{ "uniprot_canonical_ac": "Q9Z280-1", "uniprot_ac": "Q9Z280", "uniprot_id": "PLD1_MOUSE", "mass": { "chemical_mass": 123969.0, "monoisotopic_mass": 123969.0 }, "refseq": { "ac": "NP_001157528", "name": "phospholipase D1 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157528" }, "gene_names": [ { "name": "Pld1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9Z280", "id": "Q9Z280" } ], "protein_names": [ { "name": "Phospholipase D1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9Z280" }, { "name": "3.1.4.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z280" }, { "name": "Choline phosphatase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z280" }, { "name": "PLD 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z280" }, { "name": "Phosphatidylcholine-hydrolyzing phospholipase D1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z280" }, { "name": "choline phosphatase 1; phosphatidylcholine-hydrolyzing phospholipase D1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157528", "id": "NP_001157528" }, { "name": "mPLD1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z280" }, { "name": "phospholipase D1 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157528", "id": "NP_001157528" } ], "function": [ { "annotation": "Differential expression patterns of phospholipase D isoforms 1 and 2 in the mammalian brain and retina.", "evidence": [ { "database": "RefSeq", "id": "NP_001157528", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157528" }, { "database": "PubMed", "id": "35764123", "url": "https://glygen.org/publication/PubMed/35764123" } ] }, { "annotation": "Function as phospholipase selectivefor phosphatidylcholine (PubMed:9395408). Implicated as a critical step in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis. May be involved in the regulation of perinuclear intravesicular membrane traffic (PubMed:9395408).", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280#function" }, { "database": "PubMed", "id": "9395408", "url": "https://glygen.org/publication/PubMed/9395408" } ] }, { "annotation": "PLD1 promotes reactive oxygen species production in vascular smooth muscle cells and injury-induced neointima formation.", "evidence": [ { "database": "RefSeq", "id": "NP_001157528", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157528" }, { "database": "PubMed", "id": "34610470", "url": "https://glygen.org/publication/PubMed/34610470" } ] }, { "annotation": "Phospholipase D1 promotes astrocytic differentiation through the FAK/AURKA/STAT3 signaling pathway in hippocampal neural stem/progenitor cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001157528", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157528" }, { "database": "PubMed", "id": "36162649", "url": "https://glygen.org/publication/PubMed/36162649" } ] }, { "annotation": "RalA and PLD1 promote lipid droplet growth in response to nutrient withdrawal.", "evidence": [ { "database": "RefSeq", "id": "NP_001157528", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157528" }, { "database": "PubMed", "id": "34320341", "url": "https://glygen.org/publication/PubMed/34320341" } ] } ], "disease": [ { "disease_id": "DOID:0080633", "recommended_name": { "id": "DOID:0080633", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080633", "name": "developmental cardiac valvular defect", "description": "A physical disorder that has_material_basis_in homozygous or compound heterozygous mutation in the PLD1 gene on chromosome 3q26." }, "synonyms": [ { "id": "MONDO:0008913", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008913", "name": "cardiac valvular defect, developmental", "description": "" }, { "id": "MONDO:0008913", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008913", "name": "cardiac valvular defect, developmental", "description": "" }, { "id": "MONDO:0008913", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008913", "name": "CARDIAC valvular defect, developmental", "description": "" }, { "id": "MONDO:0008913", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008913", "name": "CVDD", "description": "" }, { "id": "MIM:212093", "resource": "MIM", "url": "https://www.omim.org/entry/212093", "name": "Cardiac valvular dysplasia 1", "description": "Cardiac valvular dysplasia 1" } ], "evidence": [ { "id": "0080633", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080633" } ] }, { "disease_id": "DOID:11832", "recommended_name": { "id": "DOID:11832", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11832", "name": "visual epilepsy", "description": "" }, "synonyms": [ { "id": "DOID:11832", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11832", "name": "epilepsy, visual", "description": "" } ], "evidence": [ { "id": "11832", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11832" } ] }, { "disease_id": "DOID:3498", "recommended_name": { "id": "DOID:3498", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3498", "name": "pancreatic ductal adenocarcinoma", "description": "A pancreatic adenocarcinoma that derives_from pancreatic duct cells." }, "synonyms": [ { "id": "DOID:3498", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3498", "name": "ductal adenocarcinoma of the pancreas", "description": "" } ], "evidence": [ { "id": "3498", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3498" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Pld1", "url": "https://www.uniprot.org/uniprot/Q9Z280", "locus": { "chromosome": "3", "start_pos": 28187511, "end_pos": 27992844, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000027695", "url": "https://www.ensembl.org/id/ENSMUSG00000027695" } ] } } ], "crossref": [ { "id": "ENSMUSG00000027695", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000027695", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.1.4.4", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.4.4&UniProtAcc=Q9Z280", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd01254", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01254", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd07296", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07296", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd09842", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09842", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd09844", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09844", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3309054", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3309054", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "18805", "url": "https://www.ncbi.nlm.nih.gov/gene/18805", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9Z280", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9Z280*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001683", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001683", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001736", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001736", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001849", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001849", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011993", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011993", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015679", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015679", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016555", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016555", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025202", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025202", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036871", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036871", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:18805", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18805", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "109585", "url": "http://www.informatics.jax.org/marker/MGI:109585", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q9Z280", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Z280", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PFPTKSH", "url": "https://omabrowser.org/oma/group/PFPTKSH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "335467at2759", "url": "http://www.orthodb.org/?query=335467at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR18896", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18896", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR18896:SF57", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18896:SF57", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00169", "url": "http://pfam.xfam.org/family/PF00169", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00614", "url": "http://pfam.xfam.org/family/PF00614", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00787", "url": "http://pfam.xfam.org/family/PF00787", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13091", "url": "http://pfam.xfam.org/family/PF13091", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9Z280", "url": "http://purl.obolibrary.org/obo/PR_Q9Z280", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1483166", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2029485", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8980692", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9013149", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9013408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "14445", "url": "https://www.rhea-db.org/rhea/14445", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "44868", "url": "https://www.rhea-db.org/rhea/44868", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "44872", "url": "https://www.rhea-db.org/rhea/44872", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "D3Z2V2", "url": "https://www.uniprot.org/uniprot/D3Z2V2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z2V2-1", "url": "https://www.uniprot.org/uniprot/D3Z2V2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RH77", "url": "https://www.uniprot.org/uniprot/D6RH77", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RH77-1", "url": "https://www.uniprot.org/uniprot/D6RH77-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6QJR6", "url": "https://www.uniprot.org/uniprot/F6QJR6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6QJR6-1", "url": "https://www.uniprot.org/uniprot/F6QJR6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6WKY8", "url": "https://www.uniprot.org/uniprot/F6WKY8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6WKY8-1", "url": "https://www.uniprot.org/uniprot/F6WKY8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6NVF2", "url": "https://www.uniprot.org/uniprot/Q6NVF2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6NVF2-1", "url": "https://www.uniprot.org/uniprot/Q6NVF2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z280-1", "url": "https://www.uniprot.org/uniprot/Q9Z280-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z280-2", "url": "https://www.uniprot.org/uniprot/Q9Z280-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSLKSETRVNTSTLQKIAADMSNLIENLDTRELHFEGEEVEYDASPGDPKAQEGCIPFSSIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTSRVPSINLYTIELTHGEFTWQVKRKFKHFQEFHRELLKYKAFIRIPIPTKRHTFRRQNVKEEPREMPSLPRSSENAIQEEQFFGRRKQLEDYLTKILKMPMYRNYHATTEFLDVSQLSFIHDLGPKGLEGMIMKRSGGHRIPGVNCCGHGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRVKVGRKETETKYGLRIDNLSRTLILKCNSYRHARWWGGAIEEFIRKHGADFLKDHRFGSYAALHENTLAKWYVNAKGYFEDIANAMEEASEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLYKEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTSGLSLGSLTAASVESMESLSLKDKHEFHKKEPISKIVDETDMKLKGIGKSRKFSKFSLYRQLHRHHLHNADSISSIDSTSSYFSHCRSHQNLIHGLKPHLKLFHPSSESEQGLTRHSTDTGSIRSVQTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIGSVVHGKAARDVARHFIQRWNFTKIMKPKYRSLSYPFLLPKSQATAHELRYQVPGAVPAKVQLLRSAADWSAGIKHHEESIHAAYIHVIENSKHYIYIENQFFISCADDKVVFNKVGDRIAQRILKAHREGQRYRVYIVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGESSILEQLKPELGNKWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARDLRLECFRLVLGYLSDPSEDLQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPILAKEDALRAEEELRKIRGFLVQFPLYFLSEENLLPSVGTKEAIVPMEVWT", "length": 1074, "header": "sp|Q9Z280-1|PLD1_MOUSE Isoform 1 of Phospholipase D1 OS=Mus musculus OX=10090 GN=Pld1 PE=1 SV=1 CANONICAL=Q9Z280-1" }, "isoforms": [ { "isoform_ac": "D3Z2V2-1", "url": "", "sequence": { "sequence": "MSLKSETRVNTSTLQKIAADMSNLIENLDTRELHFEGEEVEYDASPGDPKAQEGCIPFSSIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTSRVPSINLYTIELTHGEFTWQVKRKFKHFQEF", "length": 126, "header": "tr|D3Z2V2-1|D3Z2V2_MOUSE Computationally mapped isoform of Phospholipase D1 OS=Mus musculus OX=10090 GN=Pld1 PE=1 SV=1 CANONICAL=Q9Z280-1" }, "locus": { "chromosome": "3", "start_pos": 28082834, "end_pos": 28078343, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000125338.8", "url": "https://www.ensembl.org/id/ENSMUST00000125338.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000121318.2", "url": "https://www.ensembl.org/id/ENSMUSP00000121318.2" } ] } }, { "isoform_ac": "D6RH77-1", "url": "", "sequence": { "sequence": "MSLKSETRVNTSTLQKIAADMSNLIENLDTRELHFEGEEVEYDASPGDPKAQEGCIPFSSIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTSRVPSINLYTIELTHGEFTWQVKRKFKHFQEFHRELLKYKAFIRIPIPTKRHTFRRQNVKEEPREMPSLPRSSENAIQEEQFFGRRKQLEDYLTKILKMPMYRNYHATTEFLDVSQLSFIHDLGPKGLEGMIMKRSGGHRIPGVNCCGHGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRVKVGRKETETKYGLRIDNLSRTLILKCNSYRHARWWGGAIEEFIRKHGADFLKDHRFGSYAALHENTLAKWYVNAKGYFEDIANAMEEASEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLYKEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTSGLSLGSLTAASVESMESLSLKDKHEFHKKEPISKIVDETDMKLKGIGKSRKFSKFSLYRQLHRHHLHNADSISSIDSTSSYFSHCRSHQNLIHGLKPHLKLFHPSSESEQGLTRHSTDTGSIRSVQTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIGSVVHGKAARDVARHFIQRWNFTKIMKPKYRSLSYPFLLPKSQATAHELRYQVPGAVPAKVQLLRSAADWSAGIKHHEESIHAAYIHVIENSKHYIYIENQFFISCADDKVVFNKVGDAIAQRILKAHREGQRYRVYIVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGESSILEQLKPELGNKWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARDLRLECFRLVLGYLSDPSEDLQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPILAKEDRLRAEEELRKIRGFLVQFPLYFLSEENLLPSVGTKEAIVPMEVWT", "length": 1074, "header": "tr|D6RH77-1|D6RH77_MOUSE Computationally mapped isoform of Phospholipase OS=Mus musculus OX=10090 GN=Pld1 PE=1 SV=2 CANONICAL=Q9Z280-1" }, "locus": { "chromosome": "3", "start_pos": 28185884, "end_pos": 28078343, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000123539.8", "url": "https://www.ensembl.org/id/ENSMUST00000123539.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000118727.3", "url": "https://www.ensembl.org/id/ENSMUSP00000118727.3" } ] } }, { "isoform_ac": "F6QJR6-1", "url": "", "sequence": { "sequence": "XIVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGESSILEQLKPELGNKWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARDLRLECFRLVLGYLSDPSEDLQDPVSDKFFKEIWVSTAARNATIYDKDVELSSNTSGAYDQPVMR", "length": 201, "header": "tr|F6QJR6-1|F6QJR6_MOUSE Computationally mapped isoform of phospholipase D OS=Mus musculus OX=10090 GN=Pld1 PE=1 SV=1 CANONICAL=Q9Z280-1" }, "locus": { "chromosome": "3", "start_pos": 28184944, "end_pos": 28163908, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000126594.3", "url": "https://www.ensembl.org/id/ENSMUST00000126594.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000121569.2", "url": "https://www.ensembl.org/id/ENSMUSP00000121569.2" } ] } }, { "isoform_ac": "F6WKY8-1", "url": "", "sequence": { "sequence": "XILKMPMYRNYHATTEFLDVSQLSFIHDLGPKGLEGMIMKRSGGHRIPGVNCCGHGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRVKVGRKETETKYGLRIDNLSRTLILKCNSYRHARWWGGAIEEFIRKHGADFLKDHRFGSYAALHENTLAKWYVNAKGYFEDIANAMEEASEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLYKEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTSGLSLGSLTAASVESMESLSLKDKHEFHKKEPISKIVDETDMKLKGIGKSRKFSKFSLYRQLHRHHLHNADSISSIDSTSNTGSIRSVQTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIGSVVHGKAARDVARHFIQRWNFTKIMKPKYRSLSYPFLLPKSQATAHELRYQVPGAVPAKVQLLRSAADWSAGIKHHEESIHAAYIHVIENSKHYIYIENQFFISCADDKVVFNKVGDAIAQRILKAHREGQRYRVYIVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGESSILEQLKPELGNKWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIATPWFVTIISWLSQESPSFVLKHGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARDLRLECFRLVLGYLSDPSEDLQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPILAKEDRLRAEEELRKIRGFLVQFPLYFLSEENLLPSVGTKEAIVPMEVWT", "length": 871, "header": "tr|F6WKY8-1|F6WKY8_MOUSE Computationally mapped isoform of phospholipase D OS=Mus musculus OX=10090 GN=Pld1 PE=1 SV=1 CANONICAL=Q9Z280-1" }, "locus": { "chromosome": "3", "start_pos": 28185885, "end_pos": 28085411, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000148827.8", "url": "https://www.ensembl.org/id/ENSMUST00000148827.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000120273.2", "url": "https://www.ensembl.org/id/ENSMUSP00000120273.2" } ] } }, { "isoform_ac": "Q6NVF2-1", "url": "", "sequence": { "sequence": "MSLKSETRVNTSTLQKIAADMSNLIENLDTRELHFEGEEVEYDASPGDPKAQEGCIPFSSIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTSRVPSINLYTIELTHGEFTWQVKRKFKHFQEFHRELLKYKAFIRIPIPTKRHTFRRQNVKEEPREMPSLPRSSENAIQEEQFFGRRKQLEDYLTKILKMPMYRNYHATTEFLDVSQLSFIHDLGPKGLEGMIMKRSGGHRIPGVNCCGHGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRVKVGRKETETKYGLRIDNLSRTLILKCNSYRHARWWGGAIEEFIRKHGADFLKDHRFGSYAALHENTLAKWYVNAKGYFEDIANAMEEASEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLYKEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTSGLSLGSLTAASVESMESLSLKDKHEFHKKEPISKIVDETDMKLKGIGKSRKFSKFSLYRQLHRHHLHNADSISSIDSTSNTGSIRSVQTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIGSVVHGKAARDVARHFIQRWNFTKIMKPKYRSLSYPFLLPKSQATAHELRYQVPGAVPAKVQLLRSAADWSAGIKHHEESIHAAYIHVIENSKHYIYIENQFFISCADDKVVFNKVGDAIAQRILKAHREGQRYRVYIVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGESSILEQLKPELGNKWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARDLRLECFRLVLGYLSDPSEDLQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPILAKEDRLRAEEELRKIRGFLVQFPLYFLSEENLLPSVGTKEAIVPMEVWT", "length": 1036, "header": "tr|Q6NVF2-1|Q6NVF2_MOUSE Computationally mapped isoform of Phospholipase OS=Mus musculus OX=10090 GN=Pld1 PE=1 SV=1 CANONICAL=Q9Z280-1" }, "locus": { "chromosome": "3", "start_pos": 28185884, "end_pos": 28078343, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000120834.8", "url": "https://www.ensembl.org/id/ENSMUST00000120834.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000113810.2", "url": "https://www.ensembl.org/id/ENSMUSP00000113810.2" } ] } }, { "isoform_ac": "Q9Z280-1", "url": "", "sequence": { "sequence": "MSLKSETRVNTSTLQKIAADMSNLIENLDTRELHFEGEEVEYDASPGDPKAQEGCIPFSSIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTSRVPSINLYTIELTHGEFTWQVKRKFKHFQEFHRELLKYKAFIRIPIPTKRHTFRRQNVKEEPREMPSLPRSSENAIQEEQFFGRRKQLEDYLTKILKMPMYRNYHATTEFLDVSQLSFIHDLGPKGLEGMIMKRSGGHRIPGVNCCGHGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRVKVGRKETETKYGLRIDNLSRTLILKCNSYRHARWWGGAIEEFIRKHGADFLKDHRFGSYAALHENTLAKWYVNAKGYFEDIANAMEEASEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLYKEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTSGLSLGSLTAASVESMESLSLKDKHEFHKKEPISKIVDETDMKLKGIGKSRKFSKFSLYRQLHRHHLHNADSISSIDSTSSYFSHCRSHQNLIHGLKPHLKLFHPSSESEQGLTRHSTDTGSIRSVQTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIGSVVHGKAARDVARHFIQRWNFTKIMKPKYRSLSYPFLLPKSQATAHELRYQVPGAVPAKVQLLRSAADWSAGIKHHEESIHAAYIHVIENSKHYIYIENQFFISCADDKVVFNKVGDRIAQRILKAHREGQRYRVYIVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGESSILEQLKPELGNKWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARDLRLECFRLVLGYLSDPSEDLQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPILAKEDALRAEEELRKIRGFLVQFPLYFLSEENLLPSVGTKEAIVPMEVWT", "length": 1074, "header": "sp|Q9Z280-1|PLD1_MOUSE Isoform 1 of Phospholipase D1 OS=Mus musculus OX=10090 GN=Pld1 PE=1 SV=1 CANONICAL=Q9Z280-1" }, "locus": {} }, { "isoform_ac": "Q9Z280-2", "url": "", "sequence": { "sequence": "MSLKSETRVNTSTLQKIAADMSNLIENLDTRELHFEGEEVEYDASPGDPKAQEGCIPFSSIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTSRVPSINLYTIELTHGEFTWQVKRKFKHFQEFHRELLKYKAFIRIPIPTKRHTFRRQNVKEEPREMPSLPRSSENAIQEEQFFGRRKQLEDYLTKILKMPMYRNYHATTEFLDVSQLSFIHDLGPKGLEGMIMKRSGGHRIPGVNCCGHGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRVKVGRKETETKYGLRIDNLSRTLILKCNSYRHARWWGGAIEEFIRKHGADFLKDHRFGSYAALHENTLAKWYVNAKGYFEDIANAMEEASEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLYKEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTSGLSLGSLTAASVESMESLSLKDKHEFHKKEPISKIVDETDMKLKGIGKSRKFSKFSLYRQLHRHHLHNADSISSIDSTSNTGSIRSVQTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIGSVVHGKAARDVARHFIQRWNFTKIMKPKYRSLSYPFLLPKSQATAHELRYQVPGAVPAKVQLLRSAADWSAGIKHHEESIHAAYIHVIENSKHYIYIENQFFISCADDKVVFNKVGDRIAQRILKAHREGQRYRVYIVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGESSILEQLKPELGNKWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARDLRLECFRLVLGYLSDPSEDLQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPILAKEDALRAEEELRKIRGFLVQFPLYFLSEENLLPSVGTKEAIVPMEVWT", "length": 1036, "header": "sp|Q9Z280-2|PLD1_MOUSE Isoform 2 of Phospholipase D1 OS=Mus musculus OX=10090 GN=Pld1 PE=1 SV=1 CANONICAL=Q9Z280-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 554, "start_aa": "Ser", "end_pos": 554, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser554", "evidence": [ { "id": "Q9Z280", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Z280" }, { "id": "34418053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34418053" } ] } ], "phosphorylation": [ { "start_pos": 499, "end_pos": 499, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "site_lbl": "Ser499" }, { "start_pos": 538, "end_pos": 538, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q9Z280", "url": "http://phospho.elm.eu.org/byAccession/Q9Z280.html" }, { "database": "iPTMnet", "id": "Q9Z280", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z280" }, { "database": "PubMed", "id": "17203969", "url": "https://glygen.org/publication/PubMed/17203969" } ], "site_lbl": "Ser538" }, { "start_pos": 561, "end_pos": 561, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "site_lbl": "Ser561" }, { "start_pos": 629, "end_pos": 629, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "site_lbl": "Ser629" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Protein phosphorylation and expression profiling by Yin-yang multidimensional liquid chromatography (Yin-yang MDLC) mass spectrometry.", "journal": "Journal of proteome research", "date": "2007", "authors": "Dai J, Jin WH, Sheng QH, Shieh CH, Wu JR, Zeng R", "evidence": [ { "database": "iPTMnet", "id": "Q9Z280", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z280" } ], "reference": [ { "type": "PubMed", "id": "17203969", "url": "https://glygen.org/publication/PubMed/17203969" } ] }, { "title": "RalA and PLD1 promote lipid droplet growth in response to nutrient withdrawal.", "journal": "Cell reports", "date": "2021", "authors": "Hussain SS, Tran TM, Ware TB, Luse MA, Prevost CT, Ferguson AN, Kashatus JA, Hsu KL, Kashatus DF", "evidence": [ { "database": "RefSeq", "id": "NP_001157528", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157528" } ], "reference": [ { "type": "PubMed", "id": "34320341", "url": "https://glygen.org/publication/PubMed/34320341" } ] }, { "title": "O-GlcNAcylation Is Essential for Rapid Pomc Expression and Cell Proliferation in Corticotropic Tumor Cells.", "journal": "Endocrinology", "date": "2021", "authors": "Massman LJ, Pereckas M, Zwagerman NT, Olivier-Van Stichelen S", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9Z280", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Z280" } ], "reference": [ { "type": "PubMed", "id": "34418053", "url": "https://glygen.org/publication/PubMed/34418053" } ] }, { "title": "PLD1 promotes reactive oxygen species production in vascular smooth muscle cells and injury-induced neointima formation.", "journal": "Biochimica et biophysica acta. Molecular and cell biology of lipids", "date": "2022", "authors": "Cai M, Wang Z, Luu TTT, Zhang D, Finke B, He J, Tay LWR, Di Paolo G, Du G", "evidence": [ { "database": "RefSeq", "id": "NP_001157528", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157528" } ], "reference": [ { "type": "PubMed", "id": "34610470", "url": "https://glygen.org/publication/PubMed/34610470" } ] }, { "title": "Differential expression patterns of phospholipase D isoforms 1 and 2 in the mammalian brain and retina.", "journal": "Journal of lipid research", "date": "2022", "authors": "Barber CN, Goldschmidt HL, Lilley B, Bygrave AM, Johnson RC, Huganir RL, Zack DJ, Raben DM", "evidence": [ { "database": "RefSeq", "id": "NP_001157528", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157528" } ], "reference": [ { "type": "PubMed", "id": "35764123", "url": "https://glygen.org/publication/PubMed/35764123" } ] }, { "title": "Phospholipase D1 promotes astrocytic differentiation through the FAK/AURKA/STAT3 signaling pathway in hippocampal neural stem/progenitor cells.", "journal": "Biochimica et biophysica acta. Molecular cell research", "date": "2022-12", "authors": "Kang Min-Jeong, Jin Nuri, Park Shin-Young, Han Joong-Soo", "evidence": [ { "database": "RefSeq", "id": "NP_001157528", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157528" } ], "reference": [ { "type": "PubMed", "id": "36162649", "url": "https://glygen.org/publication/PubMed/36162649" } ] }, { "title": "Cloning and expression analysis of murine phospholipase D1.", "journal": "Biochem. J.", "date": "1997", "authors": "Copeland N.G., Gilbert D.J., Jenkins N.A., Bollag R.J., Tsirka S.E., Altshuller Y.M., Frohman M.A., Bollag W.B., Branch K.D., Colley W.C., Sue-Ling C.K.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "reference": [ { "type": "PubMed", "id": "9307024", "url": "https://glygen.org/publication/PubMed/9307024" } ] }, { "title": "Phospholipase D2, a distinct phospholipase D isoform with novel regulatory properties that provokes cytoskeletal reorganization.", "journal": "Curr. Biol.", "date": "1997", "authors": "Bar-Sagi D., Hammond S.M., Morris A.J., Altshuller Y.M., Frohman M.A., Jenco J.M., Sung T.-C., Colley W.C., Roll R.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "reference": [ { "type": "PubMed", "id": "9395408", "url": "https://glygen.org/publication/PubMed/9395408" } ] }, { "title": "Genomic analysis of murine phospholipase D1 and comparison to phospholipase D2 reveals an unusual difference in gene size.", "journal": "Gene", "date": "1998", "authors": "Redina OE, Frohman MA", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "reference": [ { "type": "PubMed", "id": "9813240", "url": "https://glygen.org/publication/PubMed/9813240" } ] } ], "pathway": [ { "id": "mmu:18805", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18805", "resource": "KEGG Pathway" }, { "id": "R-MMU-1483166", "name": "Synthesis of PA", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1483166", "resource": "Reactome", "description": "Synthesis of PA" }, { "id": "R-MMU-2029485", "name": "Role of phospholipids in phagocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2029485", "resource": "Reactome", "description": "Role of phospholipids in phagocytosis" }, { "id": "R-MMU-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-MMU-8980692", "name": "RHOA GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8980692", "resource": "Reactome", "description": "RHOA GTPase cycle" }, { "id": "R-MMU-9013149", "name": "RAC1 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9013149", "resource": "Reactome", "description": "RAC1 GTPase cycle" }, { "id": "R-MMU-9013408", "name": "RHOG GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9013408", "resource": "Reactome", "description": "RHOG GTPase cycle" } ], "orthologs": [ { "uniprot_canonical_ac": "P70496-1", "protein_name": "Phospholipase D1", "gene_name": "Pld1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSLRSEARVNTSTLQKIAADMSNLIENLDTRELHFEGEEVEYDASPGDPTAQEACIPFSSIYNTQGFKEPNIQIYLSGCPVKAQVLEVERFTSTSRMPSVNLYTIELTHGEFTWQVKRKFKHFQEFHRELLKYKAFIRIPIPTKRHTFRRQNVKEEPREMPSLPRSSENAIQEEQFFGRRKQLEDYLTKILKMPMYRNYHATTEFLDVSQLSFIHDLGPKGLEGMIMKRSGGHRIPGVNCCGHGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRIKVGKKETETKYGLRIDNLSRTLILKCNSYRHARWWGGAIEEFIQKHGTDFLKDHRFGSYAAVHENILAKWYVNAKGYFEDIANAMEGATEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLYKEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTSGQSLGSLTAASVESMESLSLKDKHQSHKNEPVLKSVNDTDMKLKGIGKSRKFSKFSLYRQLHRRNLHNSDSISSVDSASSYFNHYRSHQNLIHGIKPHLKLFRPSSESEQGLTRHSADTGSIRSVQTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIGSVVHGKAARDVARHFIQRWNFTKIMKPKYRSLSYPFLLPKSQATAHELRYQVPGAVHAKAQLLRSAADWSAGIKHHEESIHAAYTHVIENSKHYIYIENQFFISCADDKVVFNKVGNAIAQRILKAHREGQRYRVYIVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGESSILEQLKPELGNKWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFAQGLRLECFRLVLGYLSDPSEDIQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPILAKEDRLRAEEELRKIRGFLVQFPFYFLSEENLLPSVGTKEAIVPMEVWT", "length": 1074 }, "evidence": [ { "id": "45225949", "url": "http://www.informatics.jax.org/homology/45225949", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q13393-1", "protein_name": "Phospholipase D1", "gene_name": "PLD1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSLKNEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSAIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKFKHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRRKQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNCCGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGIRIDNLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENALAKWYVNAKGYFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLYKEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTSGPSLGSLPPAAMESMESLRLKDKNEPVQNLPIQKSIDDVDSKLKGIGKPRKFSKFSLYKQLHRHHLHDADSISSIDSTSSYFNHYRSHHNLIHGLKPHFKLFHPSSESEQGLTRPHADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLLPKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVIENSRHYIYIENQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARGLRLQCFRVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT", "length": 1074 }, "evidence": [ { "id": "45225949", "url": "http://www.informatics.jax.org/homology/45225949", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "N-acylphosphatidylethanolamine-specific phospholipase D activity", "id": "GO:0070290", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070290", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "phospholipase D activity", "id": "GO:0004630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004630", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "phosphatidylinositol binding", "id": "GO:0035091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035091", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 18, "go_terms": [ { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "endocytic vesicle", "id": "GO:0030139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030139", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "organelle membrane", "id": "GO:0031090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031090", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "cholinergic synapse", "id": "GO:0098981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098981", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "intracellular organelle", "id": "GO:0043229", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043229", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "lamellipodium", "id": "GO:0030027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030027", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "vesicle", "id": "GO:0031982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031982", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "Golgi cisterna", "id": "GO:0031985", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031985", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "endomembrane system", "id": "GO:0012505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012505", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "phosphatidic acid biosynthetic process", "id": "GO:0006654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006654", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "lipid catabolic process", "id": "GO:0016042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016042", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "positive regulation of translation", "id": "GO:0045727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045727", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "inositol lipid-mediated signaling", "id": "GO:0048017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048017", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "regulation of microvillus assembly", "id": "GO:0032534", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032534", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "regulation of synaptic vesicle cycle", "id": "GO:0098693", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098693", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "defense response to Gram-positive bacterium", "id": "GO:0050830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "phospholipid catabolic process", "id": "GO:0009395", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009395", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "regulation of vesicle-mediated transport", "id": "GO:0060627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060627", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "response to peptide hormone", "id": "GO:0043434", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043434", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" }, { "name": "phospholipid biosynthetic process", "id": "GO:0008654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008654", "evidence": [ { "database": "UniProtKB", "id": "Q9Z280", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 10, "end_pos": 12, "annotation": "n_glycosylation_sequon" }, { "start_pos": 301, "end_pos": 303, "annotation": "n_glycosylation_sequon" }, { "start_pos": 702, "end_pos": 704, "annotation": "n_glycosylation_sequon" }, { "start_pos": 994, "end_pos": 996, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "14445", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + choline + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P70498-1", "P70496-1", "Q13393-1", "O14939-1", "Q9Z280-1", "P97813-1", "P36126-1", "Q54K50-1", "Q54SA1-1", "Q54UK0-1", "Q54WR4-1", "Q54Z25-1", "B7YZT5-1" ], "evidence": [ { "id": "14445", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14445" } ] }, { "id": "44868", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phosphocholine + ethanol = 1,2-diacyl-sn-glycero-3-phosphoethanol + choline", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P70496-1", "Q13393-1", "Q9Z280-1" ], "evidence": [ { "id": "44868", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/44868" } ] }, { "id": "44872", "name": "", "equation": "1,2-dihexadecanoyl-sn-glycero-3-phosphocholine + H2O = 1,2-dihexadecanoyl-sn-glycero-3-phosphate + choline + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P70498-1", "P70496-1", "O14939-1", "Q13393-1", "P97813-1", "Q9Z280-1" ], "evidence": [ { "id": "44872", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/44872" } ] }, { "id": "R-MMU-1483172", "name": "PC is transphosphatidylated to PG by Pld1-4/6", "equation": "", "summary": "In mice in the endoplasmic reticulum (ER) membrane, phospholipase D1-4,6 (Pld1-4,6) transphosphatidylates phosphatidylcholine (PC) with glycerol to displace choline (Cho) and form phosphatidylglycerol (PG) (Zheng et al. 2003, Piazza et al. 2007).", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O35405-1", "Q9Z280-1", "Q5SWZ9-1", "P97813-1", "Q8BG07-1" ], "evidence": [ { "id": "R-MMU-1483172", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1483172" } ] }, { "id": "R-MMU-1483182", "name": "PC is hydrolyzed to PA and choline by PLD1/2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z280-1", "P97813-1" ], "evidence": [ { "id": "R-MMU-1483182", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1483182" } ] }, { "id": "R-MMU-2029471", "name": "Hydrolysis of PC to PA by PLD", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [ "R-ALL-429802" ], "output_participant_list": [], "enzyme_list": [ "O35405-1", "Q9Z280-1", "P97813-1", "Q8BG07-1" ], "evidence": [ { "id": "R-MMU-2029471", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2029471" } ] }, { "id": "R-MMU-6798747", "name": "Exocytosis of tertiary granule membrane proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "plasma membrane, tertiary granule membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P70699-1", "Q9Z280-1", "O35598-1", "P62482-1", "B2RU80-1", "Q8BU31-1", "A2AN08-1", "P98197-1", "Q61093-1", "Q3UDW8-1", "P08556-1", "P61226-1", "Q05910-1", "P06869-1", "A2ANX3-1" ], "evidence": [ { "id": "R-MMU-6798747", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798747" } ] }, { "id": "R-MMU-6799350", "name": "Exocytosis of specific granule membrane proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "plasma membrane, specific granule membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64455-1", "O09005-1", "Q9Z280-1", "O35598-1", "P70704-1", "P62482-1", "B2RU80-1", "Q9Z2A7-1", "O35488-1", "A2AN08-1", "P98197-1", "Q61093-1", "O70252-1", "Q3UDW8-1", "Q80VQ0-1", "Q64277-1", "Q8K3K7-1", "Q3U435-1", "P62835-1", "O55098-1", "P61226-1", "Q05910-1", "P06869-1", "A2ANX3-1" ], "evidence": [ { "id": "R-MMU-6799350", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6799350" } ] }, { "id": "R-MMU-9013009", "name": "RHOA binds effectors at the plasma membrane", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P70268-1", "Q8BWW9-1", "Q9Z280-1", "Q9QUI0-1", "P55096-1", "P70335-1", "O54988-1", "O70252-1", "Q8K045-1", "P70336-1", "O55098-1", "P68033-1" ], "evidence": [ { "id": "R-MMU-9013009", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9013009" } ] }, { "id": "R-MMU-9013145", "name": "RAC1 binds effectors at the plasma membrane", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P70268-1", "Q8BWW9-1", "Q672J9-1", "Q3ULB5-1", "Q9Z280-1", "Q03145-1", "P42337-1", "Q3UU96-1", "Q61093-1", "Q8CIZ9-1", "P97813-1", "P60766-2", "Q61036-1", "Q8BTW9-1", "Q8CIN4-1", "O88643-1", "P63001-1", "Q8C015-1", "P51150-1", "Q8BYC6-1", "Q4JIM5-1" ], "evidence": [ { "id": "R-MMU-9013145", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9013145" } ] }, { "id": "R-MMU-9014449", "name": "RHOG binds effectors at the plasma membrane", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z280-1", "Q03145-1", "Q9CZN7-1", "P60766-2", "Q80XI6-1", "Q8BTW9-1", "Q8CIN4-1", "Q9DCT2-1", "P51150-1" ], "evidence": [ { "id": "R-MMU-9014449", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9014449" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-429802", "participant_name": "PC [plasma membrane]", "crossref": [ { "id": "C00157", "database": "COMPOUND", "url": "" }, { "id": "57643", "database": "ChEBI", "url": "" }, { "id": "57643", "database": "ChEBI", "url": "" }, { "id": "C00157", "database": "COMPOUND", "url": "" }, { "id": "C00157", "database": "COMPOUND", "url": "" }, { "id": "57643", "database": "ChEBI", "url": "" }, { "id": "57643", "database": "ChEBI", "url": "" }, { "id": "C00157", "database": "COMPOUND", "url": "" }, { "id": "C00157", "database": "COMPOUND", "url": "" }, { "id": "57643", "database": "ChEBI", "url": "" }, { "id": "C00157", "database": "COMPOUND", "url": "" }, { "id": "57643", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A2AN08", "gene_name": "Ubr4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A2AN08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AN08" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "A2AN08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AN08" } ] } ] }, { "uniprot_ac": "A2ANX3", "gene_name": "Atp8b4", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "A2ANX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2ANX3" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "A2ANX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2ANX3" } ] } ] }, { "uniprot_ac": "B2RU80", "gene_name": "Ptprb", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "B2RU80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RU80" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "B2RU80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RU80" } ] } ] }, { "uniprot_ac": "B7YZT5", "gene_name": "Pld", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "B7YZT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B7YZT5" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "B7YZT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B7YZT5" } ] } ] }, { "uniprot_ac": "O09005", "gene_name": "Degs1", "activity": [ { "ec_number": "1.14.19.17", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "O09005", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09005" } ] }, { "ec_number": "5.2.1.-", "activity": "", "evidence": [ { "id": "O09005", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09005" } ] }, { "ec_number": "1.14.19.17", "activity": "", "evidence": [ { "id": "O09005", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09005" } ] } ] }, { "uniprot_ac": "O14939", "gene_name": "PLD2", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "O14939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14939" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "O14939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14939" } ] } ] }, { "uniprot_ac": "O35405", "gene_name": "Pld3", "activity": [ { "ec_number": "3.1.16.1", "activity": "Exonucleolytic cleavage in the 5'- to 3'-direction to yield nucleoside 3'-phosphates.", "evidence": [ { "id": "O35405", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35405" } ] }, { "ec_number": "3.1.16.1", "activity": "", "evidence": [ { "id": "O35405", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35405" } ] } ] }, { "uniprot_ac": "O35488", "gene_name": "Slc27a2", "activity": [ { "ec_number": "6.2.1.3", "activity": "a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] }, { "ec_number": "6.2.1.-", "activity": "", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] }, { "ec_number": "6.2.1.7", "activity": "(25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oate + ATP + CoA = (25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] }, { "ec_number": "6.2.1.24", "activity": "3,7,11,15-tetramethylhexadecanoate + ATP + CoA = AMP + diphosphate + phytanoyl-CoA.", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] }, { "ec_number": "6.2.1.15", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + ATP + CoA = (5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] } ] }, { "uniprot_ac": "O35598", "gene_name": "Adam10", "activity": [ { "ec_number": "3.4.24.81", "activity": "Endopeptidase of broad specificity.", "evidence": [ { "id": "O35598", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35598" } ] }, { "ec_number": "3.4.24.81", "activity": "", "evidence": [ { "id": "O35598", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35598" } ] } ] }, { "uniprot_ac": "O54988", "gene_name": "Slk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O54988", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54988" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O54988", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54988" } ] } ] }, { "uniprot_ac": "O55098", "gene_name": "Stk10", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O55098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55098" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O55098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55098" } ] } ] }, { "uniprot_ac": "O70252", "gene_name": "Hmox2", "activity": [ { "ec_number": "1.14.14.18", "activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "O70252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70252" } ] }, { "ec_number": "1.14.14.18", "activity": "", "evidence": [ { "id": "O70252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70252" } ] } ] }, { "uniprot_ac": "O88643", "gene_name": "Pak1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O88643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88643" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O88643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88643" } ] } ] }, { "uniprot_ac": "P06869", "gene_name": "Plau", "activity": [ { "ec_number": "3.4.21.73", "activity": "Specific cleavage of Arg-|-Val bond in plasminogen to form plasmin.", "evidence": [ { "id": "P06869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06869" } ] }, { "ec_number": "3.4.21.73", "activity": "", "evidence": [ { "id": "P06869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06869" } ] } ] }, { "uniprot_ac": "P08556", "gene_name": "Nras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P08556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08556" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08556" } ] } ] }, { "uniprot_ac": "P36126", "gene_name": "SPO14", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "P36126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36126" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "P36126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36126" } ] } ] }, { "uniprot_ac": "P42337", "gene_name": "Pik3ca", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] } ] }, { "uniprot_ac": "P51150", "gene_name": "Rab7a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51150" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51150" } ] } ] }, { "uniprot_ac": "P55096", "gene_name": "Abcd3", "activity": [ { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "P55096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55096" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "P55096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55096" } ] } ] }, { "uniprot_ac": "P60766", "gene_name": "Cdc42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P60766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60766" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60766" } ] } ] }, { "uniprot_ac": "P61226", "gene_name": "Rap2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] } ] }, { "uniprot_ac": "P62482", "gene_name": "Kcnab2", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "P62482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62482" } ] } ] }, { "uniprot_ac": "P62835", "gene_name": "Rap1a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] } ] }, { "uniprot_ac": "P63001", "gene_name": "Rac1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P63001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63001" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63001" } ] } ] }, { "uniprot_ac": "P68033", "gene_name": "Actc1", "activity": [ { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P68033", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68033" } ] } ] }, { "uniprot_ac": "P70268", "gene_name": "Pkn1", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70268" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P70268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70268" } ] } ] }, { "uniprot_ac": "P70335", "gene_name": "Rock1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70335", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70335" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P70335", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70335" } ] } ] }, { "uniprot_ac": "P70336", "gene_name": "Rock2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70336" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P70336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70336" } ] } ] }, { "uniprot_ac": "P70496", "gene_name": "Pld1", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "P70496", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70496" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "P70496", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70496" } ] } ] }, { "uniprot_ac": "P70498", "gene_name": "Pld2", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "P70498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70498" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "P70498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70498" } ] } ] }, { "uniprot_ac": "P70699", "gene_name": "Gaa", "activity": [ { "ec_number": "3.2.1.20", "activity": "Hydrolysis of terminal, non-reducing (1->4)-linked alpha-D-glucose residues with release of alpha-D-glucose.", "evidence": [ { "id": "P70699", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70699" } ] }, { "ec_number": "3.2.1.20", "activity": "", "evidence": [ { "id": "P70699", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70699" } ] } ] }, { "uniprot_ac": "P70704", "gene_name": "Atp8a1", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "P70704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70704" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "P70704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70704" } ] } ] }, { "uniprot_ac": "P97813", "gene_name": "Pld2", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "P97813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97813" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "P97813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97813" } ] } ] }, { "uniprot_ac": "P98197", "gene_name": "Atp11a", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "P98197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98197" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "P98197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98197" } ] } ] }, { "uniprot_ac": "Q03145", "gene_name": "Epha2", "activity": [ { "ec_number": "2.7.10.1", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q03145", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03145" } ] }, { "ec_number": "2.7.10.1", "activity": "", "evidence": [ { "id": "Q03145", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03145" } ] } ] }, { "uniprot_ac": "Q05910", "gene_name": "Adam8", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "Q05910", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05910" } ] } ] }, { "uniprot_ac": "Q13393", "gene_name": "PLD1", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "Q13393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13393" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "Q13393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13393" } ] } ] }, { "uniprot_ac": "Q3U435", "gene_name": "Mmp25", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "Q3U435", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U435" } ] } ] }, { "uniprot_ac": "Q3UDW8", "gene_name": "Hgsnat", "activity": [ { "ec_number": "2.3.1.78", "activity": "acetyl-CoA + alpha-D-glucosaminyl-[heparan sulfate](n) = CoA + H(+) + N-acetyl-alpha-D-glucosaminyl-[heparan sulfate](n).", "evidence": [ { "id": "Q3UDW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UDW8" } ] }, { "ec_number": "2.3.1.78", "activity": "", "evidence": [ { "id": "Q3UDW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UDW8" } ] } ] }, { "uniprot_ac": "Q3ULB5", "gene_name": "Pak6", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3ULB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3ULB5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3ULB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3ULB5" } ] } ] }, { "uniprot_ac": "Q3UU96", "gene_name": "Cdc42bpa", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3UU96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UU96" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3UU96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UU96" } ] } ] }, { "uniprot_ac": "Q4JIM5", "gene_name": "Abl2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q4JIM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4JIM5" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "Q4JIM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4JIM5" } ] } ] }, { "uniprot_ac": "Q54K50", "gene_name": "pldY", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "Q54K50", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54K50" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "Q54K50", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54K50" } ] } ] }, { "uniprot_ac": "Q54SA1", "gene_name": "pldZ", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "Q54SA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SA1" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "Q54SA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SA1" } ] } ] }, { "uniprot_ac": "Q54UK0", "gene_name": "pldA", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "Q54UK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UK0" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "Q54UK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UK0" } ] } ] }, { "uniprot_ac": "Q54WR4", "gene_name": "pldB", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "Q54WR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WR4" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "Q54WR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WR4" } ] } ] }, { "uniprot_ac": "Q54Z25", "gene_name": "pldC", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "Q54Z25", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Z25" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "Q54Z25", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Z25" } ] } ] }, { "uniprot_ac": "Q5SWZ9", "gene_name": "Pld6", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q5SWZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SWZ9" } ] } ] }, { "uniprot_ac": "Q61036", "gene_name": "Pak3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q61036", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61036" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q61036", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61036" } ] } ] }, { "uniprot_ac": "Q61093", "gene_name": "Cybb", "activity": [ { "ec_number": "1.-.-.-", "activity": "", "evidence": [ { "id": "Q61093", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61093" } ] } ] }, { "uniprot_ac": "Q64277", "gene_name": "Bst1", "activity": [ { "ec_number": "3.2.2.6", "activity": "H2O + NAD(+) = ADP-D-ribose + H(+) + nicotinamide.", "evidence": [ { "id": "Q64277", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64277" } ] }, { "ec_number": "3.2.2.6", "activity": "", "evidence": [ { "id": "Q64277", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64277" } ] } ] }, { "uniprot_ac": "Q64455", "gene_name": "Ptprj", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "Q64455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64455" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q64455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64455" } ] } ] }, { "uniprot_ac": "Q672J9", "gene_name": "Nox3", "activity": [ { "ec_number": "1.6.3.-", "activity": "", "evidence": [ { "id": "Q672J9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q672J9" } ] } ] }, { "uniprot_ac": "Q80VQ0", "gene_name": "Aldh3b1", "activity": [ { "ec_number": "1.2.1.5", "activity": "an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH.", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.28", "activity": "benzaldehyde + H2O + NAD(+) = benzoate + 2 H(+) + NADH.", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.7", "activity": "benzaldehyde + H2O + NADP(+) = benzoate + 2 H(+) + NADPH.", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.7", "activity": "", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.5", "activity": "", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.28", "activity": "", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] } ] }, { "uniprot_ac": "Q80XI6", "gene_name": "Map3k11", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80XI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80XI6" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q80XI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80XI6" } ] } ] }, { "uniprot_ac": "Q8BG07", "gene_name": "Pld4", "activity": [ { "ec_number": "3.1.16.1", "activity": "Exonucleolytic cleavage in the 5'- to 3'-direction to yield nucleoside 3'-phosphates.", "evidence": [ { "id": "Q8BG07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BG07" } ] }, { "ec_number": "3.1.16.1", "activity": "", "evidence": [ { "id": "Q8BG07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BG07" } ] } ] }, { "uniprot_ac": "Q8BTW9", "gene_name": "Pak4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BTW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTW9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BTW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTW9" } ] } ] }, { "uniprot_ac": "Q8BU31", "gene_name": "Rap2c", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8BU31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU31" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8BU31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU31" } ] } ] }, { "uniprot_ac": "Q8BWW9", "gene_name": "Pkn2", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BWW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWW9" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q8BWW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWW9" } ] } ] }, { "uniprot_ac": "Q8BYC6", "gene_name": "Taok3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BYC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYC6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BYC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYC6" } ] } ] }, { "uniprot_ac": "Q8C015", "gene_name": "Pak5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8C015", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C015" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8C015", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C015" } ] } ] }, { "uniprot_ac": "Q8CIN4", "gene_name": "Pak2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8CIN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIN4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8CIN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIN4" } ] } ] }, { "uniprot_ac": "Q8CIZ9", "gene_name": "Nox1", "activity": [ { "ec_number": "1.-.-.-", "activity": "", "evidence": [ { "id": "Q8CIZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIZ9" } ] } ] }, { "uniprot_ac": "Q8K045", "gene_name": "Pkn3", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8K045", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K045" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q8K045", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K045" } ] } ] }, { "uniprot_ac": "Q8K3K7", "gene_name": "Agpat2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q8K3K7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3K7" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q8K3K7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3K7" } ] } ] }, { "uniprot_ac": "Q9CZN7", "gene_name": "Shmt2", "activity": [ { "ec_number": "2.1.2.1", "activity": "(6R)-5,10-methylene-5,6,7,8-tetrahydrofolate + glycine + H2O = (6S)-5,6,7,8-tetrahydrofolate + L-serine.", "evidence": [ { "id": "Q9CZN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CZN7" } ] }, { "ec_number": "2.1.2.1", "activity": "", "evidence": [ { "id": "Q9CZN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CZN7" } ] } ] }, { "uniprot_ac": "Q9DCT2", "gene_name": "Ndufs3", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q9DCT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCT2" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q9DCT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCT2" } ] } ] }, { "uniprot_ac": "Q9QUI0", "gene_name": "Rhoa", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9QUI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUI0" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9QUI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUI0" } ] } ] }, { "uniprot_ac": "Q9Z280", "gene_name": "Pld1", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "Q9Z280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "Q9Z280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ] } ] }, { "uniprot_ac": "Q9Z2A7", "gene_name": "Dgat1", "activity": [ { "ec_number": "2.3.1.20", "activity": "a 1,2-diacyl-sn-glycerol + an acyl-CoA = a triacyl-sn-glycerol + CoA.", "evidence": [ { "id": "Q9Z2A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A7" } ] }, { "ec_number": "2.3.1.76", "activity": "all-trans-retinol + an acyl-CoA = an all-trans-retinyl ester + CoA.", "evidence": [ { "id": "Q9Z2A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A7" } ] }, { "ec_number": "2.3.1.20", "activity": "", "evidence": [ { "id": "Q9Z2A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }