{ "uniprot_canonical_ac": "Q9Z0J4-1", "uniprot_ac": "Q9Z0J4", "uniprot_id": "NOS1_MOUSE", "mass": { "chemical_mass": 160472.0, "monoisotopic_mass": 160472.0 }, "refseq": { "ac": "NP_032738", "name": "nitric oxide synthase 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032738" }, "gene_names": [ { "name": "Nos1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9Z0J4", "id": "Q9Z0J4" } ], "protein_names": [ { "name": "Nitric oxide synthase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9Z0J4" }, { "name": "1.14.13.39", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0J4" }, { "name": "Constitutive NOS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0J4" }, { "name": "N-NOS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0J4" }, { "name": "NC-NOS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0J4" }, { "name": "NOS type I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0J4" }, { "name": "Neuronal NOS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0J4" }, { "name": "Nitric oxide synthase, brain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0J4" }, { "name": "Peptidyl-cysteine S-nitrosylase NOS1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0J4" }, { "name": "bNOS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0J4" }, { "name": "nNOS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9Z0J4" }, { "name": "nitric oxide synthase 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032738", "id": "NP_032738" }, { "name": "nitric oxide synthase, brain; neuronal nitric oxide synthase; NOS type I; neuronal NOS; constitutive NOS; peptidyl-cysteine S-nitrosylase NOS1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032738", "id": "NP_032738" } ], "function": [ { "annotation": "NNOS Increases Fiber Type-Specific Angiogenesis in Skeletal Muscle of Mice in Response to Endurance Exercise. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_032738", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032738" }, { "database": "PubMed", "id": "37298293", "url": "https://glygen.org/publication/PubMed/37298293" } ] }, { "annotation": "Nos1[+] and Nos1[-] excitatory neurons in the BLA regulate anxiety- and depression-related behaviors oppositely.", "evidence": [ { "database": "RefSeq", "id": "NP_032738", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032738" }, { "database": "PubMed", "id": "37080493", "url": "https://glygen.org/publication/PubMed/37080493" } ] }, { "annotation": "Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body.", "evidence": [ { "database": "UniProtKB", "id": "S4R255", "url": "https://www.uniprot.org/uniprot/S4R255#function" }, { "database": "UniProtKB", "id": "PIRNR000333", "url": "https://www.uniprot.org/uniprot/PIRNR000333#function" } ] }, { "annotation": "Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter. Probably has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such SRR. Isoform NNOS Mu may be an effector enzyme for the dystrophin complex.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4#function" }, { "database": "PubMed", "id": "17293453", "url": "https://glygen.org/publication/PubMed/17293453" } ] } ], "disease": [ { "disease_id": "DOID:0050453", "recommended_name": { "id": "DOID:0050453", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050453", "name": "lissencephaly", "description": "A congenital nervous system abnormality characterized by the absence of folds in the cerebral cortex and caused_by defective neuronal migration during the 12th to 24th weeks of gestation." }, "synonyms": [ { "id": "MONDO:0011830", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011830", "name": "lissencephaly due to LIS1 mutation", "description": "Lissencephaly due to LIS1 mutation is a cerebral malformation with epilepsy characterized predominantly by posterior isolated lissencephaly with developmental delay, intellectual disability and epilepsy that usually evolves from West syndrome to Lennox-Gastaut syndrome. Additional features include muscular hypotonia, acquired microcephaly, failure to thrive and poor control of airways leading to aspiration pneumonia." }, { "id": "MONDO:0011830", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011830", "name": "PAFAH1B1-related lissencephaly", "description": "" }, { "id": "MONDO:0011830", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011830", "name": "LIS1", "description": "" }, { "id": "MONDO:0011830", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011830", "name": "lissencephaly 1", "description": "" }, { "id": "MONDO:0011830", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011830", "name": "lissencephaly sequence, isolated", "description": "" }, { "id": "MONDO:0011830", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011830", "name": "lissencephaly, classic", "description": "" }, { "id": "MONDO:0011830", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011830", "name": "subcortical band heterotopia", "description": "" }, { "id": "MONDO:0011830", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011830", "name": "subcortical laminar heterotopia", "description": "" }, { "id": "MIM:607432", "resource": "MIM", "url": "https://www.omim.org/entry/607432", "name": "Subcortical band heterotopia", "description": "Subcortical band heterotopia" } ], "evidence": [ { "id": "0050453", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050453" } ] }, { "disease_id": "DOID:0050700", "recommended_name": { "id": "DOID:0050700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050700", "name": "cardiomyopathy", "description": "A heart disease and a myopathy that is characterized by deterioration of the function of the heart muscle." }, "synonyms": [ { "id": "DOID:0050700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050700", "name": "Cardiomyopathies", "description": "" } ], "evidence": [ { "id": "0050700", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050700" } ] }, { "disease_id": "DOID:0080855", "recommended_name": { "id": "DOID:0080855", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080855", "name": "Parkinsonism", "description": "A movement disorder that is characterized by disturbances of balance, gait and posture." }, "synonyms": [], "evidence": [ { "id": "0080855", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080855" } ] }, { "disease_id": "DOID:0080998", "recommended_name": { "id": "DOID:0080998", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080998", "name": "acute necrotizing pancreatitis", "description": "An acute pancreatitis that is characterized by one or more areas of necrosis in the pancreas with varying degree of involvement of the surrounding tissues or organ systems." }, "synonyms": [], "evidence": [ { "id": "0080998", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080998" } ] }, { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:10762", "recommended_name": { "id": "DOID:10762", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10762", "name": "portal hypertension", "description": "" }, "synonyms": [], "evidence": [ { "id": "10762", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10762" } ] }, { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:11723", "recommended_name": { "id": "DOID:11723", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11723", "name": "Duchenne muscular dystrophy", "description": "A muscular dystrophy that has_material_basis_in X-linked mutations in the DMD gene found on the X chromosome. It is characterized by rapidly progressing muscle weakness and muscle atrophy initially involving the lower extremities and eventually affecting the whole body. It affects males whereas females can be carriers. The symptoms start before the age of six and may appear at infancy." }, "synonyms": [ { "id": "DOID:11723", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11723", "name": "Muscular dystrophy, Duchenne", "description": "" }, { "id": "MONDO:0010679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010679", "name": "Duchenne muscular dystrophy", "description": "Duchenne muscular dystrophy (DMD) is a neuromuscular disease characterized by rapidly progressive muscle weakness and wasting due to degeneration of skeletal, smooth and cardiac muscle." }, { "id": "MONDO:0010679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010679", "name": "DMD", "description": "" }, { "id": "MONDO:0010679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010679", "name": "Duchenne muscular dystrophy", "description": "" }, { "id": "MONDO:0010679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010679", "name": "Duchenne muscular dystrophy, X-linked recessive", "description": "" }, { "id": "MONDO:0010679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010679", "name": "muscular dystrophy, Duchenne", "description": "" }, { "id": "MONDO:0010679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010679", "name": "severe dystrophinopathy, Duchenne type", "description": "" }, { "id": "MONDO:0010679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010679", "name": "muscular dystrophy, Duchenne type", "description": "" }, { "id": "MONDO:0010679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010679", "name": "muscular dystrophy, pseudohypertrophic progressive, Duchenne type", "description": "" }, { "id": "MIM:310200", "resource": "MIM", "url": "https://www.omim.org/entry/310200", "name": "Duchenne muscular dystrophy", "description": "Duchenne muscular dystrophy" } ], "evidence": [ { "id": "11723", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11723" } ] }, { "disease_id": "DOID:1184", "recommended_name": { "id": "DOID:1184", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1184", "name": "nephrotic syndrome", "description": "A nephrosis characterized by marked increase in glomerular protein permeability resulting in marked elevation of urine protein levels, hypoalbuminemia, hyperlipidemia, and hypercoagulability." }, "synonyms": [], "evidence": [ { "id": "1184", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1184" } ] }, { "disease_id": "DOID:12577", "recommended_name": { "id": "DOID:12577", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12577", "name": "urethral obstruction", "description": "" }, "synonyms": [ { "id": "DOID:12577", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12577", "name": "Obstruction of urethra", "description": "" } ], "evidence": [ { "id": "12577", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12577" } ] }, { "disease_id": "DOID:12638", "recommended_name": { "id": "DOID:12638", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12638", "name": "hypertrophic pyloric stenosis", "description": "A pyloric stenosis characterized by the enlargement of the muscle surrounding the pylorus, causing severe projectile non-bilious vomiting." }, "synonyms": [ { "id": "DOID:12638", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12638", "name": "congenital hypertrophic pyloric stenosis", "description": "" }, { "id": "DOID:12638", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12638", "name": "congenital or infantile stricture of pylorus", "description": "" }, { "id": "MONDO:0010411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010411", "name": "pyloric stenosis, infantile hypertrophic, 4", "description": "" }, { "id": "MONDO:0010411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010411", "name": "IHPS4", "description": "" }, { "id": "MONDO:0010411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010411", "name": "pyloric stenosis, infantile hypertrophic, 4", "description": "" }, { "id": "MONDO:0008355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008355", "name": "pyloric stenosis, infantile hypertrophic, 1", "description": "" }, { "id": "MONDO:0008355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008355", "name": "IHPS1", "description": "" }, { "id": "MONDO:0008355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008355", "name": "pyloric stenosis, infantile hypertrophic 1, multifactorial", "description": "" }, { "id": "MONDO:0008355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008355", "name": "pyloric stenosis, infantile hypertrophic, 1", "description": "" }, { "id": "MONDO:0008355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008355", "name": "pyloric stenosis, infantile", "description": "" }, { "id": "MONDO:0008355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008355", "name": "pyloric stenosis, infantile hypertrophic", "description": "" }, { "id": "MONDO:0012922", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012922", "name": "pyloric stenosis, infantile hypertrophic, 5", "description": "" }, { "id": "MONDO:0012922", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012922", "name": "IHPS5", "description": "" }, { "id": "MONDO:0012922", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012922", "name": "infantile hypertrophic pyloric stenosis type 5", "description": "" }, { "id": "MONDO:0012922", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012922", "name": "pyloric stenosis, infantile hypertrophic, 5", "description": "" }, { "id": "MONDO:0012785", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012785", "name": "pyloric stenosis, infantile hypertrophic, 3", "description": "" }, { "id": "MONDO:0012785", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012785", "name": "IHPS3", "description": "" }, { "id": "MONDO:0012785", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012785", "name": "pyloric stenosis, infantile hypertrophic, 3", "description": "" }, { "id": "MONDO:0012457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012457", "name": "pyloric stenosis, infantile hypertrophic, 2", "description": "" }, { "id": "MONDO:0012457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012457", "name": "IHPS2", "description": "" }, { "id": "MONDO:0012457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012457", "name": "pyloric stenosis, infantile hypertrophic, 2", "description": "" } ], "evidence": [ { "id": "12638", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12638" } ] }, { "disease_id": "DOID:12935", "recommended_name": { "id": "DOID:12935", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12935", "name": "alcoholic cardiomyopathy", "description": "" }, "synonyms": [ { "id": "DOID:12935", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12935", "name": "Alcohol-induced heart muscle disease", "description": "" }, { "id": "DOID:12935", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12935", "name": "Dilated cardiomyopathy secondary to alcohol", "description": "" } ], "evidence": [ { "id": "12935", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12935" } ] }, { "disease_id": "DOID:13025", "recommended_name": { "id": "DOID:13025", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13025", "name": "retinopathy of prematurity", "description": "" }, "synonyms": [ { "id": "DOID:13025", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13025", "name": "Retrolental fibroplasia", "description": "" }, { "id": "DOID:13025", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13025", "name": "premature retinopathy", "description": "" } ], "evidence": [ { "id": "13025", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:13025" } ] }, { "disease_id": "DOID:13413", "recommended_name": { "id": "DOID:13413", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13413", "name": "hepatic encephalopathy", "description": "A brain disease that is characterized by loss of brain function, the occurrence of confusion, altered level of consciousness, and coma that results when the liver is unable to remove toxins from the blood." }, "synonyms": [ { "id": "DOID:13413", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13413", "name": "Portal-systemic encephalopathy", "description": "" } ], "evidence": [ { "id": "13413", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:13413" } ] }, { "disease_id": "DOID:14330", "recommended_name": { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson's disease", "description": "A synucleinopathy that has_material_basis_in degeneration of the central nervous system that often impairs motor skills, speech, and other functions." }, "synonyms": [ { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson disease", "description": "" }, { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "paralysis agitans", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "A Parkinson disease that begins after around the age of 50." }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "LOPD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PARK", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, age of onset, modifier, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "autosomal dominant late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson's disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "" }, { "id": "MIM:168600", "resource": "MIM", "url": "https://www.omim.org/entry/168600", "name": "Parkinson disease", "description": "Parkinson disease" } ], "evidence": [ { "id": "14330", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:14330" } ] }, { "disease_id": "DOID:1470", "recommended_name": { "id": "DOID:1470", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1470", "name": "major depressive disorder", "description": "A depressive disorder that is characterized by at least two weeks of loss of interest or pleasure in normally enjoyable activities or depressed mood along with additional cognitive or somatic impairments such as appetite or weight changes, sleep difficulties, psychomotor agitation or retardation, fatigue or loss of energy, diminished ability to think or concentrate, feelings of worthlessness or excessive guilt, and suicidality." }, "synonyms": [ { "id": "DOID:1470", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1470", "name": "clinical depression", "description": "" }, { "id": "DOID:1470", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1470", "name": "recurrent major depression", "description": "" }, { "id": "DOID:1470", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1470", "name": "single major depressive episode", "description": "" }, { "id": "DOID:1470", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1470", "name": "unipolar depression", "description": "" }, { "id": "DOID:1470", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1470", "name": "major depression", "description": "" }, { "id": "MONDO:0012100", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012100", "name": "major depressive disorder 2", "description": "" }, { "id": "MONDO:0012100", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012100", "name": "MDD2", "description": "" }, { "id": "MONDO:0012100", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012100", "name": "major depressive disorder 2", "description": "" }, { "id": "MONDO:0012100", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012100", "name": "major depressive disorder type 2", "description": "" }, { "id": "MONDO:0012100", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012100", "name": "unipolar depression 2", "description": "" }, { "id": "MONDO:0012050", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012050", "name": "major depressive disorder 1", "description": "" }, { "id": "MONDO:0012050", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012050", "name": "MDD1", "description": "" }, { "id": "MONDO:0012050", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012050", "name": "major depressive disorder 1", "description": "" }, { "id": "MONDO:0012050", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012050", "name": "major depressive disorder type 1", "description": "" }, { "id": "MONDO:0012050", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012050", "name": "unipolar depression 1", "description": "" } ], "evidence": [ { "id": "1470", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1470" } ] }, { "disease_id": "DOID:1485", "recommended_name": { "id": "DOID:1485", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1485", "name": "cystic fibrosis", "description": "A syndrome that is characterized by the buildup of thick, sticky mucus that can damage many organs." }, "synonyms": [ { "id": "DOID:1485", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1485", "name": "CF", "description": "" }, { "id": "DOID:1485", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1485", "name": "mucoviscidosis", "description": "" }, { "id": "MONDO:0009061", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009061", "name": "cystic fibrosis", "description": "Cystic fibrosis (CF) is a genetic disorder characterized by the production of sweat with a high salt content and mucus secretions with an abnormal viscosity." }, { "id": "MONDO:0009061", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009061", "name": "CF", "description": "" }, { "id": "MONDO:0009061", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009061", "name": "cystic fibrosis", "description": "" }, { "id": "MONDO:0009061", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009061", "name": "cystic fibrosis lung disease, modifier of", "description": "" }, { "id": "MONDO:0009061", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009061", "name": "mucoviscidosis", "description": "" }, { "id": "MONDO:0009061", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009061", "name": "pseudomonas aeruginosa, susceptibility to chronic infection by, in cystic fibrosis", "description": "" }, { "id": "MIM:219700", "resource": "MIM", "url": "https://www.omim.org/entry/219700", "name": "Cystic fibrosis", "description": "Cystic fibrosis" } ], "evidence": [ { "id": "1485", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1485" } ] }, { "disease_id": "DOID:1591", "recommended_name": { "id": "DOID:1591", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1591", "name": "renovascular hypertension", "description": "" }, "synonyms": [], "evidence": [ { "id": "1591", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1591" } ] }, { "disease_id": "DOID:1596", "recommended_name": { "id": "DOID:1596", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1596", "name": "depressive disorder", "description": "A mood disorder characterized by persistent sadness, emptiness, or irritability and decreased ability to function." }, "synonyms": [ { "id": "DOID:1596", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1596", "name": "mental depression", "description": "" } ], "evidence": [ { "id": "1596", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1596" } ] }, { "disease_id": "DOID:1826", "recommended_name": { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epilepsy", "description": "A brain disease that is characterized by the occurrance of at least two unprovoked seizures resulting from a persistent epileptogenic abnormality of the brain that is able to spontaneously generate paroxysmal activity and typically manifested by sudden brief episodes of altered or diminished consciousness, involuntary movements, or convulsions." }, "synonyms": [ { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epilepsy syndrome", "description": "" }, { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epileptic syndrome", "description": "" } ], "evidence": [ { "id": "1826", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1826" } ] }, { "disease_id": "DOID:1875", "recommended_name": { "id": "DOID:1875", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1875", "name": "impotence", "description": "A sexual dysfunction that is characterized by persistent or recurrent inability to achieve or to maintain an erection during sexual activity." }, "synonyms": [ { "id": "DOID:1875", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1875", "name": "Sexual impotence", "description": "" }, { "id": "DOID:1875", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1875", "name": "erectile dysfunction", "description": "" } ], "evidence": [ { "id": "1875", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1875" } ] }, { "disease_id": "DOID:224", "recommended_name": { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "transient cerebral ischemia", "description": "A brain ischemia that is characterized by ischemia of brief duration and without resultant tissue death." }, "synonyms": [ { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "TIA", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "TIA - Transient ischaemic attack", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "Transient cerebral ischaemia", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "Transient ischemic attacks", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "transient ischemic attack", "description": "" } ], "evidence": [ { "id": "224", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:224" } ] }, { "disease_id": "DOID:231", "recommended_name": { "id": "DOID:231", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:231", "name": "motor neuron disease", "description": "A neurodegenerative disease that is located_in the motor neurons." }, "synonyms": [], "evidence": [ { "id": "231", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:231" } ] }, { "disease_id": "DOID:2316", "recommended_name": { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "brain ischemia", "description": "An ischemia that is characterized by insufficient blood flow to the brain to meet metabolic demand." }, "synonyms": [ { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "Ischaemic encephalopathy", "description": "" }, { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "Ischemic encephalopathy", "description": "" }, { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "cerebral ischemia", "description": "" } ], "evidence": [ { "id": "2316", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2316" } ] }, { "disease_id": "DOID:2841", "recommended_name": { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "asthma", "description": "A bronchial disease that is characterized by chronic inflammation and narrowing of the airways, which is caused by a combination of environmental and genetic factors. The disease has_symptom recurring periods of wheezing (a whistling sound while breathing), has_symptom chest tightness, has_symptom shortness of breath, has_symptom mucus production and has_symptom coughing." }, "synonyms": [ { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "Exercise induced asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "bronchial hyperreactivity", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with acute exacerbation", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with status asthmaticus", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "exercise-induced asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "inherited susceptibility to asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, nocturnal, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, bronchial", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, diminished response to Antileukotriene treatment 1N", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, protection against", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma-related traits, susceptibility to", "description": "" }, { "id": "MIM:600807", "resource": "MIM", "url": "https://www.omim.org/entry/600807", "name": "Asthma", "description": "Asthma" } ], "evidence": [ { "id": "2841", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2841" } ] }, { "disease_id": "DOID:3021", "recommended_name": { "id": "DOID:3021", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3021", "name": "acute kidney failure", "description": "" }, "synonyms": [], "evidence": [ { "id": "3021", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3021" } ] }, { "disease_id": "DOID:3083", "recommended_name": { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "chronic obstructive pulmonary disease", "description": "An obstructive lung disease that is a chronic and progressive disorder of small airways in the lungs and that is characterized by irreversible airflow obstruction, typically identified by reductions in quantitative spirometric indices, induced forced expiratory volume at 1 second (FEV1) and the ratio of FEV1 to forced vital capacity (less than 0.7 is diagnostic of COPD). Lung volume is increased and pulmonary hypertension may occur. The pathologic changes result in the disruption of the airflow in the bronchial airways. Signs and symptoms include shortness of breath, wheezing, productive cough and chest tightness. COPD is a consequence (an end result) of chronic bronchitis, emphysema or both." }, "synonyms": [ { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "COLD", "description": "" }, { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "COPD", "description": "" }, { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "chronic obstructive airway disease", "description": "" }, { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "chronic obstructive lung disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive pulmonary disease", "description": "A chronic and progressive lung disorder characterized by the loss of elasticity of the bronchial tree and the air sacs, destruction of the air sacs wall, thickening of the bronchial wall, and mucous accumulation in the bronchial tree. The pathologic changes result in the disruption of the air flow in the bronchial airways. Signs and symptoms include shortness of breath, wheezing, productive cough, and chest tightness. The two main types of chronic obstructive pulmonary disease are chronic obstructive bronchitis and emphysema." }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "COPD", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "COPD, chronic obstructive pulmonary disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive airway disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive airways disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive lung disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive pulmonary disease (COPD)", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive pulmonary disease, (COPD)", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "cold", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "cold (chronic obstructive lung disease)", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "disease (COPD), chronic obstructive", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "obstructive lung disease, chronic", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "obstructive pulmonary disease (COPD), chronic", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "pulmonary disease (COPD), chronic obstructive", "description": "" } ], "evidence": [ { "id": "3083", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3083" } ] }, { "disease_id": "DOID:3328", "recommended_name": { "id": "DOID:3328", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3328", "name": "temporal lobe epilepsy", "description": "A focal epilepsy that is characterized by recurrent, unprovoked focal seizures that originate in the temporal lobe of the brain and last about one or two minutes." }, "synonyms": [ { "id": "DOID:3328", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3328", "name": "epilepsy, temporal lobe", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, familial temporal lobe, 1", "description": "An autosomal dominant condition caused by mutation(s) in the LGI1 gene, encoding leucine-rich glioma-inactivated protein 1. It is characterized by partial seizures originating in the temporal lobe and often accompanied by auditory sensory manifestations." }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "ETL1", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, familial temporal lobe, type 1", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, lateral temporal lobe, autosomal dominant", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, partial, with auditory features", "description": "" }, { "id": "MIM:600512", "resource": "MIM", "url": "https://www.omim.org/entry/600512", "name": "Epilepsy, familial temporal lobe, 1", "description": "Epilepsy, familial temporal lobe, 1" } ], "evidence": [ { "id": "3328", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3328" } ] }, { "disease_id": "DOID:5419", "recommended_name": { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia", "description": "A psychotic disorder that is characterized by a disintegration of thought processes and of emotional responsiveness." }, "synonyms": [ { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "A major psychotic disorder characterized by abnormalities in the perception or expression of reality. It affects the cognitive and psychomotor functions. Common clinical signs and symptoms include delusions, hallucinations, disorganized thinking, and retreat from reality." }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia 12", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia (disease)", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "SCZD", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizoaffective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia with or without an affective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia, susceptibility to", "description": "" }, { "id": "MIM:181500", "resource": "MIM", "url": "https://www.omim.org/entry/181500", "name": "Schizophrenia", "description": "Schizophrenia" } ], "evidence": [ { "id": "5419", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5419" } ] }, { "disease_id": "DOID:6000", "recommended_name": { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "congestive heart failure", "description": "A heart disease that is characterized by any structural or functional cardiac disorder that impairs the ability of the heart to fill with or pump a sufficient amount of blood throughout the body." }, "synonyms": [ { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "CHF", "description": "" }, { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "Cardiac Failure Congestive", "description": "" }, { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "Congestive heart disease", "description": "" }, { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "Weak heart", "description": "" } ], "evidence": [ { "id": "6000", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:6000" } ] }, { "disease_id": "DOID:783", "recommended_name": { "id": "DOID:783", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:783", "name": "end stage renal disease", "description": "A chronic kidney disease is characterized by non-functioning kidneys, as the final stage in chronic kidney disease." }, "synonyms": [ { "id": "DOID:783", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:783", "name": "end stage renal failure", "description": "" }, { "id": "DOID:783", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:783", "name": "end-stage kidney disease", "description": "" } ], "evidence": [ { "id": "783", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:783" } ] }, { "disease_id": "DOID:8947", "recommended_name": { "id": "DOID:8947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8947", "name": "diabetic retinopathy", "description": "" }, "synonyms": [ { "id": "DOID:8947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8947", "name": "Retinal abnormality - diabetes-related", "description": "" } ], "evidence": [ { "id": "8947", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8947" } ] }, { "disease_id": "DOID:9164", "recommended_name": { "id": "DOID:9164", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9164", "name": "achalasia", "description": "An esophageal disease that is characterized by an inability of the esophagus to move food toward the stomach resulting from the lower esophogeal sphincter not fully relaxing during swallowing." }, "synonyms": [ { "id": "DOID:9164", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9164", "name": "achalasia of cardia", "description": "" }, { "id": "DOID:9164", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9164", "name": "achalasia of esophagus", "description": "" }, { "id": "DOID:9164", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9164", "name": "cardiospasm", "description": "" }, { "id": "DOID:9164", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9164", "name": "esophageal achalasia", "description": "" }, { "id": "DOID:9164", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9164", "name": "hypertensive lower esophageal sphincter", "description": "" }, { "id": "DOID:9164", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9164", "name": "Lack of reflex relaxation of lower oesophageal sphincter", "description": "" }, { "id": "MONDO:0100457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100457", "name": "achalasia, familial esophageal", "description": "An instance of achalsia that is caused by an inherited genomic modification in an individual." }, { "id": "MONDO:0100457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100457", "name": "achalasia, familial esophageal", "description": "" } ], "evidence": [ { "id": "9164", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9164" } ] }, { "disease_id": "DOID:9352", "recommended_name": { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes mellitus", "description": "A diabetes mellitus that is characterized by high blood sugar, insulin resistance, and relative lack of insulin." }, "synonyms": [ { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "NIDDM", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type II diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "insulin resistance", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, type 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "Niddm4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "noninsulin-dependent diabetes mellitus 4", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "A type of diabetes mellitus that is characterized by insulin resistance or desensitization and increased blood glucose levels. This is a chronic disease that can develop gradually over the life of a patient and can be linked to both environmental factors and heredity." }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "NIDDM", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "T2DM - type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, association with", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, late onset", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, severe, digenic", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus non-insulin dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, non-insulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, protection against", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "hypertension, insulin resistance-related, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "maturity-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus, susceptibility to", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, type 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "NIDDM1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "noninsulin-dependent diabetes mellitus 1", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "NIDDM2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "noninsulin-dependent diabetes mellitus 2", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, type 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "type 2 diabetes mellitus 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "NIDDM3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "noninsulin-dependent diabetes mellitus 3", "description": "" }, { "id": "MIM:125853", "resource": "MIM", "url": "https://www.omim.org/entry/125853", "name": "Type 2 diabetes mellitus", "description": "Type 2 diabetes mellitus" }, { "id": "MIM:601283", "resource": "MIM", "url": "https://www.omim.org/entry/601283", "name": "Type 2 diabetes mellitus 1", "description": "Type 2 diabetes mellitus 1" } ], "evidence": [ { "id": "9352", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9352" } ] }, { "disease_id": "DOID:9970", "recommended_name": { "id": "DOID:9970", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9970", "name": "obesity", "description": "An overnutrition that is characterized by excess body fat, traditionally defined as an elevated ratio of weight to height (specifically 30 kilograms per meter squared), has_material_basis_in a multifactorial etiology related to excess nutrition intake, decreased caloric utilization, and genetic susceptibility, and possibly medications and certain disorders of metabolism, endocrine function, and mental illness." }, "synonyms": [ { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "inherited obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity (disease)", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "leanness, inherited, autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "monogenic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, association with, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, early-onset, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, late-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, mild, early-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, and type II diabetes, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MIM:601665", "resource": "MIM", "url": "https://www.omim.org/entry/601665", "name": "Obesity", "description": "Obesity" } ], "evidence": [ { "id": "9970", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9970" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Nos1", "url": "https://www.uniprot.org/uniprot/Q9Z0J4", "locus": { "chromosome": "5", "start_pos": 118096905, "end_pos": 117919097, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000029361", "url": "https://www.ensembl.org/id/ENSMUSG00000029361" } ] } } ], "crossref": [ { "id": "ENSMUSG00000029361", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000029361", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00795", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00795", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00992", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00992", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd06202", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06202", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4719", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4719", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "18125", "url": "https://www.ncbi.nlm.nih.gov/gene/18125", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9Z0J4", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9Z0J4*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001094", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001094", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001433", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001433", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001478", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001478", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001709", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001709", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003097", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003097", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004030", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004030", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008254", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008254", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012144", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012144", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017927", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017927", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017938", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017938", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023173", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023173", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029039", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029039", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036119", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036119", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039261", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039261", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044940", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044940", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044943", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044943", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044944", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044944", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:18125", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18125", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "97360", "url": "http://www.informatics.jax.org/marker/MGI:97360", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "KCPEPLR", "url": "https://omabrowser.org/oma/group/KCPEPLR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "276396at2759", "url": "http://www.orthodb.org/?query=276396at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43410", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43410", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43410:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43410:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2O60", "url": "https://www.rcsb.org/structure/2O60", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00175", "url": "http://pfam.xfam.org/family/PF00175", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00258", "url": "http://pfam.xfam.org/family/PF00258", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00595", "url": "http://pfam.xfam.org/family/PF00595", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00667", "url": "http://pfam.xfam.org/family/PF00667", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02898", "url": "http://pfam.xfam.org/family/PF02898", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9Z0J4", "url": "http://purl.obolibrary.org/obo/PR_Q9Z0J4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-1222556", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1222556", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-392154", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-392154", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5578775", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5578775", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_032738", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032738", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "19897", "url": "https://www.rhea-db.org/rhea/19897", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "F8WGF2", "url": "https://www.uniprot.org/uniprot/F8WGF2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WGF2-1", "url": "https://www.uniprot.org/uniprot/F8WGF2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z0J4-1", "url": "https://www.uniprot.org/uniprot/Q9Z0J4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z0J4-2", "url": "https://www.uniprot.org/uniprot/Q9Z0J4-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z0J4-3", "url": "https://www.uniprot.org/uniprot/Q9Z0J4-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z0J4-4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9Z0J4-5", "url": "https://www.uniprot.org/uniprot/Q9Z0J4-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R1D5", "url": "https://www.uniprot.org/uniprot/S4R1D5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R1D5-1", "url": "https://www.uniprot.org/uniprot/S4R1D5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R255", "url": "https://www.uniprot.org/uniprot/S4R255", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R255-1", "url": "https://www.uniprot.org/uniprot/S4R255-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEEHTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGTPTKAVDLSRQPSASKDQPLAVDRVPGPSNGPQHAQGRGQGAGSVSQANGVAIDPTMKNTKANLQDSGEQDELLKEIEPVLSILTGGGKAVNRGGPAKAEMKDTGIQVDRDLDGKLHKAPPLGGENDRVFNDLWGKGNVPVVLNNPYSENEQSPASGKQSPTKNGSPSRCPRFLKVKNWETDVVLTDTLHLKSTLETGCTEQICMGSIMLPSHHIRKSEDVRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVEFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKSYKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTYVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS", "length": 1429, "header": "sp|Q9Z0J4-1|NOS1_MOUSE Isoform 1 of Nitric oxide synthase 1 OS=Mus musculus OX=10090 GN=Nos1 PE=1 SV=1 CANONICAL=Q9Z0J4-1" }, "isoforms": [ { "isoform_ac": "F8WGF2-1", "url": "", "sequence": { "sequence": "MEEHTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGTPTKAVDLSRQPSASKDQPLAVDRVPGPSNGPQHAQGRGQGAGSVSQANGVAIDPTMKNTKANLQDSGEQDELLKEIEPVLSILTGGGKAVNRGGPAKAEMKDTGIQVDRDLDGKLHKAPPLGGENDRVFNDLWGKGNVPVVLNNPYSENEQSPASGKQSPTKNGSPSRCPRFLKVKNWETDVVLTDTLHLKSTLETGCTEQICMGSIMLPSHHIRKSEDVRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVEFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKYPEPLRFFPRKGPSLSHADSEAHSLVAARDSQHRSYKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTYVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS", "length": 1463, "header": "tr|F8WGF2-1|NOS1_MOUSE Computationally mapped isoform of Nitric oxide synthase 1 OS=Mus musculus OX=10090 GN=Nos1 PE=1 SV=1 CANONICAL=Q9Z0J4-1" }, "locus": { "chromosome": "5", "start_pos": 118091875, "end_pos": 118005282, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000102557.10", "url": "https://www.ensembl.org/id/ENSMUST00000102557.10" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000099617.3", "url": "https://www.ensembl.org/id/ENSMUSP00000099617.3" } ] } }, { "isoform_ac": "Q9Z0J4-1", "url": "", "sequence": { "sequence": "MEEHTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGTPTKAVDLSRQPSASKDQPLAVDRVPGPSNGPQHAQGRGQGAGSVSQANGVAIDPTMKNTKANLQDSGEQDELLKEIEPVLSILTGGGKAVNRGGPAKAEMKDTGIQVDRDLDGKLHKAPPLGGENDRVFNDLWGKGNVPVVLNNPYSENEQSPASGKQSPTKNGSPSRCPRFLKVKNWETDVVLTDTLHLKSTLETGCTEQICMGSIMLPSHHIRKSEDVRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVEFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKSYKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTYVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS", "length": 1429, "header": "sp|Q9Z0J4-1|NOS1_MOUSE Isoform 1 of Nitric oxide synthase 1 OS=Mus musculus OX=10090 GN=Nos1 PE=1 SV=1 CANONICAL=Q9Z0J4-1" }, "locus": { "chromosome": "5", "start_pos": 118091875, "end_pos": 118005282, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000142742", "url": "https://www.ensembl.org/id/ENSMUST00000142742" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000120421", "url": "https://www.ensembl.org/id/ENSMUSP00000120421" } ] } }, { "isoform_ac": "Q9Z0J4-2", "url": "", "sequence": { "sequence": "MEEHTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGTPTKAVDLSRQPSASKDQPLAVDRVPGPSNGPQHAQGRGQGAGSVSQANGVAIDPTMKNTKANLQDSGEQDELLKEIEPVLSILTGGGKAVNRGGPAKAEMKDTGIQVDRDLDGKLHKAPPLGGENDRVFNDLWGKGNVPVVLNNPYSENEQSPASGKQSPTKNGSPSRCPRFLKVKNWETDVVLTDTLHLKSTLETGCTEQICMGSIMLPSHHIRKSEDVRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVEFTEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKSYKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTYVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS", "length": 1324, "header": "sp|Q9Z0J4-2|NOS1_MOUSE Isoform 2 of Nitric oxide synthase 1 OS=Mus musculus OX=10090 GN=Nos1 PE=1 SV=1 CANONICAL=Q9Z0J4-1" }, "locus": {} }, { "isoform_ac": "Q9Z0J4-3", "url": "", "sequence": { "sequence": "MRGLGSRDLDGKLHKAPPLGGENDRVFNDLWGKGNVPVVLNNPYSENEQSPASGKQSPTKNGSPSRCPRFLKVKNWETDVVLTDTLHLKSTLETGCTEQICMGSIMLPSHHIRKSEDVRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVEFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKSYKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTYVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS", "length": 1199, "header": "sp|Q9Z0J4-3|NOS1_MOUSE Isoform 3 of Nitric oxide synthase 1 OS=Mus musculus OX=10090 GN=Nos1 PE=1 SV=1 CANONICAL=Q9Z0J4-1" }, "locus": {} }, { "isoform_ac": "Q9Z0J4-4", "url": "", "sequence": { "sequence": "MGSIMLPSHHIRKSEDVRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVEFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKSYKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTYVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS", "length": 1098, "header": "sp|Q9Z0J4-4|NOS1_MOUSE Isoform 4 of Nitric oxide synthase 1 OS=Mus musculus OX=10090 GN=Nos1 PE=1 SV=1 CANONICAL=Q9Z0J4-1" }, "locus": {} }, { "isoform_ac": "Q9Z0J4-5", "url": "", "sequence": { "sequence": "MEEHTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGTPTKAVDLSRQPSASKDQPLAVDRVPGPSNGPQHAQGRGQGAGSVSQANGVAIDPTMKNTKANLQDSGEQDELLKEIEPVLSILTGGGKAVNRGGPAKAEMKDTGIQVDRDLDGKLHKAPPLGGENDRVFNDLWGKGNVPVVLNNPYSENEQSPASGKQSPTKNGSPSRCPRFLKVKNWETDVVLTDTLHLKSTLETGCTEQICMGSIMLPSHHIRKSEDVRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVEFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKYPEPLRFFPRKGPSLSHVDSEAHSLVAARDSQHRSYKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTYVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS", "length": 1463, "header": "sp|Q9Z0J4-5|NOS1_MOUSE Isoform 5 of Nitric oxide synthase 1 OS=Mus musculus OX=10090 GN=Nos1 PE=1 SV=1 CANONICAL=Q9Z0J4-1" }, "locus": {} }, { "isoform_ac": "S4R1D5-1", "url": "", "sequence": { "sequence": "MEEHTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSA", "length": 80, "header": "tr|S4R1D5-1|S4R1D5_MOUSE Computationally mapped isoform of Nitric oxide synthase 1, neuronal OS=Mus musculus OX=10090 GN=Nos1 PE=1 SV=1 CANONICAL=Q9Z0J4-1" }, "locus": { "chromosome": "5", "start_pos": 118005521, "end_pos": 118005282, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000138579.3", "url": "https://www.ensembl.org/id/ENSMUST00000138579.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000138176.2", "url": "https://www.ensembl.org/id/ENSMUSP00000138176.2" } ] } }, { "isoform_ac": "S4R255-1", "url": "", "sequence": { "sequence": "MEEHTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGTPTKAVDLSRQPSASKDQPLAVDRVPGPSNGPQHAQGRGQGAGSVSQANGVAIDPTMKNTKANLQDSGEQDELLKEIEPVLSILTGGGKAVNRGGPAKAEMKDTGIQVDRDLDGKLHKAPPLGGENDRVFNDLWGKGNVPVVLNNPYSENEQSPASGKQSPTKNGSPSRCPRFLKVKNWETDVVLTDTLHLKSTLETGCTEQICMGSIMLPSHHIRKSEDVRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVEFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKSYKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTYVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDE", "length": 1425, "header": "tr|S4R255-1|NOS1_MOUSE Computationally mapped isoform of Nitric oxide synthase 1 OS=Mus musculus OX=10090 GN=Nos1 PE=1 SV=1 CANONICAL=Q9Z0J4-1" }, "locus": { "chromosome": "5", "start_pos": 118090949, "end_pos": 118005282, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000086451.12", "url": "https://www.ensembl.org/id/ENSMUST00000086451.12" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000138506.2", "url": "https://www.ensembl.org/id/ENSMUSP00000138506.2" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 1296, "end_pos": 1296, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" }, { "database": "PubMed", "id": "16214135", "url": "https://glygen.org/publication/PubMed/16214135" } ], "site_lbl": "Thr1296" }, { "start_pos": 1412, "end_pos": 1412, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" }, { "database": "PubMed", "id": "22209711", "url": "https://glygen.org/publication/PubMed/22209711" }, { "database": "PubMed", "id": "22262891", "url": "https://glygen.org/publication/PubMed/22262891" }, { "database": "PubMed", "id": "25025574", "url": "https://glygen.org/publication/PubMed/25025574" }, { "database": "PubMed", "id": "26324446", "url": "https://glygen.org/publication/PubMed/26324446" }, { "database": "PubMed", "id": "31634463", "url": "https://glygen.org/publication/PubMed/31634463" }, { "database": "PubMed", "id": "31975425", "url": "https://glygen.org/publication/PubMed/31975425" }, { "database": "PubMed", "id": "32101284", "url": "https://glygen.org/publication/PubMed/32101284" } ], "site_lbl": "Ser1412" }, { "start_pos": 280, "end_pos": 280, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "site_lbl": "Ser280" }, { "start_pos": 847, "end_pos": 847, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" }, { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" }, { "database": "PubMed", "id": "10874031", "url": "https://glygen.org/publication/PubMed/10874031" }, { "database": "PubMed", "id": "17258865", "url": "https://glygen.org/publication/PubMed/17258865" }, { "database": "PubMed", "id": "18096606", "url": "https://glygen.org/publication/PubMed/18096606" }, { "database": "PubMed", "id": "18635601", "url": "https://glygen.org/publication/PubMed/18635601" }, { "database": "PubMed", "id": "28066266", "url": "https://glygen.org/publication/PubMed/28066266" }, { "database": "PubMed", "id": "29905797", "url": "https://glygen.org/publication/PubMed/29905797" } ], "site_lbl": "Ser847" }, { "start_pos": 852, "end_pos": 852, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" }, { "database": "PubMed", "id": "28066266", "url": "https://glygen.org/publication/PubMed/28066266" }, { "database": "PubMed", "id": "29577226", "url": "https://glygen.org/publication/PubMed/29577226" } ], "site_lbl": "Ser852" }, { "start_pos": 857, "end_pos": 857, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "site_lbl": "Ser857" }, { "start_pos": 858, "end_pos": 858, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "site_lbl": "Ser858" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Solution structure and backbone dynamics of the second PDZ domain of postsynaptic density-95.", "journal": "J. Mol. Biol.", "date": "2000", "authors": "Tochio H, Hung F, Li M, Bredt DS, Zhang M", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "10623522", "url": "https://glygen.org/publication/PubMed/10623522" } ] }, { "title": "Inhibition of neuronal nitric-oxide synthase by calcium/ calmodulin-dependent protein kinase IIalpha through Ser847 phosphorylation in NG108-15 neuronal cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Komeima K, Hayashi Y, Naito Y, Watanabe Y", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "10874031", "url": "https://glygen.org/publication/PubMed/10874031" } ] }, { "title": "Dexras1: a G protein specifically coupled to neuronal nitric oxide synthase via CAPON.", "journal": "Neuron", "date": "2000", "authors": "Fang M, Jaffrey SR, Sawa A, Ye K, Luo X, Snyder SH", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "11086993", "url": "https://glygen.org/publication/PubMed/11086993" } ] }, { "title": "New sorting nexin (SNX27) and NHERF specifically interact with the 5-HT4a receptor splice variant: roles in receptor targeting.", "journal": "J. Cell Sci.", "date": "2004", "authors": "Joubert L, Hanson B, Barthet G, Sebben M, Claeysen S, Hong W, Marin P, Dumuis A, Bockaert J", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "15466885", "url": "https://glygen.org/publication/PubMed/15466885" } ] }, { "title": "Inhibition of neuronal nitric-oxide synthase by phosphorylation at Threonine1296 in NG108-15 neuronal cells.", "journal": "FEBS letters", "date": "2005", "authors": "Song T, Hatano N, Kume K, Sugimoto K, Yamaguchi F, Tokuda M, Watanabe Y", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "16214135", "url": "https://glygen.org/publication/PubMed/16214135" } ] }, { "title": "Phosphorylation of neuronal nitric oxide synthase at Ser847 in the nucleus intermediolateralis after spinal cord injury in mice.", "journal": "Neuroscience", "date": "2007", "authors": "Osuka K, Watanabe Y, Usuda N, Atsuzawa K, Aoshima C, Yamauchi K, Takayasu M, Yoshida J", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "17258865", "url": "https://glygen.org/publication/PubMed/17258865" } ] }, { "title": "Nitric oxide S-nitrosylates serine racemase, mediating feedback inhibition of D-serine formation.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2007", "authors": "Mustafa AK, Kumar M, Selvakumar B, Ho GP, Ehmsen JT, Barrow RK, Amzel LM, Snyder SH", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "17293453", "url": "https://glygen.org/publication/PubMed/17293453" } ] }, { "title": "Physical interaction between the serotonin transporter and neuronal nitric oxide synthase underlies reciprocal modulation of their activity.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2007", "authors": "Chanrion B, Mannoury la Cour C, Bertaso F, Lerner-Natoli M, Freissmuth M, Millan MJ, Bockaert J, Marin P", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "17452640", "url": "https://glygen.org/publication/PubMed/17452640" } ] }, { "title": "Active and inactive pools of nNOS in the nerve terminals in mouse gut: implications for nitrergic neurotransmission.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2008", "authors": "Rao YM, Chaudhury A, Goyal RK", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "18096606", "url": "https://glygen.org/publication/PubMed/18096606" } ] }, { "title": "PIN/LC8 is associated with cytosolic but not membrane-bound nNOS in the nitrergic varicosities of mice gut: implications for nitrergic neurotransmission.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2008", "authors": "Chaudhury A, Rao YM, Goyal RK", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "18635601", "url": "https://glygen.org/publication/PubMed/18635601" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" }, { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Requirement of argininosuccinate lyase for systemic nitric oxide production.", "journal": "Nat. Med.", "date": "2011", "authors": "Erez A, Nagamani SC, Shchelochkov OA, Premkumar MH, Campeau PM, Chen Y, Garg HK, Li L, Mian A, Bertin TK, Black JO, Zeng H, Tang Y, Reddy AK, Summar M, O'Brien WE, Harrison DG, Mitch WE, Marini JC, Aschner JL, Bryan NS, Lee B", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "22081021", "url": "https://glygen.org/publication/PubMed/22081021" } ] }, { "title": "NO-dependent protective effect of VEGF against excitotoxicity on layer VI of the developing cerebral cortex.", "journal": "Neurobiology of disease", "date": "2012", "authors": "El Ghazi F, Desfeux A, Brasse-Lagnel C, Roux C, Lesueur C, Mazur D, Remy-Jouet I, Richard V, Jegou S, Laudenbach V, Marret S, Bekri S, Prevot V, Gonzalez BJ", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "22209711", "url": "https://glygen.org/publication/PubMed/22209711" } ] }, { "title": "Kisspeptin-GPR54 signaling in mouse NO-synthesizing neurons participates in the hypothalamic control of ovulation.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2012", "authors": "Hanchate NK, Parkash J, Bellefontaine N, Mazur D, Colledge WH, d'Anglemont de Tassigny X, Prevot V", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "22262891", "url": "https://glygen.org/publication/PubMed/22262891" } ] }, { "title": "Acidic pH increases cGMP accumulation through the OGR1/phospholipase C/Ca(2+)/neuronal NOS pathway in N1E-115 neuronal cells.", "journal": "Cellular signalling", "date": "2014-11", "authors": "Kotake Mie, Sato Koichi, Mogi Chihiro, Tobo Masayuki, Aoki Haruka, Ishizuka Tamotsu, Sunaga Noriaki, Imai Hisao, Kaira Kyoichi, Hisada Takeshi, Yamada Masanobu, Okajima Fumikazu", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "25025574", "url": "https://glygen.org/publication/PubMed/25025574" } ] }, { "title": "NOS1-derived nitric oxide promotes NF-kappaB transcriptional activity through inhibition of suppressor of cytokine signaling-1.", "journal": "The Journal of experimental medicine", "date": "2015", "authors": "Baig MS, Zaichick SV, Mao M, de Abreu AL, Bakhshi FR, Hart PC, Saqib U, Deng J, Chatterjee S, Block ML, Vogel SM, Malik AB, Consolaro ME, Christman JW, Minshall RD, Gantner BN, Bonini MG", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "26324446", "url": "https://glygen.org/publication/PubMed/26324446" } ] }, { "title": "Deep Phosphoproteomic Measurements Pinpointing Drug Induced Protective Mechanisms in Neuronal Cells.", "journal": "Frontiers in physiology", "date": "2016", "authors": "Yu C, Gao J, Zhou Y, Chen X, Xiao R, Zheng J, Liu Y, Zhou H", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "28066266", "url": "https://glygen.org/publication/PubMed/28066266" } ] }, { "title": "Neuronal nitric oxide synthase phosphorylation induced by docosahexaenoic acid protects dopaminergic neurons in an experimental model of Parkinson's disease.", "journal": "Folia histochemica et cytobiologica", "date": "2018", "authors": "Parlak H, Ozkan A, Dilmac S, Tanriover G, Ozsoy O, Agar A", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "29577226", "url": "https://glygen.org/publication/PubMed/29577226" } ] }, { "title": "Crucial role for Nox2 and sleep deprivation in aircraft noise-induced vascular and cerebral oxidative stress, inflammation, and gene regulation.", "journal": "European heart journal", "date": "2018", "authors": "Kroller-Schon S, Daiber A, Steven S, Oelze M, Frenis K, Kalinovic S, Heimann A, Schmidt FP, Pinto A, Kvandova M, Vujacic-Mirski K, Filippou K, Dudek M, Bosmann M, Klein M, Bopp T, Hahad O, Wild PS, Frauenknecht K, Methner A, Schmidt ER, Rapp S, Mollnau H, Munzel T", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "29905797", "url": "https://glygen.org/publication/PubMed/29905797" } ] }, { "title": "Dysregulated NO/PDE5 signaling in the sickle cell mouse lower urinary tract: Reversal by oral nitrate therapy.", "journal": "Life sciences", "date": "2019", "authors": "Musicki B, Anele UA, Campbell JD, Karakus S, Shiva S, Silva FH, Burnett AL", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "31634463", "url": "https://glygen.org/publication/PubMed/31634463" } ] }, { "title": "Protein kinase A facilitates relaxation of mouse ileum via phosphorylation of neuronal nitric oxide synthase.", "journal": "British journal of pharmacology", "date": "2020-06", "authors": "Guerra Damian D, Bok Rachael, Lorca Ram\u00f3n A, Hurt K Joseph", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "31975425", "url": "https://glygen.org/publication/PubMed/31975425" } ] }, { "title": "Effect of neuronal nitric oxide synthase serine-1412 phosphorylation on hypothalamic-pituitary-ovarian function and leptin response.", "journal": "Biology of reproduction", "date": "2020-05-26", "authors": "Guerra Damian D, Bok Rachael, Cari Evelyn Llerena, Nicholas Cari, Orlicky David J, Johnson Joshua, Hurt K Joseph", "evidence": [ { "database": "iPTMnet", "id": "Q9Z0J4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "32101284", "url": "https://glygen.org/publication/PubMed/32101284" } ] }, { "title": "Nos1+ and Nos1- excitatory neurons in the BLA regulate anxiety- and depression-related behaviors oppositely.", "journal": "Journal of affective disorders", "date": "2023-04-18", "authors": "Cai Cheng-Yun, Tao Yan, Zhou Ying, Yang Di, Qin Cheng, Bian Xin-Lan, Xian Jia-Yun, Cao Bo, Chang Lei, Wu Hai-Yin, Luo Chun-Xia, Zhu Dong-Ya", "evidence": [ { "database": "RefSeq", "id": "NP_032738", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032738" } ], "reference": [ { "type": "PubMed", "id": "37080493", "url": "https://glygen.org/publication/PubMed/37080493" } ] }, { "title": "nNOS Increases Fiber Type-Specific Angiogenesis in Skeletal Muscle of Mice in Response to Endurance Exercise.", "journal": "International journal of molecular sciences", "date": "2023-05-26", "authors": "Baum Oliver, Huber-Abel Felicitas A M, Fl\u00fcck Martin", "evidence": [ { "database": "RefSeq", "id": "NP_032738", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032738" } ], "reference": [ { "type": "PubMed", "id": "37298293", "url": "https://glygen.org/publication/PubMed/37298293" } ] }, { "title": "Structural diversity of neuronal oxide synthase mRNA in the nervous system.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1993", "authors": "Esumi H., Ogura T., Yokoyama T., Kurashima Y., Fujisawa H.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "7686743", "url": "https://glygen.org/publication/PubMed/7686743" } ] }, { "title": "Neuronal nitric-oxide synthase-mu, an alternatively spliced isoform expressed in differentiated skeletal muscle.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Bredt D.S., Xia H., Silvagno F.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "8626668", "url": "https://glygen.org/publication/PubMed/8626668" } ] }, { "title": "Regulation of neuronal nitric oxide synthase through alternative transcripts.", "journal": "Dev. Neurosci.", "date": "1997", "authors": "Bredt D.S., Xia H., Brenman J.E., Black S.M., Chao D.S.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "reference": [ { "type": "PubMed", "id": "9208206", "url": "https://glygen.org/publication/PubMed/9208206" } ] } ], "pathway": [ { "id": "mmu:18125", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18125", "resource": "KEGG Pathway" }, { "id": "R-MMU-1222556", "name": "ROS and RNS production in phagocytes", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1222556", "resource": "Reactome", "description": "ROS and RNS production in phagocytes" }, { "id": "R-MMU-392154", "name": "Nitric oxide stimulates guanylate cyclase", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-392154", "resource": "Reactome", "description": "Nitric oxide stimulates guanylate cyclase" }, { "id": "R-MMU-5578775", "name": "Ion homeostasis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5578775", "resource": "Reactome", "description": "Ion homeostasis" } ], "orthologs": [ { "uniprot_canonical_ac": "P29475-1", "protein_name": "Nitric oxide synthase 1", "gene_name": "NOS1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAPRPPGQDPAKKATRVSLQGRGENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQVDRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPSKCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVRTKGQLFPLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTFVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGSQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEYEEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDKPKKYVQDILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAEDAGVFISRMRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS", "length": 1434 }, "evidence": [ { "id": "45224227", "url": "http://www.informatics.jax.org/homology/45224227", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P29476-1", "protein_name": "Nitric oxide synthase 1", "gene_name": "Nos1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEENTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPSASKDQSLAVDRVTGLGNGPQHAQGHGQGAGSVSQANGVAIDPTMKSTKANLQDIGEHDELLKEIEPVLSILNSGSKATNRGGPAKAEMKDTGIQVDRDLDGKSHKAPPLGGDNDRVFNDLWGKDNVPVILNNPYSEKEQSPTSGKQSPTKNGSPSRCPRFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLPSQHTRKPEDVRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKSYKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKPNNSLISNDRSWKRNKFRLTYVAEAPDLTQGLSNVHKKRVSAARLLSRQNLQSPKFSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDADEVFSS", "length": 1429 }, "evidence": [ { "id": "45224227", "url": "http://www.informatics.jax.org/homology/45224227", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 18, "go_terms": [ { "name": "nitric-oxide synthase activity", "id": "GO:0004517", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004517", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "calmodulin binding", "id": "GO:0005516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005516", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "flavin adenine dinucleotide binding", "id": "GO:0050660", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050660", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "heme binding", "id": "GO:0020037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "FMN binding", "id": "GO:0010181", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010181", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "NADP binding", "id": "GO:0050661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050661", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "cadmium ion binding", "id": "GO:0046870", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046870", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "calcium-dependent protein binding", "id": "GO:0048306", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048306", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "ATPase binding", "id": "GO:0051117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051117", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "sodium channel regulator activity", "id": "GO:0017080", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017080", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "transmembrane transporter binding", "id": "GO:0044325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044325", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "phosphoprotein binding", "id": "GO:0051219", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051219", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "scaffold protein binding", "id": "GO:0097110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097110", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "NADPH binding", "id": "GO:0070402", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070402", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 30, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "dendritic spine", "id": "GO:0043197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043197", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "sarcolemma", "id": "GO:0042383", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042383", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "sarcoplasmic reticulum", "id": "GO:0016529", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016529", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "glutamatergic synapse", "id": "GO:0098978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098978", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "calyx of Held", "id": "GO:0044305", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044305", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "mitochondrial outer membrane", "id": "GO:0005741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005741", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "postsynaptic density", "id": "GO:0014069", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014069", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "secretory granule", "id": "GO:0030141", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030141", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "nuclear membrane", "id": "GO:0031965", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031965", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "photoreceptor inner segment", "id": "GO:0001917", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001917", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "cell periphery", "id": "GO:0071944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071944", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "Z disc", "id": "GO:0030018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030018", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "azurophil granule", "id": "GO:0042582", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042582", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "T-tubule", "id": "GO:0030315", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030315", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "vesicle membrane", "id": "GO:0012506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012506", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "sarcoplasmic reticulum membrane", "id": "GO:0033017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033017", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "postsynaptic density, intracellular component", "id": "GO:0099092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099092", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "postsynaptic specialization, intracellular component", "id": "GO:0099091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099091", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 53, "go_terms": [ { "name": "positive regulation of peptidyl-serine phosphorylation", "id": "GO:0033138", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033138", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "response to hypoxia", "id": "GO:0001666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001666", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "vasodilation", "id": "GO:0042311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042311", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "nitric oxide biosynthetic process", "id": "GO:0006809", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006809", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "response to heat", "id": "GO:0009408", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009408", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "multicellular organismal response to stress", "id": "GO:0033555", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033555", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "cellular response to chemical stimulus", "id": "GO:0070887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070887", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "muscle contraction", "id": "GO:0006936", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006936", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "peptidyl-cysteine S-nitrosylation", "id": "GO:0018119", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018119", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "response to lipopolysaccharide", "id": "GO:0032496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032496", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "positive regulation of long-term synaptic potentiation", "id": "GO:1900273", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900273", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "positive regulation of neuron death", "id": "GO:1901216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901216", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "calcium ion transport", "id": "GO:0006816", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006816", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "positive regulation of guanylate cyclase activity", "id": "GO:0031284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031284", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of blood pressure", "id": "GO:0045776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045776", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of neuron apoptotic process", "id": "GO:0043524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043524", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "regulation of sodium ion transport", "id": "GO:0002028", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002028", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of insulin secretion", "id": "GO:0046676", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046676", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of calcium ion transport", "id": "GO:0051926", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051926", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "cellular response to growth factor stimulus", "id": "GO:0071363", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071363", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "nitric oxide mediated signal transduction", "id": "GO:0007263", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007263", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "establishment of protein localization", "id": "GO:0045184", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045184", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "potassium ion transport", "id": "GO:0006813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006813", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of potassium ion transport", "id": "GO:0043267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043267", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "behavioral response to cocaine", "id": "GO:0048148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048148", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "xenobiotic catabolic process", "id": "GO:0042178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042178", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "response to hormone", "id": "GO:0009725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009725", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "response to estrogen", "id": "GO:0043627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043627", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "cellular response to mechanical stimulus", "id": "GO:0071260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071260", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "striated muscle contraction", "id": "GO:0006941", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006941", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of vasoconstriction", "id": "GO:0045906", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045906", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "cellular response to epinephrine stimulus", "id": "GO:0071872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071872", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "response to peptide hormone", "id": "GO:0043434", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043434", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "positive regulation of sodium ion transmembrane transport", "id": "GO:1902307", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902307", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of iron ion transmembrane transport", "id": "GO:0034760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034760", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "positive regulation of histone acetylation", "id": "GO:0035066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035066", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "regulation of neurogenesis", "id": "GO:0050767", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050767", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of peptidyl-serine phosphorylation", "id": "GO:0033137", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033137", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of hydrolase activity", "id": "GO:0051346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051346", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "arginine catabolic process", "id": "GO:0006527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006527", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of cytosolic calcium ion concentration", "id": "GO:0051481", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051481", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of serotonin uptake", "id": "GO:0051612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051612", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "establishment of localization in cell", "id": "GO:0051649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051649", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "synaptic signaling by nitric oxide", "id": "GO:0099163", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099163", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "retrograde trans-synaptic signaling by nitric oxide", "id": "GO:0098924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098924", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "positive regulation of the force of heart contraction", "id": "GO:0098735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098735", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "regulation of postsynaptic membrane potential", "id": "GO:0060078", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060078", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "positive regulation of adenylate cyclase-activating adrenergic receptor signaling pathway involved in heart process", "id": "GO:0140196", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140196", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" }, { "name": "negative regulation of hepatic stellate cell contraction", "id": "GO:0061875", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061875", "evidence": [ { "database": "UniProtKB", "id": "Q9Z0J4", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 291, "end_pos": 293, "annotation": "n_glycosylation_sequon" }, { "start_pos": 411, "end_pos": 413, "annotation": "n_glycosylation_sequon" }, { "start_pos": 720, "end_pos": 722, "annotation": "n_glycosylation_sequon" }, { "start_pos": 954, "end_pos": 956, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "19897", "name": "", "equation": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P29476-1", "Q06518-1", "Q62600-1", "P35228-1", "P29475-1", "P29474-1", "P29477-1", "P70313-1", "Q9Z0J4-1", "Q27571-1" ], "evidence": [ { "id": "19897", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19897" } ] }, { "id": "R-MMU-418436", "name": "Nitric Oxide Synthase (NOS) produces Nitric Oxide (NO)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P70313-1", "P29477-1", "Q9Z0J4-1" ], "evidence": [ { "id": "R-MMU-418436", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418436" } ] }, { "id": "R-MMU-5617178", "name": "ATP2B4 binds to NOS1, inhibiting it", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6Q477-1", "Q9Z0J4-1" ], "evidence": [ { "id": "R-MMU-5617178", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5617178" } ] }, { "id": "R-MMU-5617179", "name": "PRKACA phosphorylates TNNI3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-MMU-390542" ], "output_participant_list": [ "R-MMU-5617219" ], "enzyme_list": [ "P05132-1", "Q6Q477-1", "Q9Z0J4-1" ], "evidence": [ { "id": "R-MMU-5617179", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5617179" } ] }, { "id": "R-MMU-5617182", "name": "PRKACA phosphorylates PLN", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, sarcoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P05132-1", "Q6Q477-1", "Q9Z0J4-1" ], "evidence": [ { "id": "R-MMU-5617182", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5617182" } ] } ], "reaction_participants": [ { "participant_id": "R-MMU-390542", "participant_name": "Tnni3 [cytosol]", "crossref": [ { "id": "2JPW", "database": "PDB", "url": "" }, { "id": "NP_033432.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSG00000035458", "database": "Ensembl", "url": "" }, { "id": "P48787", "database": "UniProt", "url": "" }, { "id": "P48787", "database": "PRO", "url": "" }, { "id": "ENSMUST00000098859", "database": "Ensembl", "url": "" }, { "id": "6KLT", "database": "PDB", "url": "" }, { "id": "ENSMUSP00000096458", "database": "Ensembl", "url": "" }, { "id": "98783", "database": "MGI", "url": "" }, { "id": "6KLU", "database": "PDB", "url": "" } ] }, { "participant_id": "R-MMU-5617219", "participant_name": "phospho-Tnni3 [cytosol]", "crossref": [ { "id": "P48787", "database": "UniProt", "url": "" }, { "id": "98783", "database": "MGI", "url": "" }, { "id": "2JPW", "database": "PDB", "url": "" }, { "id": "6KLT", "database": "PDB", "url": "" }, { "id": "P48787", "database": "PRO", "url": "" }, { "id": "6KLU", "database": "PDB", "url": "" }, { "id": "NP_033432.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSP00000096458", "database": "Ensembl", "url": "" }, { "id": "ENSMUSG00000035458", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000098859", "database": "Ensembl", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P05132", "gene_name": "Prkaca", "activity": [ { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P05132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05132" } ] }, { "ec_number": "2.7.11.11", "activity": "", "evidence": [ { "id": "P05132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05132" } ] } ] }, { "uniprot_ac": "P29474", "gene_name": "NOS3", "activity": [ { "ec_number": "1.14.13.39", "activity": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide.", "evidence": [ { "id": "P29474", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29474" } ] }, { "ec_number": "1.14.13.39", "activity": "", "evidence": [ { "id": "P29474", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29474" } ] } ] }, { "uniprot_ac": "P29475", "gene_name": "NOS1", "activity": [ { "ec_number": "1.14.13.39", "activity": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide.", "evidence": [ { "id": "P29475", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29475" } ] }, { "ec_number": "1.14.13.39", "activity": "", "evidence": [ { "id": "P29475", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29475" } ] } ] }, { "uniprot_ac": "P29476", "gene_name": "Nos1", "activity": [ { "ec_number": "1.14.13.39", "activity": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide.", "evidence": [ { "id": "P29476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29476" } ] }, { "ec_number": "1.14.13.39", "activity": "", "evidence": [ { "id": "P29476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29476" } ] } ] }, { "uniprot_ac": "P29477", "gene_name": "Nos2", "activity": [ { "ec_number": "1.14.13.39", "activity": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide.", "evidence": [ { "id": "P29477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29477" } ] }, { "ec_number": "1.14.13.39", "activity": "", "evidence": [ { "id": "P29477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29477" } ] } ] }, { "uniprot_ac": "P35228", "gene_name": "NOS2", "activity": [ { "ec_number": "1.14.13.39", "activity": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide.", "evidence": [ { "id": "P35228", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35228" } ] }, { "ec_number": "1.14.13.39", "activity": "", "evidence": [ { "id": "P35228", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35228" } ] } ] }, { "uniprot_ac": "P70313", "gene_name": "Nos3", "activity": [ { "ec_number": "1.14.13.39", "activity": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide.", "evidence": [ { "id": "P70313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70313" } ] }, { "ec_number": "1.14.13.39", "activity": "", "evidence": [ { "id": "P70313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70313" } ] } ] }, { "uniprot_ac": "Q06518", "gene_name": "Nos2", "activity": [ { "ec_number": "1.14.13.39", "activity": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide.", "evidence": [ { "id": "Q06518", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06518" } ] }, { "ec_number": "1.14.13.39", "activity": "", "evidence": [ { "id": "Q06518", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06518" } ] } ] }, { "uniprot_ac": "Q27571", "gene_name": "Nos", "activity": [ { "ec_number": "1.14.13.39", "activity": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide.", "evidence": [ { "id": "Q27571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q27571" } ] }, { "ec_number": "1.14.13.39", "activity": "", "evidence": [ { "id": "Q27571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q27571" } ] } ] }, { "uniprot_ac": "Q62600", "gene_name": "Nos3", "activity": [ { "ec_number": "1.14.13.39", "activity": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide.", "evidence": [ { "id": "Q62600", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62600" } ] }, { "ec_number": "1.14.13.39", "activity": "", "evidence": [ { "id": "Q62600", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62600" } ] } ] }, { "uniprot_ac": "Q6Q477", "gene_name": "Atp2b4", "activity": [ { "ec_number": "7.2.2.10", "activity": "ATP + Ca(2+)(in) + H2O = ADP + Ca(2+)(out) + H(+) + phosphate.", "evidence": [ { "id": "Q6Q477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6Q477" } ] }, { "ec_number": "7.2.2.10", "activity": "", "evidence": [ { "id": "Q6Q477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6Q477" } ] } ] }, { "uniprot_ac": "Q9Z0J4", "gene_name": "Nos1", "activity": [ { "ec_number": "1.14.13.39", "activity": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide.", "evidence": [ { "id": "Q9Z0J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ] }, { "ec_number": "1.14.13.39", "activity": "", "evidence": [ { "id": "Q9Z0J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0J4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 27 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }