{ "uniprot_canonical_ac": "Q9Z0R9-1", "uniprot_ac": "Q9Z0R9", "uniprot_id": "FADS2_MOUSE", "mass": { "chemical_mass": 52387.0, "monoisotopic_mass": 52387.0 }, "refseq": { "ac": "NP_062673", "name": "acyl-CoA 6-desaturase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673" }, "gene_names": [ { "name": "Fads2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9Z0R9", "id": "Q9Z0R9" }, { "name": "2900042M13Rik; Fads2a; Fadsd2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673", "id": "NP_062673" }, { "name": "Fads2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673", "id": "NP_062673" }, { "name": "Fadsd2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9Z0R9", "id": "Q9Z0R9" } ], "protein_names": [ { "name": "Acyl-CoA 6-desaturase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9Z0R9" }, { "name": "1.14.19.3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0R9" }, { "name": "D6D; delta(6) desaturase; delta(6) fatty acid desaturase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673", "id": "NP_062673" }, { "name": "D6D", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0R9" }, { "name": "Delta(6) desaturase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0R9" }, { "name": "Delta(6) fatty acid desaturase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0R9" }, { "name": "Delta-6 desaturase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0R9" }, { "name": "Fatty acid desaturase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0R9" }, { "name": "acyl-CoA 6-desaturase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673", "id": "NP_062673" } ], "function": [ { "annotation": "Ablation of fatty acid desaturase 2 (FADS2) exacerbates hepatic triacylglycerol and cholesterol accumulation in polyunsaturated fatty acid-depleted mice.", "evidence": [ { "database": "RefSeq", "id": "NP_062673", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673" }, { "database": "PubMed", "id": "34008174", "url": "https://glygen.org/publication/PubMed/34008174" } ] }, { "annotation": "Conjugated linoleic acid-induced fat loss was found to be dependent on delta6-desaturase activity.", "evidence": [ { "database": "RefSeq", "id": "NP_062673", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673" }, { "database": "PubMed", "id": "18719641", "url": "https://glygen.org/publication/PubMed/18719641" } ] }, { "annotation": "Deletion of delta6-fatty acid desaturase (FADS2) gene expression abolishes the initial step in the enzymatic cascade of PUFA synthesis", "evidence": [ { "database": "RefSeq", "id": "NP_062673", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673" }, { "database": "PubMed", "id": "19172737", "url": "https://glygen.org/publication/PubMed/19172737" } ] }, { "annotation": "High fat / high cholesterol diet does not provoke atherosclerosis in the omega3-and omega6-polyunsaturated fatty acid synthesis-inactivated Delta6-fatty acid desaturase-deficient mouse.", "evidence": [ { "database": "RefSeq", "id": "NP_062673", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673" }, { "database": "PubMed", "id": "34530175", "url": "https://glygen.org/publication/PubMed/34530175" } ] }, { "annotation": "Inhibition of Delta-6 desaturase reduces fatty acid re-esterification in 3T3-L1 adipocytes independent of changes in n3-PUFA cellular content.", "evidence": [ { "database": "RefSeq", "id": "NP_062673", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673" }, { "database": "PubMed", "id": "35421603", "url": "https://glygen.org/publication/PubMed/35421603" } ] }, { "annotation": "Involved in the biosynthesis of highly unsaturated fatty acids (HUFA) from the essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3) precursors, acting as a fatty acyl-coenzyme A (CoA) desaturase that introduces a cis double bond at carbon 6 of the fatty acyl chain. Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleate (GLA) (18:3n-6) and stearidonate (18:4n-3), respectively (PubMed:9867867). Subsequently, in the biosynthetic pathway of HUFA n-3 series, it desaturates tetracosapentaenoate (24:5n-3) to tetracosahexaenoate (24:6n-3), which is then converted to docosahexaenoate (DHA)(22:6n-3), an important lipid for nervous system function (By similarity). It can also desaturate (11E)-octadecenoate (trans-vaccenoate) at carbon 6 generating (6Z,11E)-octadecadienoate (By similarity). In addition to Delta-6 activity, this enzyme exhibits Delta-8 activity with slight biases toward n-3 fatty acyl-CoA substrates (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0R9", "url": "https://www.uniprot.org/uniprot/Q9Z0R9#function" }, { "database": "PubMed", "id": "9867867", "url": "https://glygen.org/publication/PubMed/9867867" }, { "database": "UniProtKB", "id": "Q9Z122", "url": "https://www.uniprot.org/uniprot/Q9Z122#function" }, { "database": "UniProtKB", "id": "B8R1K0", "url": "https://www.uniprot.org/uniprot/B8R1K0#function" } ] }, { "annotation": "Methylation silencing of liver Fads2 expression and changes in liver fatty acids may contribute to the pathology of hyperhomocysteinemia.", "evidence": [ { "database": "RefSeq", "id": "NP_062673", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673" }, { "database": "PubMed", "id": "17971455", "url": "https://glygen.org/publication/PubMed/17971455" } ] } ], "disease": [ { "disease_id": "DOID:1574", "recommended_name": { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol use disorder", "description": "A substance abuse that involves the recurring use of alcoholic beverages despite negative consequences." }, "synonyms": [ { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "Ethanol abuse", "description": "" }, { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol abuse", "description": "" } ], "evidence": [ { "id": "1574", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1574" } ] }, { "disease_id": "DOID:3146", "recommended_name": { "id": "DOID:3146", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3146", "name": "lipid metabolism disorder", "description": "An inherited metabolic disorder that involves the creation and degradation of lipids." }, "synonyms": [ { "id": "DOID:3146", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3146", "name": "dyslipidemia", "description": "" }, { "id": "DOID:3146", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3146", "name": "fatty acid metabolism disorder", "description": "" } ], "evidence": [ { "id": "3146", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3146" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9Z0R9", "url": "https://www.uniprot.org/uniprot/Q9Z0R9" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Fads2", "url": "https://www.uniprot.org/uniprot/Q9Z0R9", "locus": { "chromosome": "19", "start_pos": 10040129, "end_pos": 10079110, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000024665", "url": "https://www.ensembl.org/id/ENSMUSG00000024665" } ] } } ], "crossref": [ { "id": "ENSMUSG00000024665", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000024665", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03506", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03506", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5087", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5087", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "56473", "url": "https://www.ncbi.nlm.nih.gov/gene/56473", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001199", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001199", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005804", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005804", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012171", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012171", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036400", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036400", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:56473", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56473", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1930079", "url": "http://www.informatics.jax.org/marker/MGI:1930079", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "FYPVMCL", "url": "https://omabrowser.org/oma/group/FYPVMCL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "294339at2759", "url": "http://www.orthodb.org/?query=294339at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR19353", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19353", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19353:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19353:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00173", "url": "http://pfam.xfam.org/family/PF00173", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00487", "url": "http://pfam.xfam.org/family/PF00487", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9Z0R9", "url": "http://purl.obolibrary.org/obo/PR_Q9Z0R9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-2046105", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2046105", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2046106", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_062673", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "36999", "url": "https://www.rhea-db.org/rhea/36999", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "39567", "url": "https://www.rhea-db.org/rhea/39567", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "39571", "url": "https://www.rhea-db.org/rhea/39571", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46064", "url": "https://www.rhea-db.org/rhea/46064", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "47140", "url": "https://www.rhea-db.org/rhea/47140", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "47144", "url": "https://www.rhea-db.org/rhea/47144", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A494BBD1", "url": "https://www.uniprot.org/uniprot/A0A494BBD1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494BBD1-1", "url": "https://www.uniprot.org/uniprot/A0A494BBD1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z0R9", "url": "https://www.uniprot.org/uniprot/Q9Z0R9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z0R9-1", "url": "https://www.uniprot.org/uniprot/Q9Z0R9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGKGGNQGEGSTERQAPMPTFRWEEIQKHNLRTDRWLVIDRKVYNVTKWSQRHPGGHRVIGHYSGEDATDAFRAFHLDLDFVGKFLKPLLIGELAPEEPSLDRGKSSQITEDFRALKKTAEDMNLFKTNHLFFFLLLSHIIVMESLAWFILSYFGTGWIPTLVTAFVLATSQAQAGWLQHDYGHLSVYKKSIWNHVVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDIKSLHVFVLGEWQPLEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMISRRDWVDLAWAISYYMRFFYTYIPFYGILGALVFLNFIRFLESHWFVWVTQMNHLVMEIDLDHYRDWFSSQLAATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALIDIVSSLKKSGELWLDAYLHK", "length": 444, "header": "sp|Q9Z0R9-1|FADS2_MOUSE Isoform 1 of Acyl-CoA 6-desaturase OS=Mus musculus OX=10090 GN=Fads2 PE=1 SV=1 CANONICAL=Q9Z0R9-1" }, "isoforms": [ { "isoform_ac": "A0A494BBD1-1", "url": "", "sequence": { "sequence": "IGHLKGASANWWNHRHFQHHAKPNIFHKDPDIKSLHVFVLGEWQPLETLSHVMVPPAFKYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMISRRDWVDLAWAISYYMRFF", "length": 118, "header": "tr|A0A494BBD1-1|FADS2_MOUSE Computationally mapped isoform of Acyl-CoA 6-desaturase OS=Mus musculus OX=10090 GN=Fads2 PE=1 SV=1 CANONICAL=Q9Z0R9-1" }, "locus": { "chromosome": "19", "start_pos": 10066080, "end_pos": 10043938, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000235937.2", "url": "https://www.ensembl.org/id/ENSMUST00000235937.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000158465.2", "url": "https://www.ensembl.org/id/ENSMUSP00000158465.2" } ] } }, { "isoform_ac": "Q9Z0R9-1", "url": "", "sequence": { "sequence": "MGKGGNQGEGSTERQAPMPTFRWEEIQKHNLRTDRWLVIDRKVYNVTKWSQRHPGGHRVIGHYSGEDATDAFRAFHLDLDFVGKFLKPLLIGELAPEEPSLDRGKSSQITEDFRALKKTAEDMNLFKTNHLFFFLLLSHIIVMESLAWFILSYFGTGWIPTLVTAFVLATSQAQAGWLQHDYGHLSVYKKSIWNHVVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDIKSLHVFVLGEWQPLEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMISRRDWVDLAWAISYYMRFFYTYIPFYGILGALVFLNFIRFLESHWFVWVTQMNHLVMEIDLDHYRDWFSSQLAATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALIDIVSSLKKSGELWLDAYLHK", "length": 444, "header": "sp|Q9Z0R9-1|FADS2_MOUSE Isoform 1 of Acyl-CoA 6-desaturase OS=Mus musculus OX=10090 GN=Fads2 PE=1 SV=1 CANONICAL=Q9Z0R9-1" }, "locus": { "chromosome": "19", "start_pos": 10078793, "end_pos": 10041630, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000025567", "url": "https://www.ensembl.org/id/ENSMUST00000025567" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000025567", "url": "https://www.ensembl.org/id/ENSMUSP00000025567" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Dual regulation of mouse Delta(5)- and Delta(6)-desaturase gene expression by SREBP-1 and PPARalpha.", "journal": "J. Lipid Res.", "date": "2002", "authors": "Yoshikawa T., Sone H., Okazaki H., Takahashi A., Yamada N., Tamura Y., Iizuka Y., Shimano H., Gotoda T., Matsuzaka T., Ishibashi S., Osuga J., Yahagi N., Amemiya-Kudo M., Hasty A.H.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0R9", "url": "https://www.uniprot.org/uniprot/Q9Z0R9" } ], "reference": [ { "type": "PubMed", "id": "11792729", "url": "https://glygen.org/publication/PubMed/11792729" } ] }, { "title": "Hypermethylation of Fads2 and altered hepatic fatty acid and phospholipid metabolism in mice with hyperhomocysteinemia.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Devlin AM, Singh R, Wade RE, Innis SM, Bottiglieri T, Lentz SR", "evidence": [ { "database": "RefSeq", "id": "NP_062673", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673" } ], "reference": [ { "type": "PubMed", "id": "17971455", "url": "https://glygen.org/publication/PubMed/17971455" } ] }, { "title": "Conjugated linoleic acid-induced fat loss dependence on Delta6-desaturase or cyclooxygenase.", "journal": "Obesity (Silver Spring, Md.)", "date": "2008", "authors": "Hargrave-Barnes KM, Azain MJ, Miner JL", "evidence": [ { "database": "RefSeq", "id": "NP_062673", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673" } ], "reference": [ { "type": "PubMed", "id": "18719641", "url": "https://glygen.org/publication/PubMed/18719641" } ] }, { "title": "Delta6-desaturase (FADS2) deficiency unveils the role of omega3- and omega6-polyunsaturated fatty acids.", "journal": "The EMBO journal", "date": "2008", "authors": "Stoffel W, Holz B, Jenke B, Binczek E, Gunter RH, Kiss C, Karakesisoglou I, Thevis M, Weber AA, Arnhold S, Addicks K", "evidence": [ { "database": "RefSeq", "id": "NP_062673", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673" } ], "reference": [ { "type": "PubMed", "id": "19172737", "url": "https://glygen.org/publication/PubMed/19172737" } ] }, { "title": "Ablation of fatty acid desaturase 2 (FADS2) exacerbates hepatic triacylglycerol and cholesterol accumulation in polyunsaturated fatty acid-depleted mice.", "journal": "FEBS letters", "date": "2021", "authors": "Hayashi Y, Lee-Okada HC, Nakamura E, Tada N, Yokomizo T, Fujiwara Y, Ichi I", "evidence": [ { "database": "RefSeq", "id": "NP_062673", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673" } ], "reference": [ { "type": "PubMed", "id": "34008174", "url": "https://glygen.org/publication/PubMed/34008174" } ] }, { "title": "High fat / high cholesterol diet does not provoke atherosclerosis in the omega3-and omega6-polyunsaturated fatty acid synthesis-inactivated Delta6-fatty acid desaturase-deficient mouse.", "journal": "Molecular metabolism", "date": "2021", "authors": "Stoffel W, Binczek E, Schmidt-Soltau I, Brodesser S, Wegner I", "evidence": [ { "database": "RefSeq", "id": "NP_062673", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673" } ], "reference": [ { "type": "PubMed", "id": "34530175", "url": "https://glygen.org/publication/PubMed/34530175" } ] }, { "title": "Inhibition of Delta-6 desaturase reduces fatty acid re-esterification in 3T3-L1 adipocytes independent of changes in n3-PUFA cellular content.", "journal": "Biochimica et biophysica acta. Molecular and cell biology of lipids", "date": "2022", "authors": "Wang C, MacIntyre B, Mutch DM", "evidence": [ { "database": "RefSeq", "id": "NP_062673", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062673" } ], "reference": [ { "type": "PubMed", "id": "35421603", "url": "https://glygen.org/publication/PubMed/35421603" } ] }, { "title": "Cloning, expression, and nutritional regulation of the mammalian Delta-6 desaturase.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Cho H.P., Clarke S.D., Nakamura M.T.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0R9", "url": "https://www.uniprot.org/uniprot/Q9Z0R9" } ], "reference": [ { "type": "PubMed", "id": "9867867", "url": "https://glygen.org/publication/PubMed/9867867" } ] } ], "pathway": [ { "id": "mmu:56473", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56473", "resource": "KEGG Pathway" }, { "id": "R-MMU-2046105", "name": "Linoleic acid (LA) metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2046105", "resource": "Reactome", "description": "Linoleic acid (LA) metabolism" }, { "id": "R-MMU-2046106", "name": "alpha-linolenic acid (ALA) metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2046106", "resource": "Reactome", "description": "alpha-linolenic acid (ALA) metabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHVFFLLLLAHIIALESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFVLGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIVHKNWVDLAWAVSYYIRFFITYIPFYGILGALLFLNFIRFLESHWFVWVTQMNHIVMEIDQEAYRDWFSSQLTATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALLDIIRSLKKSGKLWLDAYLHK", "length": 444 }, "evidence": [ { "id": "45224654", "url": "http://www.informatics.jax.org/homology/45224654", "database": "MGI" }, { "id": "Q9Z0R9", "url": "https://omabrowser.org/oma/group/Q9Z0R9/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9Z122-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "Fads2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGKGGNQGEGSTELQAPMPTFRWEEIQKHNLRTDRWLVIDRKVYNVTKWSQRHPGGHRVIGHYSGEDATDAFRAFHLDLDFVGKFLKPLLIGELAPEEPSLDRGKSSQITEDFRALKKTAEDMNLFKTNHLFFFLLLSHIIVMESIAWFILSYFGNGWIPTVITAFVLATSQAQAGWLQHDYGHLSVYKKSIWNHIVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDIKSLHVFVLGEWQPLEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIRRRDWVDLAWAISYYARFFYTYIPFYGILGALVFLNFIRFLESHWFVWVTQMNHIVMEIDLDHYRDWFSSQLAATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALLDIVSSLKKSGELWLDAYLHK", "length": 444 }, "evidence": [ { "id": "45224654", "url": "http://www.informatics.jax.org/homology/45224654", "database": "MGI" }, { "id": "Q9Z0R9", "url": "https://omabrowser.org/oma/group/Q9Z0R9/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0R9", "url": "https://www.uniprot.org/uniprot/Q9Z0R9" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0R9", "url": "https://www.uniprot.org/uniprot/Q9Z0R9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "oxidoreductase activity", "id": "GO:0016491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016491", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0R9", "url": "https://www.uniprot.org/uniprot/Q9Z0R9" } ], "pmid": "" }, { "name": "stearoyl-CoA 9-desaturase activity", "id": "GO:0004768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004768", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0R9", "url": "https://www.uniprot.org/uniprot/Q9Z0R9" } ], "pmid": "" }, { "name": "linoleoyl-CoA desaturase activity", "id": "GO:0016213", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016213", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0R9", "url": "https://www.uniprot.org/uniprot/Q9Z0R9" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water", "id": "GO:0016717", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016717", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0R9", "url": "https://www.uniprot.org/uniprot/Q9Z0R9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0R9", "url": "https://www.uniprot.org/uniprot/Q9Z0R9" } ], "pmid": "" }, { "name": "unsaturated fatty acid biosynthetic process", "id": "GO:0006636", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006636", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0R9", "url": "https://www.uniprot.org/uniprot/Q9Z0R9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 45, "end_pos": 47, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "36999", "name": "", "equation": "(9Z,12Z,15Z,18Z,21Z)-tetracosapentaenoyl-CoA + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = (6Z,9Z,12Z,15Z,18Z,21Z)-tetracosahexaenoyl-CoA + 2 Fe(III)-[cytochrome b5] + 2 H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z122-1", "O95864-1", "Q9Z0R9-1" ], "evidence": [ { "id": "36999", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36999" } ] }, { "id": "39567", "name": "", "equation": "(11Z,14Z)-eicosadienoyl-CoA + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = (8Z,11Z,14Z)-eicosatrienoyl-CoA + 2 Fe(III)-[cytochrome b5] + 2 H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z122-1", "O95864-1", "Q9Z0R9-1" ], "evidence": [ { "id": "39567", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/39567" } ] }, { "id": "39571", "name": "", "equation": "(11Z,14Z,17Z)-eicosatrienoyl-CoA + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = (8Z,11Z,14Z,17Z)-eicosatetraenoyl-CoA + 2 Fe(III)-[cytochrome b5] + 2 H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z122-1", "O95864-1", "Q9Z0R9-1" ], "evidence": [ { "id": "39571", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/39571" } ] }, { "id": "46064", "name": "", "equation": "(11E)-octadecenoyl-CoA + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = (6Z,11E)-octadecadienoyl-CoA + 2 Fe(III)-[cytochrome b5] + 2 H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z122-1", "O95864-1", "Q9Z0R9-1" ], "evidence": [ { "id": "46064", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46064" } ] }, { "id": "47140", "name": "", "equation": "(9Z,12Z)-octadecadienoyl-CoA + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = (6Z,9Z,12Z)-octadecatrienoyl-CoA + 2 Fe(III)-[cytochrome b5] + 2 H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z122-1", "O95864-1", "Q9Z0R9-1" ], "evidence": [ { "id": "47140", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/47140" } ] }, { "id": "47144", "name": "", "equation": "(9Z,12Z,15Z)-octadecatrienoyl-CoA + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = (6Z,9Z,12Z,15Z)-octadecatetraenoyl-CoA + 2 Fe(III)-[cytochrome b5] + 2 H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z122-1", "O95864-1", "Q9Z0R9-1" ], "evidence": [ { "id": "47144", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/47144" } ] }, { "id": "R-MMU-2046084", "name": "Desaturation of alpha-linoleoyl-CoA to Stearidonoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-113534", "R-ALL-194697" ], "output_participant_list": [ "R-ALL-194653", "R-ALL-2046052" ], "enzyme_list": [ "Q9Z0R9-1" ], "evidence": [ { "id": "R-MMU-2046084", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2046084" } ] }, { "id": "R-MMU-2046096", "name": "Desaturation of Linoleoyl-CoA to gamma-linolenoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-2046042" ], "enzyme_list": [ "Q9Z0R9-1" ], "evidence": [ { "id": "R-MMU-2046096", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2046096" } ] }, { "id": "R-MMU-2046097", "name": "Desaturation of tetracosatetraenoyl-CoA to tetracosapentaenoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-2046050" ], "enzyme_list": [ "Q9Z0R9-1" ], "evidence": [ { "id": "R-MMU-2046097", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2046097" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-113534", "participant_name": "O2 [endoplasmic reticulum lumen]", "crossref": [ { "id": "15379", "database": "ChEBI", "url": "" }, { "id": "HMDB0001377", "database": "HMDB Metabolite", "url": "" }, { "id": "C00007", "database": "COMPOUND", "url": "" }, { "id": "8145133", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0001377", "database": "HMDB Metabolite", "url": "" }, { "id": "15379", "database": "ChEBI", "url": "" }, { "id": "C00007", "database": "COMPOUND", "url": "" }, { "id": "8145133", "database": "PubChem Substance", "url": "" }, { "id": "15379", "database": "ChEBI", "url": "" }, { "id": "HMDB0001377", "database": "HMDB Metabolite", "url": "" }, { "id": "C00007", "database": "COMPOUND", "url": "" }, { "id": "8145133", "database": "PubChem Substance", "url": "" }, { "id": "8145133", "database": "PubChem Substance", "url": "" }, { "id": "C00007", "database": "COMPOUND", "url": "" }, { "id": "15379", "database": "ChEBI", "url": "" }, { "id": "HMDB0001377", "database": "HMDB Metabolite", "url": "" }, { "id": "C00007", "database": "COMPOUND", "url": "" }, { "id": "15379", "database": "ChEBI", "url": "" }, { "id": "8145133", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0001377", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0001377", "database": "HMDB Metabolite", "url": "" }, { "id": "15379", "database": "ChEBI", "url": "" }, { "id": "C00007", "database": "COMPOUND", "url": "" }, { "id": "8145133", "database": "PubChem Substance", "url": "" } ] }, { "participant_id": "R-ALL-194653", "participant_name": "NAD+ [endoplasmic reticulum lumen]", "crossref": [ { "id": "C00003", "database": "COMPOUND", "url": "" }, { "id": "57540", "database": "ChEBI", "url": "" }, { "id": "000008214766", "database": "ZINC", "url": "" }, { "id": "C00003", "database": "COMPOUND", "url": "" }, { "id": "57540", "database": "ChEBI", "url": "" }, { "id": "000008214766", "database": "ZINC", "url": "" }, { "id": "C00003", "database": "COMPOUND", "url": "" }, { "id": "57540", "database": "ChEBI", "url": "" }, { "id": "000008214766", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-194697", "participant_name": "NADH [endoplasmic reticulum lumen]", "crossref": [ { "id": "C00004", "database": "COMPOUND", "url": "" }, { "id": "57945", "database": "ChEBI", "url": "" }, { "id": "000008215403", "database": "ZINC", "url": "" }, { "id": "C00004", "database": "COMPOUND", "url": "" }, { "id": "000008215403", "database": "ZINC", "url": "" }, { "id": "57945", "database": "ChEBI", "url": "" }, { "id": "000008215403", "database": "ZINC", "url": "" }, { "id": "C00004", "database": "COMPOUND", "url": "" }, { "id": "57945", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2046042", "participant_name": "GLA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-2046050", "participant_name": "TPA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "63546", "database": "ChEBI", "url": "" }, { "id": "63546", "database": "ChEBI", "url": "" }, { "id": "63546", "database": "ChEBI", "url": "" }, { "id": "63546", "database": "ChEBI", "url": "" }, { "id": "63546", "database": "ChEBI", "url": "" }, { "id": "63546", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2046052", "participant_name": "SDA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O95864", "gene_name": "FADS2", "activity": [ { "ec_number": "1.14.19.3", "activity": "(9Z,12Z,15Z)-octadecatrienoyl-CoA + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = (6Z,9Z,12Z,15Z)-octadecatetraenoyl-CoA + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "O95864", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95864" } ] }, { "ec_number": "1.14.19.3", "activity": "", "evidence": [ { "id": "O95864", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95864" } ] } ] }, { "uniprot_ac": "Q9Z0R9", "gene_name": "Fads2", "activity": [ { "ec_number": "1.14.19.3", "activity": "(9Z,12Z,15Z)-octadecatrienoyl-CoA + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = (6Z,9Z,12Z,15Z)-octadecatetraenoyl-CoA + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "Q9Z0R9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0R9" } ] }, { "ec_number": "1.14.19.3", "activity": "", "evidence": [ { "id": "Q9Z0R9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0R9" } ] } ] }, { "uniprot_ac": "Q9Z122", "gene_name": "Fads2", "activity": [ { "ec_number": "1.14.19.3", "activity": "(9Z,12Z,15Z)-octadecatrienoyl-CoA + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = (6Z,9Z,12Z,15Z)-octadecatetraenoyl-CoA + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "Q9Z122", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z122" } ] }, { "ec_number": "1.14.19.3", "activity": "", "evidence": [ { "id": "Q9Z122", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z122" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }