{ "uniprot_canonical_ac": "Q9XZT6-1", "uniprot_ac": "Q9XZT6", "uniprot_id": "DNK_DROME", "mass": { "chemical_mass": 29088.0, "monoisotopic_mass": 29088.0 }, "refseq": { "ac": "NP_001262722", "name": "deoxyribonucleoside kinase, isoform B", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262722" }, "gene_names": [ { "name": "dnk", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9XZT6", "id": "Q9XZT6" }, { "name": "CG5452; Dm-dNK; DM-dNK; DmdNK; Dmel\\CG5452; dNK; DNK", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262722", "id": "NP_001262722" }, { "name": "CG5452", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9XZT6", "id": "Q9XZT6" }, { "name": "DM-dNK", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9XZT6", "id": "Q9XZT6" }, { "name": "DNK", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9XZT6", "id": "Q9XZT6" }, { "name": "Dm-dNK", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9XZT6", "id": "Q9XZT6" }, { "name": "DmdNK", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9XZT6", "id": "Q9XZT6" }, { "name": "Dmel\\CG5452", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9XZT6", "id": "Q9XZT6" }, { "name": "Dmel_CG5452", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9XZT6", "id": "Q9XZT6" }, { "name": "dNK", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9XZT6", "id": "Q9XZT6" }, { "name": "dnk", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262722", "id": "NP_001262722" } ], "protein_names": [ { "name": "Deoxynucleoside kinase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9XZT6" }, { "name": "2.7.1.145", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9XZT6" }, { "name": "CG5452-PB; dnk-PB; 2'-deoxynucleoside kinase; deoxyribonucleoside", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262722", "id": "NP_001262722" }, { "name": "Deoxyribonucleoside kinase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9XZT6" }, { "name": "Dm-dNK", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9XZT6" }, { "name": "Multispecific deoxynucleoside kinase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9XZT6" }, { "name": "deoxyribonucleoside kinase, isoform B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262722", "id": "NP_001262722" } ], "function": [ { "annotation": "Deoxyribonucleoside kinase that has a broad specificity phosphorylating thymidine, 2'-deoxyriboadenosine, 2'-deoxyribocytidine and 2'-deoxyriboguanosine. Specificity is higher for pyrimidine nucleosides. Several anti-viral and anti-cancer nucleoside analogs are also efficiently phosphorylated.", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6#function" }, { "database": "PubMed", "id": "10446143", "url": "https://glygen.org/publication/PubMed/10446143" }, { "database": "PubMed", "id": "10692477", "url": "https://glygen.org/publication/PubMed/10692477" }, { "database": "PubMed", "id": "16008571", "url": "https://glygen.org/publication/PubMed/16008571" } ] } ], "disease": [ { "disease_id": "DOID:0080120", "recommended_name": { "id": "DOID:0080120", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080120", "name": "mitochondrial DNA depletion syndrome 2", "description": "A mitochondrial DNA depletion syndrome that is characterized by childhood onset of muscle weakness associated with depletion of mtDNA in skeletal muscle, and has_material_basis_in autosomal recessive inheritance of homozygous or compound heterozygous mutation in the mitochondrial thymidine kinase gene on chromosome 16q21." }, "synonyms": [ { "id": "DOID:0080120", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080120", "name": "TK2-related mitochondrial DNA depletion syndrome, myopathic form", "description": "" }, { "id": "MONDO:0012301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012301", "name": "mitochondrial DNA depletion syndrome, myopathic form", "description": "Myopathic mitochondrial DNA (mtDNA) depletion syndrome is one of the main forms of mtDNA depletion syndrome that displays a broad phenotypic spectrum but that is most often characterized by hypotonia, proximal muscle weakness, facial and bulbar weakness and failure to thrive." }, { "id": "MONDO:0012301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012301", "name": "mitochondrial DNA depletion syndrome type 2", "description": "" }, { "id": "MONDO:0012301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012301", "name": "mtDNA depletion syndrome, myopathic form", "description": "" }, { "id": "MONDO:0012301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012301", "name": "MTDPS2", "description": "" }, { "id": "MONDO:0012301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012301", "name": "mitochondrial DNA depletion myopathy, Tk2-related", "description": "" }, { "id": "MONDO:0012301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012301", "name": "mitochondrial DNA depletion syndrome 2", "description": "" }, { "id": "MONDO:0012301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012301", "name": "mitochondrial DNA depletion syndrome 2 (myopathic type)", "description": "" }, { "id": "MIM:609560", "resource": "MIM", "url": "https://www.omim.org/entry/609560", "name": "Mitochondrial DNA depletion syndrome 2", "description": "Mitochondrial DNA depletion syndrome 2" } ], "evidence": [ { "id": "0080120", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080120" } ] }, { "disease_id": "DOID:0111523", "recommended_name": { "id": "DOID:0111523", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111523", "name": "autosomal recessive progressive external ophthalmoplegia with mitochondrial DNA deletions 3", "description": "A chronic progressive external ophthalmoplegia that has_material_basis_in homozygous or compound heterozygous mutation in TK2 on chromosome 16q21." }, "synonyms": [ { "id": "DOID:0111523", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111523", "name": "autosomal recessive progressive external ophthalmoplegia 3", "description": "" }, { "id": "DOID:0111523", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111523", "name": "PEOB3", "description": "" }, { "id": "MONDO:0014898", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014898", "name": "progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal recessive 3", "description": "Any autosomal recessive progressive external ophthalmoplegia in which the cause of the disease is a mutation in the TK2 gene." }, { "id": "MONDO:0014898", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014898", "name": "PEOB3", "description": "" }, { "id": "MONDO:0014898", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014898", "name": "TK2 autosomal recessive progressive external ophthalmoplegia", "description": "" }, { "id": "MONDO:0014898", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014898", "name": "autosomal recessive progressive external ophthalmoplegia caused by mutation in TK2", "description": "" }, { "id": "MONDO:0014898", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014898", "name": "progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal recessive 3", "description": "" }, { "id": "MONDO:0014898", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014898", "name": "progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal recessive 3; PEOB3", "description": "" }, { "id": "MONDO:0014898", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014898", "name": "progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal recessive type 3", "description": "" }, { "id": "MONDO:0014898", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014898", "name": "progressive external ophthalmoplegia, autosomal recessive 3", "description": "" }, { "id": "MIM:617069", "resource": "MIM", "url": "https://www.omim.org/entry/617069", "name": "Progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal recessive 3", "description": "Progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal recessive 3" } ], "evidence": [ { "id": "0111523", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111523" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 45, "end_pos": 45, "sequence_org": "N", "sequence_mut": "D", "comment": "Reduces enzyme activity towards dA, dG, dT and dC about 5-fold.", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" }, { "database": "PubMed", "id": "16008571", "url": "https://glygen.org/publication/PubMed/16008571" } ] }, { "start_pos": 64, "end_pos": 64, "sequence_org": "N", "sequence_mut": "D", "comment": "Reduces enzyme activity towards dT and dC about 500-fold. Reduces enzyme activity towards dG about 3900-fold. Reduces enzyme activity towards dA about 900-fold.", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" }, { "database": "PubMed", "id": "16008571", "url": "https://glygen.org/publication/PubMed/16008571" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "dnk", "url": "https://www.uniprot.org/uniprot/Q9XZT6", "locus": { "chromosome": "3R", "start_pos": 18982749, "end_pos": 18980995, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0022338", "url": "https://www.ensembl.org/id/FBgn0022338" } ] } } ], "crossref": [ { "id": "FBgn0022338", "url": "https://bgee.org/?page=gene&gene_id=FBgn0022338", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.7.1.145", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.1.145&UniProtAcc=Q9XZT6", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd01673", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01673", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4760", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4760", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "FBgn0022338", "url": "https://flybase.org/reports/FBgn0022338", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "42273", "url": "https://www.ncbi.nlm.nih.gov/gene/42273", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9XZT6", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9XZT6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002624", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002624", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031314", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031314", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG5452", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG5452", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "QEWYEFI", "url": "https://omabrowser.org/oma/group/QEWYEFI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5393913at2759", "url": "http://www.orthodb.org/?query=5393913at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10513", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10513", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10513:SF24", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10513:SF24", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1J90", "url": "https://www.rcsb.org/structure/1J90", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OE0", "url": "https://www.rcsb.org/structure/1OE0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OT3", "url": "https://www.rcsb.org/structure/1OT3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZM7", "url": "https://www.rcsb.org/structure/1ZM7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZMX", "url": "https://www.rcsb.org/structure/1ZMX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JCS", "url": "https://www.rcsb.org/structure/2JCS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JJ8", "url": "https://www.rcsb.org/structure/2JJ8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VP0", "url": "https://www.rcsb.org/structure/2VP0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VP2", "url": "https://www.rcsb.org/structure/2VP2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VP4", "url": "https://www.rcsb.org/structure/2VP4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VP5", "url": "https://www.rcsb.org/structure/2VP5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VP6", "url": "https://www.rcsb.org/structure/2VP6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VP9", "url": "https://www.rcsb.org/structure/2VP9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VPP", "url": "https://www.rcsb.org/structure/2VPP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VQS", "url": "https://www.rcsb.org/structure/2VQS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YBH", "url": "https://www.rcsb.org/structure/6YBH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01712", "url": "http://pfam.xfam.org/family/PF01712", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9XZT6", "url": "http://purl.obolibrary.org/obo/PR_Q9XZT6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DME-73614", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-73614", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001262722", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262722", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "12140", "url": "https://www.rhea-db.org/rhea/12140", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q540Z9", "url": "https://www.uniprot.org/uniprot/Q540Z9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q540Z9-1", "url": "https://www.uniprot.org/uniprot/Q540Z9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9XZT6-1", "url": "https://www.uniprot.org/uniprot/Q9XZT6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAEAASCARKGTKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADLNLENIGTEYQRSESSIFDAISSNQQPSPVLVSPSKRQRVAR", "length": 250, "header": "sp|Q9XZT6-1|DNK_DROME Isoform 1 of Deoxynucleoside kinase OS=Drosophila melanogaster OX=7227 GN=dnk PE=1 SV=1 CANONICAL=Q9XZT6-1" }, "isoforms": [ { "isoform_ac": "Q540Z9-1", "url": "", "sequence": { "sequence": "MAEAASCARKGTKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADLNLENIGTEYQRSESSIFDAISSNQQPSPVLVSPSKRQRVAR", "length": 250, "header": "tr|Q540Z9-1|DNK_DROME Computationally mapped isoform of Deoxynucleoside kinase OS=Drosophila melanogaster OX=7227 GN=dnk PE=1 SV=1 CANONICAL=Q9XZT6-1" }, "locus": { "chromosome": "3R", "start_pos": 18982454, "end_pos": 18981572, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0083707", "url": "https://www.ensembl.org/id/FBtr0083707" }, { "database": "Ensembl Peptide", "id": "FBpp0083121", "url": "https://www.ensembl.org/id/FBpp0083121" } ] } }, { "isoform_ac": "Q9XZT6-1", "url": "", "sequence": { "sequence": "MAEAASCARKGTKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADLNLENIGTEYQRSESSIFDAISSNQQPSPVLVSPSKRQRVAR", "length": 250, "header": "sp|Q9XZT6-1|DNK_DROME Isoform 1 of Deoxynucleoside kinase OS=Drosophila melanogaster OX=7227 GN=dnk PE=1 SV=1 CANONICAL=Q9XZT6-1" }, "locus": { "chromosome": "3R", "start_pos": 18982454, "end_pos": 18981572, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0083707", "url": "https://www.ensembl.org/id/FBtr0083707" }, { "database": "Ensembl Peptide", "id": "FBpp0083121", "url": "https://www.ensembl.org/id/FBpp0083121" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 236, "end_pos": 236, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" }, { "database": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" }, { "database": "phospho.ELM", "id": "Q9XZT6", "url": "http://phospho.elm.eu.org/byAccession/Q9XZT6.html" }, { "database": "iPTMnet", "id": "Q9XZT6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9XZT6" } ], "site_lbl": "Ser236" }, { "start_pos": 241, "end_pos": 241, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" }, { "database": "PubMed", "id": "17372656", "url": "https://glygen.org/publication/PubMed/17372656" }, { "database": "iPTMnet", "id": "Q9XZT6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9XZT6" } ], "site_lbl": "Ser241" }, { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" }, { "database": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" }, { "database": "phospho.ELM", "id": "Q9XZT6", "url": "http://phospho.elm.eu.org/byAccession/Q9XZT6.html" }, { "database": "iPTMnet", "id": "Q9XZT6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9XZT6" } ], "site_lbl": "Ser243" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Cloning and characterization of the multisubstrate deoxyribonucleoside kinase of Drosophila melanogaster.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Karlsson A., Johansson M., Balzarini J., Van Rompay A.R., Degreve B.", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "reference": [ { "type": "PubMed", "id": "10446143", "url": "https://glygen.org/publication/PubMed/10446143" } ] }, { "title": "Functional expression of a multisubstrate deoxyribonucleoside kinase from Drosophila melanogaster and its C-terminal deletion mutants.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Knecht W., Munch-Petersen B., Piskur J., Sondergaard L., Lenz C.", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "reference": [ { "type": "PubMed", "id": "10692477", "url": "https://glygen.org/publication/PubMed/10692477" } ] }, { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q540Z9", "url": "https://www.uniprot.org/uniprot/Q540Z9" }, { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "Q540Z9", "url": "https://www.uniprot.org/uniprot/Q540Z9" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q540Z9", "url": "https://www.uniprot.org/uniprot/Q540Z9" }, { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q540Z9", "url": "https://www.uniprot.org/uniprot/Q540Z9" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q540Z9", "url": "https://www.uniprot.org/uniprot/Q540Z9" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Structural basis for feedback inhibition of the deoxyribonucleoside salvage pathway: studies of the Drosophila deoxyribonucleoside kinase.", "journal": "Biochemistry", "date": "2003", "authors": "Andersen G., Karlsson A., Eklund H., Johansson K., Knecht W., Munch-Petersen B., Piskur J., Mikkelsen N.E.", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "reference": [ { "type": "PubMed", "id": "12741827", "url": "https://glygen.org/publication/PubMed/12741827" } ] }, { "title": "Structural basis for the changed substrate specificity of Drosophila melanogaster deoxyribonucleoside kinase mutant N64D.", "journal": "FEBS J.", "date": "2005", "authors": "Welin M, Skovgaard T, Knecht W, Zhu C, Berenstein D, Munch-Petersen B, Piskur J, Eklund H", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "reference": [ { "type": "PubMed", "id": "16008571", "url": "https://glygen.org/publication/PubMed/16008571" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "Q540Z9", "url": "https://www.uniprot.org/uniprot/Q540Z9" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "An integrated chemical, mass spectrometric and computational strategy for (quantitative) phosphoproteomics: application to Drosophila melanogaster Kc167 cells.", "journal": "Molecular bioSystems", "date": "2007", "authors": "Bodenmiller B, Mueller LN, Pedrioli PG, Pflieger D, Junger MA, Eng JK, Aebersold R, Tao WA", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" }, { "database": "iPTMnet", "id": "Q9XZT6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9XZT6" } ], "reference": [ { "type": "PubMed", "id": "17372656", "url": "https://glygen.org/publication/PubMed/17372656" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q540Z9", "url": "https://www.uniprot.org/uniprot/Q540Z9" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q540Z9", "url": "https://www.uniprot.org/uniprot/Q540Z9" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "Phosphoproteome analysis of Drosophila melanogaster embryos.", "journal": "Journal of proteome research", "date": "2008", "authors": "Zhai B, Villen J, Beausoleil SA, Mintseris J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" }, { "database": "iPTMnet", "id": "Q9XZT6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9XZT6" } ], "reference": [ { "type": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" } ] }, { "title": "Structural studies of nucleoside analog and feedback inhibitor binding to Drosophila melanogaster multisubstrate deoxyribonucleoside kinase.", "journal": "FEBS J.", "date": "2008", "authors": "Eklund H., Munch-Petersen B., Mikkelsen N.E.", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "reference": [ { "type": "PubMed", "id": "18384378", "url": "https://glygen.org/publication/PubMed/18384378" } ] }, { "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.", "journal": "Genome Res.", "date": "2015", "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q540Z9", "url": "https://www.uniprot.org/uniprot/Q540Z9" } ], "reference": [ { "type": "PubMed", "id": "25589440", "url": "https://glygen.org/publication/PubMed/25589440" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q540Z9", "url": "https://www.uniprot.org/uniprot/Q540Z9" } ], "reference": [ { "type": "PubMed", "id": "26109356", "url": "https://glygen.org/publication/PubMed/26109356" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q540Z9", "url": "https://www.uniprot.org/uniprot/Q540Z9" } ], "reference": [ { "type": "PubMed", "id": "26109357", "url": "https://glygen.org/publication/PubMed/26109357" } ] }, { "title": "Four deoxynucleoside kinase activities from Drosophila melanogaster are contained within a single monomeric enzyme, a new multifunctional deoxynucleoside kinase.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Munch-Petersen B., Piskur J., Sondergaard L.", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "reference": [ { "type": "PubMed", "id": "9461577", "url": "https://glygen.org/publication/PubMed/9461577" } ] } ], "pathway": [ { "id": "dme:Dmel_CG5452", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG5452", "resource": "KEGG Pathway" }, { "id": "R-DME-73614", "name": "Pyrimidine salvage", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-73614", "resource": "Reactome", "description": "Pyrimidine salvage" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 9, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" }, { "name": "thymidine kinase activity", "id": "GO:0004797", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004797", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" }, { "name": "deoxyguanosine kinase activity", "id": "GO:0004138", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004138", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" }, { "name": "kinase activity", "id": "GO:0016301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016301", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" }, { "name": "uridine kinase activity", "id": "GO:0004849", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004849", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" }, { "name": "deoxycytidine kinase activity", "id": "GO:0004137", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004137", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" }, { "name": "deoxynucleoside kinase activity", "id": "GO:0019136", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019136", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" }, { "name": "deoxyadenosine kinase activity", "id": "GO:0004136", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004136", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" }, { "name": "cytidine kinase activity", "id": "GO:0043771", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043771", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" }, { "name": "DNA biosynthetic process", "id": "GO:0071897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071897", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" }, { "name": "nucleoside phosphate biosynthetic process", "id": "GO:1901293", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901293", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" }, { "name": "nucleoside salvage", "id": "GO:0043174", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043174", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q9XZT6", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 121, "end_pos": 123, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "12140", "name": "", "equation": "a 2'-deoxyribonucleoside + ATP = a 2'-deoxyribonucleoside 5'-phosphate + ADP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9XZT6-1" ], "evidence": [ { "id": "12140", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/12140" } ] }, { "id": "R-DME-109759", "name": "deoxycytidine, thymidine, or deoxyuridine + ATP => dCMP, TMP, or dUMP + ADP [TK2]", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial matrix", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9XZT6-1" ], "evidence": [ { "id": "R-DME-109759", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-109759" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "Q9XZT6", "gene_name": "dnk", "activity": [ { "ec_number": "2.7.1.21", "activity": "ATP + thymidine = ADP + dTMP + H(+).", "evidence": [ { "id": "Q9XZT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ] }, { "ec_number": "2.7.1.145", "activity": "a 2'-deoxyribonucleoside + ATP = a 2'-deoxyribonucleoside 5'-phosphate + ADP + H(+).", "evidence": [ { "id": "Q9XZT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ] }, { "ec_number": "2.7.1.145", "activity": "", "evidence": [ { "id": "Q9XZT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9XZT6" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }