, { "ec_number": "3.1.2.5", "activity": "", "evidence": [ { "id": "Q8VHK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHK0" } ] }, { "ec_number": "3.1.2.2", "activity": "", "evidence": [ { "id": "Q8VHK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHK0" } ] }, { "ec_number": "3.1.2.3", "activity": "", "evidence": [ { "id": "Q8VHK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHK0" } ] }, { "ec_number": "3.1.2.1", "activity": "", "evidence": [ { "id": "Q8VHK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHK0" } ] } ] }, { "uniprot_ac": "Q8VID1", "gene_name": "Dhrs4", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] } ] }, { "uniprot_ac": "Q920F5", "gene_name": "Mlycd", "activity": [ { "ec_number": "4.1.1.9", "activity": "H(+) + malonyl-CoA = acetyl-CoA + CO2.", "evidence": [ { "id": "Q920F5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920F5" } ] }, { "ec_number": "4.1.1.9", "activity": "", "evidence": [ { "id": "Q920F5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920F5" } ] } ] }, { "uniprot_ac": "Q920P5", "gene_name": "Ak5", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q920P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P5" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q920P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P5" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q920P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P5" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q920P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P5" } ] } ] }, { "uniprot_ac": "Q96M32", "gene_name": "AK7", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q96M32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96M32" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q96M32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96M32" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q96M32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96M32" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q96M32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96M32" } ] } ] }, { "uniprot_ac": "Q96MA6", "gene_name": "AK8", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q96MA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MA6" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q96MA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MA6" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q96MA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MA6" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q96MA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MA6" } ] } ] }, { "uniprot_ac": "Q9CQ62", "gene_name": "Decr1", "activity": [ { "ec_number": "1.3.1.124", "activity": "a (2E,4E)-dienoyl-CoA + H(+) + NADPH = a 4,5-saturated-(3E)-enoyl-CoA + NADP(+).", "evidence": [ { "id": "Q9CQ62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQ62" } ] }, { "ec_number": "1.3.1.124", "activity": "", "evidence": [ { "id": "Q9CQ62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQ62" } ] } ] }, { "uniprot_ac": "Q9D2H2", "gene_name": "Ak7", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9D2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2H2" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9D2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2H2" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9D2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2H2" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9D2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2H2" } ] } ] }, { "uniprot_ac": "Q9DBP5", "gene_name": "Cmpk1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9DBP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBP5" } ] }, { "ec_number": "2.7.4.14", "activity": "ATP + CMP = ADP + CDP.", "evidence": [ { "id": "Q9DBP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBP5" } ] }, { "ec_number": "2.7.4.14", "activity": "", "evidence": [ { "id": "Q9DBP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBP5" } ] } ] }, { "uniprot_ac": "Q9ES71", "gene_name": "Gnpat", "activity": [ { "ec_number": "2.3.1.42", "activity": "an acyl-CoA + dihydroxyacetone phosphate = a 1-acylglycerone 3-phosphate + CoA.", "evidence": [ { "id": "Q9ES71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ES71" } ] }, { "ec_number": "2.3.1.42", "activity": "", "evidence": [ { "id": "Q9ES71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ES71" } ] } ] }, { "uniprot_ac": "Q9NUI1", "gene_name": "DECR2", "activity": [ { "ec_number": "1.3.1.124", "activity": "a (2E,4E)-dienoyl-CoA + H(+) + NADPH = a 4,5-saturated-(3E)-enoyl-CoA + NADP(+).", "evidence": [ { "id": "Q9NUI1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUI1" } ] }, { "ec_number": "1.3.1.124", "activity": "", "evidence": [ { "id": "Q9NUI1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUI1" } ] } ] }, { "uniprot_ac": "Q9QXL7", "gene_name": "Nme7", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9QXL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXL7" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9QXL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXL7" } ] } ] }, { "uniprot_ac": "Q9QXL8", "gene_name": "Nme7", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9QXL8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXL8" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9QXL8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXL8" } ] } ] }, { "uniprot_ac": "Q9R0Y5", "gene_name": "Ak1", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] } ] }, { "uniprot_ac": "Q9VY27", "gene_name": "nmdyn-D6", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9VY27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VY27" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9VY27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VY27" } ] } ] }, { "uniprot_ac": "Q9WUR9", "gene_name": "Ak4", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q9WUR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUR9" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9WUR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUR9" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9WUR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUR9" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "Q9WUR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUR9" } ] } ] }, { "uniprot_ac": "Q9WUS0", "gene_name": "Ak4", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q9WUS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUS0" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9WUS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUS0" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9WUS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUS0" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "Q9WUS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUS0" } ] } ] }, { "uniprot_ac": "Q9WV68", "gene_name": "Decr2", "activity": [ { "ec_number": "1.3.1.124", "activity": "a (2E,4E)-dienoyl-CoA + H(+) + NADPH = a 4,5-saturated-(3E)-enoyl-CoA + NADP(+).", "evidence": [ { "id": "Q9WV68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV68" } ] }, { "ec_number": "1.3.1.124", "activity": "", "evidence": [ { "id": "Q9WV68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV68" } ] } ] }, { "uniprot_ac": "Q9WV84", "gene_name": "Nme4", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9WV84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV84" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9WV84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV84" } ] } ] }, { "uniprot_ac": "Q9WV85", "gene_name": "Nme3", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9WV85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV85" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9WV85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV85" } ] } ] }, { "uniprot_ac": "Q9WVK3", "gene_name": "Pecr", "activity": [ { "ec_number": "1.3.1.38", "activity": "a (2E)-enoyl-CoA + H(+) + NADPH = a 2,3-saturated acyl-CoA + NADP(+).", "evidence": [ { "id": "Q9WVK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVK3" } ] }, { "ec_number": "1.3.1.38", "activity": "", "evidence": [ { "id": "Q9WVK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVK3" } ] } ] }, { "uniprot_ac": "Q9Y5B8", "gene_name": "NME7", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9Y5B8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y5B8" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9Y5B8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y5B8" } ] } ] }, { "uniprot_ac": "Q9Y6K8", "gene_name": "AK5", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9Y6K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K8" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9Y6K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K8" } ] }, { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9Y6K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K8" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9Y6K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K8" } ] } ] }, { "uniprot_ac": "Q9Z2M4", "gene_name": "Decr2", "activity": [ { "ec_number": "1.3.1.124", "activity": "a (2E,4E)-dienoyl-CoA + H(+) + NADPH = a 4,5-saturated-(3E)-enoyl-CoA + NADP(+).", "evidence": [ { "id": "Q9Z2M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ] }, { "ec_number": "1.3.1.124", "activity": "", "evidence": [ { "id": "Q9Z2M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9Z2M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9Z2M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }