{ "uniprot_canonical_ac": "Q9Z2A9-1", "uniprot_ac": "Q9Z2A9", "uniprot_id": "GGT5_MOUSE", "mass": { "chemical_mass": 61674.0, "monoisotopic_mass": 61674.0 }, "refseq": { "ac": "NP_035950", "name": "glutathione hydrolase 5 proenzyme isoform 1 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035950" }, "gene_names": [ { "name": "Ggt5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9Z2A9", "id": "Q9Z2A9" }, { "name": "GGL; GGT-REL; Ggtla1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035950", "id": "NP_035950" }, { "name": "Ggt5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035950", "id": "NP_035950" }, { "name": "Ggtla1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9Z2A9", "id": "Q9Z2A9" } ], "protein_names": [ { "name": "Glutathione hydrolase 5 proenzyme", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9Z2A9" }, { "name": "2.3.2.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2A9" }, { "name": "3.4.19.13", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2A9" }, { "name": "3.4.19.14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2A9" }, { "name": "GGL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2A9" }, { "name": "GGT 5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2A9" }, { "name": "Gamma-glutamyl leukotrienase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2A9" }, { "name": "Gamma-glutamyltransferase 5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2A9" }, { "name": "Gamma-glutamyltransferase-like activity 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2A9" }, { "name": "Gamma-glutamyltranspeptidase 5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2A9" }, { "name": "Leukotriene-C4 hydrolase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z2A9" }, { "name": "gamma-glutamyltranspeptidase 5; gamma-glutamyl leukotrienase; leukotriene-C4 hydrolase; gamma-glutamyltransferase-like activity 1; glutathione hydrolase 5 proenzyme", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035950", "id": "NP_035950" }, { "name": "glutathione hydrolase 5 proenzyme isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035950", "id": "NP_035950" } ], "function": [ { "annotation": "Abcc1 and Ggt5 support lymphocyte guidance through export and catabolism of S-geranylgeranyl-l-glutathione.", "evidence": [ { "database": "RefSeq", "id": "NP_035950", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035950" }, { "database": "PubMed", "id": "34088745", "url": "https://glygen.org/publication/PubMed/34088745" } ] }, { "annotation": "Cleaves the gamma-glutamyl peptide bond of glutathione and glutathione-S-conjugate (By similarity). Converts leukotriene C4 (LTC4), a glutathione-S-conjugate, to leukotriene D4 (LTD4) (PubMed:9774450, PubMed:11463821, PubMed:12163373). Does not cleaves gamma-glutamyl compounds such as gamma-glutamyl leucine. May also catalyze a transpeptidation reaction in addition to the hydrolysis reaction, transferring the gamma-glutamyl moiety to an acceptor amino acid to form a new gamma-glutamyl compound. Acts as a negative regulator of geranylgeranyl glutathione bioactivity by cleaving off its gamma-glutamyl group, playing a role in adaptive immune responses (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9#function" }, { "database": "PubMed", "id": "12163373", "url": "https://glygen.org/publication/PubMed/12163373" }, { "database": "UniProtKB", "id": "P36269", "url": "https://www.uniprot.org/uniprot/P36269#function" }, { "database": "PubMed", "id": "11463821", "url": "https://glygen.org/publication/PubMed/11463821" }, { "database": "PubMed", "id": "9774450", "url": "https://glygen.org/publication/PubMed/9774450" } ] }, { "annotation": "GGT5/oxidative stress cascade plays a central role during luteinizing hormone-stimulated steroidogenesis.", "evidence": [ { "database": "RefSeq", "id": "NP_035950", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035950" }, { "database": "PubMed", "id": "27397680", "url": "https://glygen.org/publication/PubMed/27397680" } ] }, { "annotation": "Plays an important role in inflammatory processes", "evidence": [ { "database": "RefSeq", "id": "NP_035950", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035950" }, { "database": "PubMed", "id": "12163373", "url": "https://glygen.org/publication/PubMed/12163373" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ggt5", "url": "https://www.uniprot.org/uniprot/Q9Z2A9", "locus": { "chromosome": "10", "start_pos": 75453034, "end_pos": 75425174, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000006344", "url": "https://www.ensembl.org/id/ENSMUSG00000006344" } ] } } ], "crossref": [ { "id": "ENSMUSG00000006344", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000006344", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.4.19.14", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.4.19.14&UniProtAcc=Q9Z2A9", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "23887", "url": "https://www.ncbi.nlm.nih.gov/gene/23887", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2331", "url": "https://glyconnect.expasy.org/browser/proteins/2331", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "GPDB0007854", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0007854", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0007855", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0007855", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "IPR000101", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000101", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029055", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029055", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043137", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043137", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043138", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043138", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:23887", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:23887", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1346063", "url": "http://www.informatics.jax.org/marker/MGI:1346063", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "VCGMGPP", "url": "https://omabrowser.org/oma/group/VCGMGPP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2910309at2759", "url": "http://www.orthodb.org/?query=2910309at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11686", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11686", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11686:SF19", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11686:SF19", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01019", "url": "http://pfam.xfam.org/family/PF01019", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9Z2A9", "url": "http://purl.obolibrary.org/obo/PR_Q9Z2A9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-174403", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174403", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-2142691", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2142691", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5423646", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9753281", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_035950", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035950", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "23904", "url": "https://www.rhea-db.org/rhea/23904", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "28807", "url": "https://www.rhea-db.org/rhea/28807", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "31563", "url": "https://www.rhea-db.org/rhea/31563", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "59468", "url": "https://www.rhea-db.org/rhea/59468", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "65120", "url": "https://www.rhea-db.org/rhea/65120", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A087WNR3", "url": "https://www.uniprot.org/uniprot/A0A087WNR3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WNR3-1", "url": "https://www.uniprot.org/uniprot/A0A087WNR3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WSM3", "url": "https://www.uniprot.org/uniprot/A0A087WSM3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WSM3-1", "url": "https://www.uniprot.org/uniprot/A0A087WSM3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80WV0", "url": "https://www.uniprot.org/uniprot/Q80WV0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80WV0-1", "url": "https://www.uniprot.org/uniprot/Q80WV0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z2A9-1", "url": "https://www.uniprot.org/uniprot/Q9Z2A9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z2A9-2", "url": "https://www.uniprot.org/uniprot/Q9Z2A9-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAWGHRATVCLVLLGVGLGLVIVVLAAVLSPRQASCGPGAFTRAAVAADSKICSDIGRAILQQRGSPVDAAIAALVCTGVVNPQSMGLGGGVVFTIYNASTGKVEIINARETVPASYDQGLLNQCKNVLPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIALLREGFRVPFILSQFLNNSILRPHLSASTLRQLFFNGTETLRSQDPFPWPALANTLETVAKEGAEVLYTGRLGRMLVEDIAKQGSLLTVQDLAAFQPEVVEPLEMPLGNYTLYSPPPPAGGAILSFILNVLKGFNFSAETVARPGGEVNMYHHLVETLKFAVGQRWRLWDPSSHPGIQNISRDLLREDLAQRIRQQIDGRGDHHQLSHYNLTGVRGNRMGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGILLNNELLDLCWRHMPTSPITPPPVPGERPPSSMVPSILVNKGQGSKLVIGGAGGELIISAVAQTIMNKLWLGFDLTEAIASPILHVNSKGHVEYEPKFNQEVQKGLQDRGQIQSQSQRPVFLNAVQAVFQEGPCVYAASDLRKAGKASGY", "length": 573, "header": "sp|Q9Z2A9-1|GGT5_MOUSE Isoform 1 of Glutathione hydrolase 5 proenzyme OS=Mus musculus OX=10090 GN=Ggt5 PE=1 SV=2 CANONICAL=Q9Z2A9-1" }, "isoforms": [ { "isoform_ac": "A0A087WNR3-1", "url": "", "sequence": { "sequence": "MAWGHRATVCLVLLGVGLGLVIVVLAAVLSPRQASCGPGAFTRAAVAADSKICSDIGRKPADSSGLGCLPA", "length": 71, "header": "tr|A0A087WNR3-1|A0A087WNR3_MOUSE Computationally mapped isoform of Gamma-glutamyltransferase 5 OS=Mus musculus OX=10090 GN=Ggt5 PE=1 SV=1 CANONICAL=Q9Z2A9-1" }, "locus": { "chromosome": "10", "start_pos": 75441129, "end_pos": 75425544, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000189972.2", "url": "https://www.ensembl.org/id/ENSMUST00000189972.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000139459.2", "url": "https://www.ensembl.org/id/ENSMUSP00000139459.2" } ] } }, { "isoform_ac": "A0A087WSM3-1", "url": "", "sequence": { "sequence": "XLSPRQASCGPGAFTRAAVAADSKICSDIGRAILQQRGSPVDAAIAALVCTGVVNPQSMGLGGGVVFTIYNASTGKVEIINARETVPASYDQGLLNQCKNVLPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIALLREGFRVPFILSQFLNNSILRPHLSASTLSARTLAVTQRRILTISLGLCRKPADSSGLGCLPA", "length": 205, "header": "tr|A0A087WSM3-1|GGT5_MOUSE Computationally mapped isoform of Glutathione hydrolase 5 proenzyme OS=Mus musculus OX=10090 GN=Ggt5 PE=1 SV=1 CANONICAL=Q9Z2A9-1" }, "locus": { "chromosome": "10", "start_pos": 75441130, "end_pos": 75425626, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000189991.2", "url": "https://www.ensembl.org/id/ENSMUST00000189991.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000141106.2", "url": "https://www.ensembl.org/id/ENSMUSP00000141106.2" } ] } }, { "isoform_ac": "Q80WV0-1", "url": "", "sequence": { "sequence": "MAWGHRATVCLVLLGVGLGLVIVVLAAVLSPRQASCGPGAFTRAAVAADSKICSDIGRAILQQRGSPVDAAIAALVCTGVVNPQSMGLGGGVVFTIYNASTGKVEIINARETVPASYDQGLLNQCKNVLPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIALLREGFRVPFILSQFLNNSILRPHLSASTLSQNLIWTKDSLLPRHWLPSACLWEWHIAFFAQ", "length": 230, "header": "tr|Q80WV0-1|Q80WV0_MOUSE Computationally mapped isoform of Ggt5 protein OS=Mus musculus OX=10090 GN=Ggt5 PE=1 SV=1 CANONICAL=Q9Z2A9-1" }, "locus": { "chromosome": "10", "start_pos": 75440239, "end_pos": 75425544, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000218807.2", "url": "https://www.ensembl.org/id/ENSMUST00000218807.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000151283.2", "url": "https://www.ensembl.org/id/ENSMUSP00000151283.2" } ] } }, { "isoform_ac": "Q9Z2A9-1", "url": "", "sequence": { "sequence": "MAWGHRATVCLVLLGVGLGLVIVVLAAVLSPRQASCGPGAFTRAAVAADSKICSDIGRAILQQRGSPVDAAIAALVCTGVVNPQSMGLGGGVVFTIYNASTGKVEIINARETVPASYDQGLLNQCKNVLPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIALLREGFRVPFILSQFLNNSILRPHLSASTLRQLFFNGTETLRSQDPFPWPALANTLETVAKEGAEVLYTGRLGRMLVEDIAKQGSLLTVQDLAAFQPEVVEPLEMPLGNYTLYSPPPPAGGAILSFILNVLKGFNFSAETVARPGGEVNMYHHLVETLKFAVGQRWRLWDPSSHPGIQNISRDLLREDLAQRIRQQIDGRGDHHQLSHYNLTGVRGNRMGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGILLNNELLDLCWRHMPTSPITPPPVPGERPPSSMVPSILVNKGQGSKLVIGGAGGELIISAVAQTIMNKLWLGFDLTEAIASPILHVNSKGHVEYEPKFNQEVQKGLQDRGQIQSQSQRPVFLNAVQAVFQEGPCVYAASDLRKAGKASGY", "length": 573, "header": "sp|Q9Z2A9-1|GGT5_MOUSE Isoform 1 of Glutathione hydrolase 5 proenzyme OS=Mus musculus OX=10090 GN=Ggt5 PE=1 SV=2 CANONICAL=Q9Z2A9-1" }, "locus": { "chromosome": "10", "start_pos": 75450713, "end_pos": 75425544, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000072217", "url": "https://www.ensembl.org/id/ENSMUST00000072217" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000072074", "url": "https://www.ensembl.org/id/ENSMUSP00000072074" } ] } }, { "isoform_ac": "Q9Z2A9-2", "url": "", "sequence": { "sequence": "MAWGHRATVCLVLLGVGLGLVIVVLAAVLSPRQASCGPGAFTRAAVAADSKICSDIGRAILQQRGSPVDAAIAALVCTGVVNPQSMGLGGGVVFTIYNASTGKVEIINARETVPASYDQGLLNQCKNVLPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIALLREGFRVPFILSQFLNNSILRPHLSASTLRQLFFNGTETLRSQDPFPWPALANTLETVAKEGAEVLYTGRLGRMLVEDIAKQGSLLTVQDLAAFQPEVVEPLEMPLGNYTLYSPPPPAGGAILSFILNVLKGFNFSAETVARPGGEVNMYHHLVETLKFAVGQRWRLWDPSSHPGIQNISRDLLREDLAQRIRQQIDGRGDHHQLSHYNLTGVRGNRMGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGILLNNELLDLCWRHMPTSPITPPPDYHEQAVAWL", "length": 456, "header": "sp|Q9Z2A9-2|GGT5_MOUSE Isoform 2 of Glutathione hydrolase 5 proenzyme OS=Mus musculus OX=10090 GN=Ggt5 PE=1 SV=2 CANONICAL=Q9Z2A9-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "Q9Z2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A9#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "Q9Z2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A9#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 277, "start_aa": "Asn", "end_pos": 277, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn277", "evidence": [ { "id": "Q9Z2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A9#ptm_processing" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 303, "start_aa": "Asn", "end_pos": 303, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn303", "evidence": [ { "id": "2331", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2331" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 303, "start_aa": "Asn", "end_pos": 303, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn303", "evidence": [ { "id": "Q9Z2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A9#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 347, "start_aa": "Asn", "end_pos": 347, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn347", "evidence": [ { "id": "Q9Z2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A9#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 378, "start_aa": "Asn", "end_pos": 378, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn378", "evidence": [ { "id": "Q9Z2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A9#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "Q9Z2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A9#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Disruption of gamma-glutamyl leukotrienase results in disruption of leukotriene D(4) synthesis in vivo and attenuation of the acute inflammatory response.", "journal": "Mol. Cell. Biol.", "date": "2001", "authors": "Han B., Matzuk M.M., Habib G.M., Lieberman M.W., Shi Z.Z.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "reference": [ { "type": "PubMed", "id": "11463821", "url": "https://glygen.org/publication/PubMed/11463821" } ] }, { "title": "Gamma-glutamyl leukotrienase, a novel endothelial membrane protein, is specifically responsible for leukotriene D(4) formation in vivo.", "journal": "Am. J. Pathol.", "date": "2002", "authors": "Han B, Luo G, Shi ZZ, Barrios R, Atwood D, Liu W, Habib GM, Sifers RN, Corry DB, Lieberman MW", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" }, { "database": "RefSeq", "id": "NP_035950", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035950" } ], "reference": [ { "type": "PubMed", "id": "12163373", "url": "https://glygen.org/publication/PubMed/12163373" } ] }, { "title": "Augmented expression of gamma-glutamyl transferase 5 (GGT5) impairs testicular steroidogenesis by deregulating local oxidative stress.", "journal": "Cell and tissue research", "date": "2016", "authors": "Li W, Wu ZQ, Zhang S, Cao R, Zhao J, Sun ZJ, Zou W", "evidence": [ { "database": "RefSeq", "id": "NP_035950", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035950" } ], "reference": [ { "type": "PubMed", "id": "27397680", "url": "https://glygen.org/publication/PubMed/27397680" } ] }, { "title": "Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis.", "journal": "Nature communications", "date": "2019", "authors": "Riley NM, Hebert AS, Westphall MS, Coon JJ", "evidence": [ { "database": "GlyConnect", "id": "2331", "url": "https://glyconnect.expasy.org/browser/proteins/2331" } ], "reference": [ { "type": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "title": "Abcc1 and Ggt5 support lymphocyte guidance through export and catabolism of S-geranylgeranyl-l-glutathione.", "journal": "Science immunology", "date": "2021", "authors": "Gallman AE, Wolfreys FD, Nguyen DN, Sandy M, Xu Y, An J, Li Z, Marson A, Lu E, Cyster JG", "evidence": [ { "database": "RefSeq", "id": "NP_035950", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035950" } ], "reference": [ { "type": "PubMed", "id": "34088745", "url": "https://glygen.org/publication/PubMed/34088745" } ] }, { "title": "Gamma-glutamyl leukotrienase, a gamma-glutamyl transpeptidase gene family member, is expressed primarily in spleen.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Carter BZ, Shi ZZ, Barrios R, Lieberman MW", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "reference": [ { "type": "PubMed", "id": "9774450", "url": "https://glygen.org/publication/PubMed/9774450" } ] } ], "pathway": [ { "id": "mmu:23887", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:23887", "resource": "KEGG Pathway" }, { "id": "R-MMU-174403", "name": "Glutathione synthesis and recycling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174403", "resource": "Reactome", "description": "Glutathione synthesis and recycling" }, { "id": "R-MMU-2142691", "name": "Synthesis of Leukotrienes (LT) and Eoxins (EX)", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2142691", "resource": "Reactome", "description": "Synthesis of Leukotrienes (LT) and Eoxins (EX)" }, { "id": "R-MMU-5423646", "name": "Aflatoxin activation and detoxification", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5423646", "resource": "Reactome", "description": "Aflatoxin activation and detoxification" }, { "id": "R-MMU-9753281", "name": "Paracetamol ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9753281", "resource": "Reactome", "description": "Paracetamol ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "P36269-1", "protein_name": "Glutathione hydrolase 5 proenzyme", "gene_name": "GGT5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARGYGATVSLVLLGLGLALAVIVLAVVLSRHQAPCGPQAFAHAAVAADSKVCSDIGRAILQQQGSPVDATIAALVCTSVVNPQSMGLGGGVIFTIYNVTTGKVEVINARETVPASHAPSLLDQCAQALPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIALLRGGHVVAPVLSRFLHNSILRPSLQASTLRQLFFNGTEPLRPQDPLPWPALATTLETVATEGVEVFYTGRLGQMLVEDIAKEGSQLTLQDLAKFQPEVVDALEVPLGDYTLYSPPPPAGGAILSFILNVLRGFNFSTESMARPEGRVNVYHHLVETLKFAKGQRWRLGDPRSHPKLQNASRDLLGETLAQLIRQQIDGRGDHQLSHYSLAEAWGHGTGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGIILNNELLDLCERCPRGSGTTPSPVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKAQGSKLVIGGAGGELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY", "length": 586 }, "evidence": [ { "id": "45229600", "url": "http://www.informatics.jax.org/homology/45229600", "database": "MGI" }, { "id": "Q9Z2A9", "url": "https://omabrowser.org/oma/group/Q9Z2A9/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q05902-1", "protein_name": "Glutathione hydrolase proenzyme", "gene_name": "ECM38", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MLLCNRKVPKTLNTCFILHIFTLLTLGVLVSGMPSKMVSFASQETLQRINNLLRGSANRDVDIIAEYLKKDDDDDGGDKDHHNIDIDPLPRRPSLTPDRQLLKVGLHGAISSDLEVCSNLTINEVLLKFPGSNAADAAVTQALCKGMVNFFNSGIGGGGYVVFSGKDDEDHLSIDFREKAPMDSHKFMFENCSLCSKIGGLAVGVPGELMGLYRLFKERGSGQVDWRDLIEPVAKLGSVGWQIGEALGATLELYEDVFLTLKEDWSFVLNSTHDGVLKEGDWIKRPALSNMLMELAKNGSVAPFYDPDHWIAKSMIDTVAKYNGIMNLQDVSSYDVHVTKPLSMKIRKGANFIPDNDMTVLTSSGSSSGAALLAALRIMDNFQNQEGGDYEKETTYHLLESMKWMASARSRLGDFEGEALPKHIEEVLDPEWALKAVKSIKRNSQDGNFKTLENWTLYDPAYDINNPHGTAHFSIVDSHGNAVSLTTTINLLFGSLVHDPKTGVIFNNEMDDFAQFNKSNSFELAPSIYNFPEPGKRPLSSTAPTIVLSELGIPDLVVGASGGSRITTSVLQTIVRTYWYNMPILETIAYPRIHHQLLPDRIELESFPMIGKAVLSTLKEMGYTMKEVFPKSVVNAIRNVRGEWHAVSDYWRKRGISSVY", "length": 660 }, "evidence": [ { "id": "Q9Z2A9", "url": "https://omabrowser.org/oma/group/Q9Z2A9/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q9QWE9-1", "protein_name": "Glutathione hydrolase 5 proenzyme", "gene_name": "Ggt5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAWGHRTTVCLVLLGVSLGLAIIVLAVVLPHHQASCRPDAFTRAAVAADSKICSDIGRVILQQQGSPVDAAIAALICTGVVNPQSMGLGGGVVFTIYNASTGKVEVINARETVPASHDQRLLDQCTNALPLCTGAQWIGVPGELRGYAEAHRRYGRLPWAQLFQPTIALLREGFRVPPILSQFLNTSFLQPCLNSSTLRQLFFNGTETLRSQDPLPWPALANTLETVAKEGAEVLYTGKLGQTLVEDIAWQGSQLTVQDLAAFRPKVVEPLEMALGNYTLYSPPPPAGGAILSFILNVLKGFNFSAETVAGPEGKVNMYHHLVEALKFAVGQRWRLWDPYSHPGIQNISQDLLRETLAQHIRQQIDGRGDHQLSHYNLSGVRGNSMGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGILLNNELLDLCWRHKPGSTVTPPPVPGEQPPSSMVPSILINEVQGSKLVIGGAGGELIISAVTQAIVNKLWLGFSLTDAIAAPILHVNSKGHVEYEPKFNQEVRKGLQDRGQSQSQSQRPVFLNSVQAVFQEGPCVYAASDLRKAGKASGY", "length": 572 }, "evidence": [ { "id": "45229600", "url": "http://www.informatics.jax.org/homology/45229600", "database": "MGI" }, { "id": "Q9Z2A9", "url": "https://omabrowser.org/oma/group/Q9Z2A9/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "glutathione catabolic process", "id": "GO:0006751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006751", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" }, { "name": "glutathione biosynthetic process", "id": "GO:0006750", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006750", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" }, { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" }, { "name": "fatty acid metabolic process", "id": "GO:0006631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006631", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" }, { "name": "amino acid metabolic process", "id": "GO:0006520", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006520", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" }, { "name": "response to organonitrogen compound", "id": "GO:0010243", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010243", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" }, { "name": "leukotriene D4 biosynthetic process", "id": "GO:1901750", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901750", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "glutathione hydrolase activity", "id": "GO:0036374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036374", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" }, { "name": "peptidyltransferase activity", "id": "GO:0000048", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000048", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" }, { "name": "leukotriene-C(4) hydrolase", "id": "GO:0002951", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002951", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" }, { "name": "hypoglycin A gamma-glutamyl transpeptidase activity", "id": "GO:0102953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102953", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" }, { "name": "leukotriene C4 gamma-glutamyl transferase activity", "id": "GO:0103068", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0103068", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 185, "end_pos": 187, "annotation": "n_glycosylation_sequon" }, { "start_pos": 204, "end_pos": 206, "annotation": "n_glycosylation_sequon" }, { "start_pos": 277, "end_pos": 279, "annotation": "n_glycosylation_sequon" }, { "start_pos": 303, "end_pos": 305, "annotation": "n_glycosylation_sequon" }, { "start_pos": 347, "end_pos": 349, "annotation": "n_glycosylation_sequon" }, { "start_pos": 378, "end_pos": 380, "annotation": "n_glycosylation_sequon" }, { "start_pos": 98, "end_pos": 100, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Cleaved by autocatalysis into a large and a small subunit.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" }, { "database": "PubMed", "id": "P19440", "url": "https://glygen.org/publication/PubMed/P19440" } ] }, { "annotation": "Glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2A9", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" }, { "database": "PubMed", "id": "12163373", "url": "https://glygen.org/publication/PubMed/12163373" } ] } ], "interactions": [], "reactions": [ { "id": "23904", "name": "", "equation": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6IE08-1", "P07314-1", "Q99MZ4-1", "Q9QWE9-1", "Q9UJ14-1", "A6NGU5-1", "P19440-1", "Q6P531-1", "P36269-1", "Q99JP7-1", "Q6PDE7-1", "Q60928-1", "Q9Z2A9-1", "Q05902-1" ], "evidence": [ { "id": "23904", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/23904" } ] }, { "id": "28807", "name": "", "equation": "glutathione + H2O = L-cysteinylglycine + L-glutamate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6IE08-1", "P07314-1", "Q99MZ4-1", "Q9QWE9-1", "Q9UJ14-1", "A6NGU5-1", "P19440-1", "Q6P531-1", "P36269-1", "Q99JP7-1", "Q6PDE7-1", "Q60928-1", "Q9Z2A9-1", "Q05902-1" ], "evidence": [ { "id": "28807", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/28807" } ] }, { "id": "31563", "name": "", "equation": "H2O + leukotriene C4 = L-glutamate + leukotriene D4", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07314-1", "Q9QWE9-1", "P19440-1", "P36269-1", "Q60928-1", "Q9Z2A9-1" ], "evidence": [ { "id": "31563", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/31563" } ] }, { "id": "59468", "name": "", "equation": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6IE08-1", "P07314-1", "Q99MZ4-1", "Q9QWE9-1", "Q9UJ14-1", "A6NGU5-1", "P19440-1", "Q6P531-1", "P36269-1", "Q99JP7-1", "Q6PDE7-1", "Q60928-1", "Q9Z2A9-1", "Q05902-1" ], "evidence": [ { "id": "59468", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/59468" } ] }, { "id": "65120", "name": "", "equation": "H2O + S-[(2E,6E,10E)-geranylgeranyl]-L-glutathione = L-glutamate + S-[(2E,6E,10E)-geranylgeranyl]-L-cysteinylglycine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QWE9-1", "P36269-1", "Q9Z2A9-1" ], "evidence": [ { "id": "65120", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/65120" } ] }, { "id": "R-MMU-266046", "name": "GGT1, 5 dimers hydrolyse LTC4 to LTD4", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [ "R-ALL-266013" ], "output_participant_list": [ "R-ALL-210382", "R-ALL-266074" ], "enzyme_list": [ "Q9Z2A9-1", "Q60928-1" ], "evidence": [ { "id": "R-MMU-266046", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-266046" } ] }, { "id": "R-MMU-5433072", "name": "GGTs hydrolyse glutamate from AFXBO-SG, AFNBO-SG", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6PDE7-1", "Q9Z2A9-1", "Q99JP7-1", "Q60928-1" ], "evidence": [ { "id": "R-MMU-5433072", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5433072" } ] }, { "id": "R-MMU-8943279", "name": "GGT dimers hydrolyse GSH", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-1247934" ], "enzyme_list": [ "Q6PDE7-1", "Q9Z2A9-1", "Q99JP7-1", "Q60928-1" ], "evidence": [ { "id": "R-MMU-8943279", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8943279" } ] }, { "id": "R-MMU-9753634", "name": "GGT dimers hydrolyse APAP-SG", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6PDE7-1", "Q9Z2A9-1", "Q99JP7-1", "Q60928-1" ], "evidence": [ { "id": "R-MMU-9753634", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9753634" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1247934", "participant_name": "CysGly [extracellular region]", "crossref": [ { "id": "61694", "database": "ChEBI", "url": "" }, { "id": "000004095652", "database": "ZINC", "url": "" }, { "id": "61694", "database": "ChEBI", "url": "" }, { "id": "000004095652", "database": "ZINC", "url": "" }, { "id": "61694", "database": "ChEBI", "url": "" }, { "id": "000004095652", "database": "ZINC", "url": "" }, { "id": "000004095652", "database": "ZINC", "url": "" }, { "id": "61694", "database": "ChEBI", "url": "" }, { "id": "61694", "database": "ChEBI", "url": "" }, { "id": "000004095652", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-210382", "participant_name": "L-Glu [extracellular region]", "crossref": [ { "id": "C00025", "database": "COMPOUND", "url": "" }, { "id": "29985", "database": "ChEBI", "url": "" }, { "id": "000001482113", "database": "ZINC", "url": "" }, { "id": "C00025", "database": "COMPOUND", "url": "" }, { "id": "29985", "database": "ChEBI", "url": "" }, { "id": "000001482113", "database": "ZINC", "url": "" }, { "id": "C00025", "database": "COMPOUND", "url": "" }, { "id": "29985", "database": "ChEBI", "url": "" }, { "id": "000001482113", "database": "ZINC", "url": "" }, { "id": "29985", "database": "ChEBI", "url": "" }, { "id": "C00025", "database": "COMPOUND", "url": "" }, { "id": "000001482113", "database": "ZINC", "url": "" }, { "id": "C00025", "database": "COMPOUND", "url": "" }, { "id": "000001482113", "database": "ZINC", "url": "" }, { "id": "29985", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-266013", "participant_name": "LTC4 [extracellular region]", "crossref": [ { "id": "000004095814", "database": "ZINC", "url": "" }, { "id": "3354", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C02166", "database": "COMPOUND", "url": "" }, { "id": "16978", "database": "ChEBI", "url": "" }, { "id": "HMDB0001198", "database": "HMDB Metabolite", "url": "" }, { "id": "C02166", "database": "COMPOUND", "url": "" }, { "id": "16978", "database": "ChEBI", "url": "" }, { "id": "000004095814", "database": "ZINC", "url": "" }, { "id": "HMDB0001198", "database": "HMDB Metabolite", "url": "" }, { "id": "3354", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C02166", "database": "COMPOUND", "url": "" }, { "id": "000004095814", "database": "ZINC", "url": "" }, { "id": "3354", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001198", "database": "HMDB Metabolite", "url": "" }, { "id": "16978", "database": "ChEBI", "url": "" }, { "id": "HMDB0001198", "database": "HMDB Metabolite", "url": "" }, { "id": "16978", "database": "ChEBI", "url": "" }, { "id": "C02166", "database": "COMPOUND", "url": "" }, { "id": "000004095814", "database": "ZINC", "url": "" }, { "id": "3354", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C02166", "database": "COMPOUND", "url": "" }, { "id": "16978", "database": "ChEBI", "url": "" }, { "id": "000004095814", "database": "ZINC", "url": "" }, { "id": "HMDB0001198", "database": "HMDB Metabolite", "url": "" }, { "id": "3354", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004095814", "database": "ZINC", "url": "" }, { "id": "3354", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C02166", "database": "COMPOUND", "url": "" }, { "id": "16978", "database": "ChEBI", "url": "" }, { "id": "HMDB0001198", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-266074", "participant_name": "LTD4 [extracellular region]", "crossref": [ { "id": "3353", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C05951", "database": "COMPOUND", "url": "" }, { "id": "HMDB0003080", "database": "HMDB Metabolite", "url": "" }, { "id": "000004632133", "database": "ZINC", "url": "" }, { "id": "28666", "database": "ChEBI", "url": "" }, { "id": "C05951", "database": "COMPOUND", "url": "" }, { "id": "28666", "database": "ChEBI", "url": "" }, { "id": "3353", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004632133", "database": "ZINC", "url": "" }, { "id": "HMDB0003080", "database": "HMDB Metabolite", "url": "" }, { "id": "C05951", "database": "COMPOUND", "url": "" }, { "id": "28666", "database": "ChEBI", "url": "" }, { "id": "3353", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004632133", "database": "ZINC", "url": "" }, { "id": "HMDB0003080", "database": "HMDB Metabolite", "url": "" }, { "id": "C05951", "database": "COMPOUND", "url": "" }, { "id": "28666", "database": "ChEBI", "url": "" }, { "id": "3353", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004632133", "database": "ZINC", "url": "" }, { "id": "HMDB0003080", "database": "HMDB Metabolite", "url": "" }, { "id": "C05951", "database": "COMPOUND", "url": "" }, { "id": "28666", "database": "ChEBI", "url": "" }, { "id": "3353", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004632133", "database": "ZINC", "url": "" }, { "id": "HMDB0003080", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A6NGU5", "gene_name": "GGT3P", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "A6NGU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NGU5" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "A6NGU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NGU5" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "A6NGU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NGU5" } ] } ] }, { "uniprot_ac": "P07314", "gene_name": "Ggt1", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "P07314", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07314" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "P07314", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07314" } ] }, { "ec_number": "3.4.19.14", "activity": "H2O + leukotriene C4 = L-glutamate + leukotriene D4.", "evidence": [ { "id": "P07314", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07314" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "P07314", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07314" } ] } ] }, { "uniprot_ac": "P19440", "gene_name": "GGT1", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "P19440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19440" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "P19440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19440" } ] }, { "ec_number": "3.4.19.14", "activity": "H2O + leukotriene C4 = L-glutamate + leukotriene D4.", "evidence": [ { "id": "P19440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19440" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "P19440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19440" } ] } ] }, { "uniprot_ac": "P36269", "gene_name": "GGT5", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "P36269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36269" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "P36269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36269" } ] }, { "ec_number": "3.4.19.14", "activity": "H2O + leukotriene C4 = L-glutamate + leukotriene D4.", "evidence": [ { "id": "P36269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36269" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "P36269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36269" } ] } ] }, { "uniprot_ac": "Q05902", "gene_name": "ECM38", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "Q05902", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05902" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "Q05902", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05902" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "Q05902", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05902" } ] } ] }, { "uniprot_ac": "Q60928", "gene_name": "Ggt1", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "Q60928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60928" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "Q60928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60928" } ] }, { "ec_number": "3.4.19.14", "activity": "H2O + leukotriene C4 = L-glutamate + leukotriene D4.", "evidence": [ { "id": "Q60928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60928" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "Q60928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60928" } ] } ] }, { "uniprot_ac": "Q6IE08", "gene_name": "Ggt6", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "Q6IE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IE08" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "Q6IE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IE08" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "Q6IE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IE08" } ] } ] }, { "uniprot_ac": "Q6P531", "gene_name": "GGT6", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "Q6P531", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P531" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "Q6P531", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P531" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "Q6P531", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P531" } ] } ] }, { "uniprot_ac": "Q6PDE7", "gene_name": "Ggt6", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "Q6PDE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PDE7" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "Q6PDE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PDE7" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "Q6PDE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PDE7" } ] } ] }, { "uniprot_ac": "Q99JP7", "gene_name": "Ggt7", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "Q99JP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JP7" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "Q99JP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JP7" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "Q99JP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JP7" } ] } ] }, { "uniprot_ac": "Q99MZ4", "gene_name": "Ggt7", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "Q99MZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MZ4" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "Q99MZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MZ4" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "Q99MZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MZ4" } ] }, { "ec_number": "2.3.2.2", "activity": "", "evidence": [ { "id": "Q99MZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MZ4" } ] } ] }, { "uniprot_ac": "Q9QWE9", "gene_name": "Ggt5", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "Q9QWE9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QWE9" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "Q9QWE9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QWE9" } ] }, { "ec_number": "3.4.19.14", "activity": "H2O + leukotriene C4 = L-glutamate + leukotriene D4.", "evidence": [ { "id": "Q9QWE9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QWE9" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "Q9QWE9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QWE9" } ] } ] }, { "uniprot_ac": "Q9UJ14", "gene_name": "GGT7", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "Q9UJ14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UJ14" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "Q9UJ14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UJ14" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "Q9UJ14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UJ14" } ] } ] }, { "uniprot_ac": "Q9Z2A9", "gene_name": "Ggt5", "activity": [ { "ec_number": "2.3.2.2", "activity": "an alpha-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-alpha-aminoacyl-[peptide].", "evidence": [ { "id": "Q9Z2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ] }, { "ec_number": "3.4.19.13", "activity": "an S-substituted glutathione + H2O = an S-substituted L-cysteinylglycine + L-glutamate.", "evidence": [ { "id": "Q9Z2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ] }, { "ec_number": "3.4.19.14", "activity": "H2O + leukotriene C4 = L-glutamate + leukotriene D4.", "evidence": [ { "id": "Q9Z2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ] }, { "ec_number": "3.4.19.13", "activity": "", "evidence": [ { "id": "Q9Z2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }