{ "uniprot_canonical_ac": "Q9WV60-1", "uniprot_ac": "Q9WV60", "uniprot_id": "GSK3B_MOUSE", "mass": { "chemical_mass": 46710.0, "monoisotopic_mass": 46710.0 }, "refseq": { "ac": "NP_001334161", "name": "glycogen synthase kinase-3 beta isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334161" }, "gene_names": [ { "name": "Gsk3b", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9WV60", "id": "Q9WV60" }, { "name": "7330414F15Rik; 8430431H08Rik; GSK-3; GSK-3beta; GSK3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062801", "id": "NP_062801" }, { "name": "Gsk3b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062801", "id": "NP_062801" } ], "protein_names": [ { "name": "Glycogen synthase kinase-3 beta", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9WV60" }, { "name": "2.7.11.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9WV60" }, { "name": "2.7.11.26", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9WV60" }, { "name": "GSK-3 beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9WV60" }, { "name": "Serine/threonine-protein kinase GSK3B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9WV60" }, { "name": "glycogen synthase kinase-3 beta isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062801", "id": "NP_062801" }, { "name": "glycogen synthase kinase-3 beta isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334161", "id": "NP_001334161" }, { "name": "serine/threonine-protein kinase GSK3B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334161", "id": "NP_001334161" } ], "function": [ { "annotation": "Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), EIF2B, CTNNB1/beta-catenin, APC, AXIN1, DPYSL2/CRMP2, JUN, NFATC1/NFATC, MAPT/TAU and MACF1 (PubMed:15791206, PubMed:22057101, PubMed:23395175). Requires primed phosphorylation of the majority of its substrates (PubMed:15791206, PubMed:22057101, PubMed:23395175). In skeletal muscle, contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis (By similarity). May also mediate the development of insulin resistance by regulating activation of transcription factors (By similarity). Regulates protein synthesis by controlling the activity of initiation factor 2B (EIF2BE/EIF2B5) in the same manner as glycogen synthase (By similarity). In Wnt signaling, GSK3B forms a multimeric complex with APC, AXIN1 and CTNNB1/beta-catenin and phosphorylates the N-terminus of CTNNB1 leading to its degradation mediated by ubiquitin/proteasomes (By similarity). Phosphorylates JUN at sites proximal to its DNA-binding domain, thereby reducing its affinity for DNA (By similarity). Phosphorylates NFATC1/NFATC on conserved serine residues promoting NFATC1/NFATC nuclear export, shutting off NFATC1/NFATC gene regulation, and thereby opposing the action of calcineurin (By similarity). Phosphorylates MAPT/TAU on 'Thr-548', decreasing significantly MAPT/TAU ability to bind and stabilize microtubules (By similarity). MAPT/TAU is the principal component of neurofibrillary tangles in Alzheimer disease (By similarity). Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex (By similarity). Phosphorylates MACF1, inhibiting its binding to microtubules which is critical for its role in bulge stem cell migration and skin wound repair (PubMed:21295697). Probably regulates NF-kappa-B (NFKB1) at the transcriptional level and is required for the NF-kappa-B-mediated anti-apoptotic response to TNF-alpha (TNF/TNFA) (PubMed:10894547). Negatively regulates replication in pancreatic beta-cells, resulting in apoptosis, loss of beta-cells and diabetes (PubMed:18288891). Through phosphorylation of the anti-apoptotic protein MCL1, may control cell apoptosis in response to growth factors deprivation (PubMed:16543145). Phosphorylates MUC1 in breast cancer cells, decreasing the interaction of MUC1 with CTNNB1/beta-catenin (By similarity). Is necessary for the establishment of neuronal polarity and axon outgrowth (PubMed:17391670). Phosphorylates MARK2, leading to inhibition of its activity (By similarity). Phosphorylates SIK1 at 'Thr-182', leading to sustainment of its activity (By similarity). Phosphorylates ZC3HAV1 which enhances its antiviral activity (By similarity). Phosphorylates SNAI1, leading to its BTRC-triggered ubiquitination and proteasomal degradation (By similarity). Phosphorylates SFPQ at 'Thr-687' upon T-cell activation (By similarity). Phosphorylates NR1D1 st 'Ser-55' and 'Ser-59' and stabilizes it by protecting it from proteasomal degradation (By similarity). Regulates the circadian clock via phosphorylation of the major clock components including BMAL1, CLOCK and PER2 (PubMed:20049328, PubMed:28556462, PubMed:28903391, PubMed:20123978). Phosphorylates CLOCK AT 'Ser-427' and targets it for proteasomal degradation (By similarity). Phosphorylates BMAL1 at 'Ser-17' and 'Ser-21' and primes it for ubiquitination and proteasomal degradation (PubMed:20049328, PubMed:28903391). Phosphorylates FBXL2 at 'Thr-404' and primes it for ubiquitination by the SCF(FBXO3) complex and proteasomal degradation (PubMed:23542741). Phosphorylates OGT at 'Ser-3' or 'Ser-4' which positively regulates its activity (By similarity). Phosphorylates MYCN in neuroblastoma cells which may promote its degradation (By similarity). Regulates the circadian rhythmicity of hippocampal long-term potentiation and BMAL1 and PER2 expression (PubMed:28556462). Acts as a regulator of autophagy by mediating phosphorylation of KAT5/TIP60 under starvation conditions, activating KAT5/TIP60 acetyltransferase activity and promoting acetylation of key autophagy regulators, such as ULK1 and RUBCNL/Pacer (PubMed:22539723). Negatively regulates extrinsic apoptotic signaling pathway via death domain receptors (By similarity). Promotes the formation of an anti-apoptotic complex, made of DDX3X, BRIC2 and GSK3B, at death receptors, including TNFRSF10B (By similarity). The anti-apoptotic function is most effective with weak apoptotic signals and can be overcome by stronger stimulation (By similarity). Phosphorylates E2F1, promoting the interaction between E2F1 and USP11, stabilizing E2F1 and promoting its activity (By similarity). Phosphorylates FXR1, promoting FXR1 ubiquitination by the SCF(FBXO4) complex and FXR1 degradation by the proteasome (PubMed:26240334, PubMed:29142209).", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60#function" }, { "database": "PubMed", "id": "20049328", "url": "https://glygen.org/publication/PubMed/20049328" }, { "database": "PubMed", "id": "16543145", "url": "https://glygen.org/publication/PubMed/16543145" }, { "database": "PubMed", "id": "10894547", "url": "https://glygen.org/publication/PubMed/10894547" }, { "database": "PubMed", "id": "21295697", "url": "https://glygen.org/publication/PubMed/21295697" }, { "database": "PubMed", "id": "17391670", "url": "https://glygen.org/publication/PubMed/17391670" }, { "database": "UniProtKB", "id": "P49841", "url": "https://www.uniprot.org/uniprot/P49841#function" }, { "database": "PubMed", "id": "23395175", "url": "https://glygen.org/publication/PubMed/23395175" }, { "database": "PubMed", "id": "15791206", "url": "https://glygen.org/publication/PubMed/15791206" }, { "database": "PubMed", "id": "22057101", "url": "https://glygen.org/publication/PubMed/22057101" }, { "database": "PubMed", "id": "18288891", "url": "https://glygen.org/publication/PubMed/18288891" }, { "database": "PubMed", "id": "26240334", "url": "https://glygen.org/publication/PubMed/26240334" }, { "database": "PubMed", "id": "23542741", "url": "https://glygen.org/publication/PubMed/23542741" }, { "database": "PubMed", "id": "29142209", "url": "https://glygen.org/publication/PubMed/29142209" }, { "database": "PubMed", "id": "28556462", "url": "https://glygen.org/publication/PubMed/28556462" }, { "database": "PubMed", "id": "28903391", "url": "https://glygen.org/publication/PubMed/28903391" }, { "database": "PubMed", "id": "22539723", "url": "https://glygen.org/publication/PubMed/22539723" }, { "database": "PubMed", "id": "20123978", "url": "https://glygen.org/publication/PubMed/20123978" }, { "database": "UniProtKB", "id": "P18266", "url": "https://www.uniprot.org/uniprot/P18266#function" } ] }, { "annotation": "Diabetic Endothelial Cell Glycogen Synthase Kinase 3beta Activation Induces VCAM1 Ectodomain Shedding. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_062801", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062801" }, { "database": "PubMed", "id": "37762417", "url": "https://glygen.org/publication/PubMed/37762417" }, { "database": "RefSeq", "id": "NP_001334161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334161" } ] }, { "annotation": "GSK3beta Inhibition Ameliorates Atherosclerotic Calcification. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_062801", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062801" }, { "database": "PubMed", "id": "37511396", "url": "https://glygen.org/publication/PubMed/37511396" }, { "database": "RefSeq", "id": "NP_001334161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334161" } ] }, { "annotation": "Glycogen synthase kinase 3 controls T-cell exhaustion by regulating NFAT activation.", "evidence": [ { "database": "RefSeq", "id": "NP_062801", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062801" }, { "database": "PubMed", "id": "37553428", "url": "https://glygen.org/publication/PubMed/37553428" }, { "database": "RefSeq", "id": "NP_001334161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334161" } ] }, { "annotation": "REDD1-dependent GSK3beta dephosphorylation promotes NF-kappaB activation and macrophage infiltration in the retina of diabetic mice.", "evidence": [ { "database": "RefSeq", "id": "NP_062801", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062801" }, { "database": "PubMed", "id": "37392853", "url": "https://glygen.org/publication/PubMed/37392853" }, { "database": "RefSeq", "id": "NP_001334161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334161" } ] } ], "disease": [ { "disease_id": "DOID:0050850", "recommended_name": { "id": "DOID:0050850", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050850", "name": "diabetic encephalopathy", "description": "A brain disease that is characterized by functional impairment of cognition, cerebral signal conduction, neurotransmission and synaptic plasticity, and underlying structural pathology associated with diabetes." }, "synonyms": [], "evidence": [ { "id": "0050850", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050850" } ] }, { "disease_id": "DOID:0050861", "recommended_name": { "id": "DOID:0050861", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050861", "name": "colorectal adenocarcinoma", "description": "A colorectal carcinoma that derives_from epithelial cells of glandular origin." }, "synonyms": [], "evidence": [ { "id": "0050861", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050861" } ] }, { "disease_id": "DOID:0050866", "recommended_name": { "id": "DOID:0050866", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050866", "name": "oral squamous cell carcinoma", "description": "An oral cavity cancer that has_material_basis_in squamous cells." }, "synonyms": [ { "id": "DOID:0050866", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050866", "name": "mouth squamous cell carcinoma", "description": "" } ], "evidence": [ { "id": "0050866", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050866" } ] }, { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:114", "recommended_name": { "id": "DOID:114", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:114", "name": "heart disease", "description": "A cardiovascular system disease that involves the heart." }, "synonyms": [], "evidence": [ { "id": "114", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:114" } ] }, { "disease_id": "DOID:11446", "recommended_name": { "id": "DOID:11446", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11446", "name": "sciatic neuropathy", "description": "" }, "synonyms": [], "evidence": [ { "id": "11446", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11446" } ] }, { "disease_id": "DOID:14330", "recommended_name": { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson's disease", "description": "A synucleinopathy that has_material_basis_in degeneration of the central nervous system that often impairs motor skills, speech, and other functions." }, "synonyms": [ { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson disease", "description": "" }, { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "paralysis agitans", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "A Parkinson disease that begins after around the age of 50." }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "LOPD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PARK", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, age of onset, modifier, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "autosomal dominant late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson's disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "" }, { "id": "MIM:168600", "resource": "MIM", "url": "https://www.omim.org/entry/168600", "name": "Parkinson disease", "description": "Parkinson disease" } ], "evidence": [ { "id": "14330", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:14330" } ] }, { "disease_id": "DOID:1596", "recommended_name": { "id": "DOID:1596", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1596", "name": "depressive disorder", "description": "A mood disorder characterized by persistent sadness, emptiness, or irritability and decreased ability to function." }, "synonyms": [ { "id": "DOID:1596", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1596", "name": "mental depression", "description": "" } ], "evidence": [ { "id": "1596", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1596" } ] }, { "disease_id": "DOID:1824", "recommended_name": { "id": "DOID:1824", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1824", "name": "status epilepticus", "description": "" }, "synonyms": [ { "id": "DOID:1824", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1824", "name": "Grand mal status", "description": "" } ], "evidence": [ { "id": "1824", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1824" } ] }, { "disease_id": "DOID:219", "recommended_name": { "id": "DOID:219", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:219", "name": "colon cancer", "description": "A colorectal cancer that is located_in the colon." }, "synonyms": [], "evidence": [ { "id": "219", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:219" } ] }, { "disease_id": "DOID:2871", "recommended_name": { "id": "DOID:2871", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2871", "name": "endometrial carcinoma", "description": "A endometrial cancer that is located_in the tissue lining the uterus." }, "synonyms": [ { "id": "DOID:2871", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2871", "name": "endometrioid carcinoma of female Reproductive system", "description": "" }, { "id": "DOID:2871", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2871", "name": "carcinoma of the Endometrium", "description": "" }, { "id": "DOID:2871", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2871", "name": "endometrioid carcinoma", "description": "" } ], "evidence": [ { "id": "2871", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2871" } ] }, { "disease_id": "DOID:303", "recommended_name": { "id": "DOID:303", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:303", "name": "substance-related disorder", "description": "A disease of mental health involving the abuse or dependence on a substance that is ingested in order to produce a high, alter one's senses, or otherwise affect functioning." }, "synonyms": [], "evidence": [ { "id": "303", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:303" } ] }, { "disease_id": "DOID:3312", "recommended_name": { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "bipolar disorder", "description": "A mood disorder that involves alternating periods of mania and depression." }, "synonyms": [ { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "Manic Bipolar Affective disorder", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "Manic Depressive disorder", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "Manic bipolar I disorder", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "bipolar depression", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "bipolar disorder manic phase", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "manic depression", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "manic disorder", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "mixed bipolar disorder", "description": "" } ], "evidence": [ { "id": "3312", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3312" } ] }, { "disease_id": "DOID:332", "recommended_name": { "id": "DOID:332", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:332", "name": "amyotrophic lateral sclerosis", "description": "A motor neuron disease that is characterized by muscle spasticity, rapidly progressive weakness due to muscle atrophy, difficulty in speaking, swallowing, and breathing." }, "synonyms": [ { "id": "DOID:332", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:332", "name": "ALS", "description": "" }, { "id": "DOID:332", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:332", "name": "Lou Gehrig's disease", "description": "" }, { "id": "DOID:332", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:332", "name": "motor neuron disease, bulbar", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis type 1", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "ALS1", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis 1", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis type 1", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "FALS", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis 1, autosomal dominant", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis 1, autosomal dominant amyotrophic lateral sclerosis 1, autosomal recessive, included", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis 1, autosomal recessive", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis 1, familial", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis, autosomal dominant", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis, familial", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis, sporadic", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis, sporadic, included", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis, susceptibility to", "description": "" }, { "id": "MIM:105400", "resource": "MIM", "url": "https://www.omim.org/entry/105400", "name": "Amyotrophic lateral sclerosis 1", "description": "Amyotrophic lateral sclerosis 1" } ], "evidence": [ { "id": "332", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:332" } ] }, { "disease_id": "DOID:3525", "recommended_name": { "id": "DOID:3525", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3525", "name": "middle cerebral artery infarction", "description": "" }, "synonyms": [], "evidence": [ { "id": "3525", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3525" } ] }, { "disease_id": "DOID:5419", "recommended_name": { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia", "description": "A psychotic disorder that is characterized by a disintegration of thought processes and of emotional responsiveness." }, "synonyms": [ { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "A major psychotic disorder characterized by abnormalities in the perception or expression of reality. It affects the cognitive and psychomotor functions. Common clinical signs and symptoms include delusions, hallucinations, disorganized thinking, and retreat from reality." }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia 12", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia (disease)", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "SCZD", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizoaffective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia with or without an affective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia, susceptibility to", "description": "" }, { "id": "MIM:181500", "resource": "MIM", "url": "https://www.omim.org/entry/181500", "name": "Schizophrenia", "description": "Schizophrenia" } ], "evidence": [ { "id": "5419", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5419" } ] }, { "disease_id": "DOID:5844", "recommended_name": { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "myocardial infarction", "description": "A coronary artery disease characterized by myocardial cell death (myocardial necrosis) due to prolonged ischaemia." }, "synonyms": [ { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "Myocardial infarct", "description": "" }, { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "heart attack", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, type 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "Mci2", "description": "" } ], "evidence": [ { "id": "5844", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5844" } ] }, { "disease_id": "DOID:8725", "recommended_name": { "id": "DOID:8725", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8725", "name": "vascular dementia", "description": "A dementia that involves impairments in cognitive function caused by problems in blood vessels that feed the brain." }, "synonyms": [ { "id": "DOID:8725", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8725", "name": "Multi Infarct Dementia", "description": "" }, { "id": "DOID:8725", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8725", "name": "multifocal dementia", "description": "" } ], "evidence": [ { "id": "8725", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8725" } ] }, { "disease_id": "DOID:90", "recommended_name": { "id": "DOID:90", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:90", "name": "degenerative disc disease", "description": "A bone deterioration disease that has_material_basis_in gradual dehydration and tears located_in intervertebral disc." }, "synonyms": [ { "id": "DOID:90", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:90", "name": "cervical disc degenerative disease", "description": "" }, { "id": "DOID:90", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:90", "name": "intervertebral disc degeneration", "description": "" }, { "id": "DOID:90", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:90", "name": "lumbar disc degeneration", "description": "" }, { "id": "DOID:90", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:90", "name": "vertebral disc disease", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "intervertebral disk degenerative disorder", "description": "Any disease of a degenerative nature that affects the intervertebral disk." }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "IDD", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "degenerative disc disease", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "degenerative disk disease", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "degenerative disorder of intervertebral disc", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "degenerative disorder of intervertebral disk", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "intervertebral Disc Degeneration", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "intervertebral Disc degenerative disease", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "intervertebral Disc degenerative disorder", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "intervertebral disc degeneration", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "intervertebral disc disease", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "intervertebral disk degeneration", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "intervertebral disk degenerative disorder", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "intervertebral disk disease", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "vertebral Disc degenerative disease", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "vertebral Disc degenerative disorder", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "vertebral disc disease", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "vertebral disk disease", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "cervical disc degenerative disease", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "cervical disk degenerative disease", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "lumbar disc degeneration", "description": "" }, { "id": "MONDO:0011385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011385", "name": "lumbar disk degeneration", "description": "" }, { "id": "MIM:603932", "resource": "MIM", "url": "https://www.omim.org/entry/603932", "name": "Intervertebral disc disease", "description": "Intervertebral disc disease" } ], "evidence": [ { "id": "90", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:90" } ] }, { "disease_id": "DOID:9352", "recommended_name": { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes mellitus", "description": "A diabetes mellitus that is characterized by high blood sugar, insulin resistance, and relative lack of insulin." }, "synonyms": [ { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "NIDDM", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type II diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "insulin resistance", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, type 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "Niddm4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "noninsulin-dependent diabetes mellitus 4", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "A type of diabetes mellitus that is characterized by insulin resistance or desensitization and increased blood glucose levels. This is a chronic disease that can develop gradually over the life of a patient and can be linked to both environmental factors and heredity." }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "NIDDM", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "T2DM - type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, association with", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, late onset", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, severe, digenic", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus non-insulin dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, non-insulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, protection against", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "hypertension, insulin resistance-related, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "maturity-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus, susceptibility to", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, type 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "NIDDM1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "noninsulin-dependent diabetes mellitus 1", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "NIDDM2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "noninsulin-dependent diabetes mellitus 2", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, type 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "type 2 diabetes mellitus 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "NIDDM3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "noninsulin-dependent diabetes mellitus 3", "description": "" }, { "id": "MIM:125853", "resource": "MIM", "url": "https://www.omim.org/entry/125853", "name": "Type 2 diabetes mellitus", "description": "Type 2 diabetes mellitus" }, { "id": "MIM:601283", "resource": "MIM", "url": "https://www.omim.org/entry/601283", "name": "Type 2 diabetes mellitus 1", "description": "Type 2 diabetes mellitus 1" } ], "evidence": [ { "id": "9352", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9352" } ] }, { "disease_id": "DOID:9408", "recommended_name": { "id": "DOID:9408", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9408", "name": "acute myocardial infarction", "description": "" }, "synonyms": [], "evidence": [ { "id": "9408", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9408" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 85, "end_pos": 85, "sequence_org": "K", "sequence_mut": "R", "comment": "Inhibits interaction with AXIN1 and ZBED3.", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" }, { "database": "PubMed", "id": "19141611", "url": "https://glygen.org/publication/PubMed/19141611" } ] }, { "start_pos": 9, "end_pos": 9, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of phosphorylation; No inhibition of activity and constitutively active.", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" }, { "database": "PubMed", "id": "15791206", "url": "https://glygen.org/publication/PubMed/15791206" }, { "database": "PubMed", "id": "22057101", "url": "https://glygen.org/publication/PubMed/22057101" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gsk3b", "url": "https://www.uniprot.org/uniprot/Q9WV60", "locus": { "chromosome": "16", "start_pos": 38066446, "end_pos": 37909363, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000022812", "url": "https://www.ensembl.org/id/ENSMUSG00000022812" } ] } } ], "crossref": [ { "id": "ENSMUSG00000022812", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000022812", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.7.11.26", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.11.26&UniProtAcc=Q9WV60", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd14137", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14137", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1075321", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1075321", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "56637", "url": "https://www.ncbi.nlm.nih.gov/gene/56637", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "E9QAQ5", "url": "https://www.ebi.ac.uk/intact/interactors/id:E9QAQ5*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "Q9WV60", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9WV60*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000719", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000719", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008271", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008271", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011009", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011009", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017441", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017441", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039192", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039192", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:56637", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56637", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1861437", "url": "http://www.informatics.jax.org/marker/MGI:1861437", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q9WV60", "url": "https://oglcnac.org/atlas/detail/Q9WV60", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "Q9WV60", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9WV60", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "REMQYTQ", "url": "https://omabrowser.org/oma/group/REMQYTQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2872909at2759", "url": "http://www.orthodb.org/?query=2872909at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24057", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24057", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24057:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24057:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4NU1", "url": "https://www.rcsb.org/structure/4NU1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AIR", "url": "https://www.rcsb.org/structure/5AIR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AE3", "url": "https://www.rcsb.org/structure/6AE3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00069", "url": "http://pfam.xfam.org/family/PF00069", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9WV60", "url": "http://purl.obolibrary.org/obo/PR_Q9WV60", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-195253", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-196299", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-196299", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3371453", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-399956", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-399956", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-4641262", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5250924", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5610785", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5610785", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9762114", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9762114", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_062801", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062801", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "12801", "url": "https://www.rhea-db.org/rhea/12801", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "17989", "url": "https://www.rhea-db.org/rhea/17989", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46608", "url": "https://www.rhea-db.org/rhea/46608", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "53904", "url": "https://www.rhea-db.org/rhea/53904", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A338P6P8", "url": "https://www.uniprot.org/uniprot/A0A338P6P8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A338P6P8-1", "url": "https://www.uniprot.org/uniprot/A0A338P6P8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9QAQ5", "url": "https://www.uniprot.org/uniprot/E9QAQ5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9QAQ5-1", "url": "https://www.uniprot.org/uniprot/E9QAQ5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9WV60-1", "url": "https://www.uniprot.org/uniprot/Q9WV60-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST", "length": 420, "header": "sp|Q9WV60-1|GSK3B_MOUSE Isoform 1 of Glycogen synthase kinase-3 beta OS=Mus musculus OX=10090 GN=Gsk3b PE=1 SV=2 CANONICAL=Q9WV60-1" }, "isoforms": [ { "isoform_ac": "A0A338P6P8-1", "url": "", "sequence": { "sequence": "XNYTEFKFPQIKAHPWTKILMLETVDRPITPLLHQLPTPPEQPPGASCAGKTSTYLSATQQHWSRLERKLKRGKQKQKQKNPVHFSVQFFLLLFLFNLVKYLYKYKPVSLYSHFSGDPRGGEGWAGRSRALNTISPTTIFSFLFKVRSPLLYTLKTRLLPHAPTATEENLFCAGLFSGFVFF", "length": 182, "header": "tr|A0A338P6P8-1|A0A338P6P8_MOUSE Computationally mapped isoform of Glycogen synthase kinase 3 beta OS=Mus musculus OX=10090 GN=Gsk3b PE=4 SV=1 CANONICAL=Q9WV60-1" }, "locus": { "chromosome": "16", "start_pos": 38061356, "end_pos": 38028400, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000231437.2", "url": "https://www.ensembl.org/id/ENSMUST00000231437.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000156065.2", "url": "https://www.ensembl.org/id/ENSMUSP00000156065.2" } ] } }, { "isoform_ac": "E9QAQ5-1", "url": "", "sequence": { "sequence": "MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKDSPGAGHFTPGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST", "length": 433, "header": "tr|E9QAQ5-1|E9QAQ5_MOUSE Computationally mapped isoform of [tau protein] kinase OS=Mus musculus OX=10090 GN=Gsk3b PE=1 SV=1 CANONICAL=Q9WV60-1" }, "locus": { "chromosome": "16", "start_pos": 38060928, "end_pos": 37910888, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000114750.2", "url": "https://www.ensembl.org/id/ENSMUST00000114750.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000110398.2", "url": "https://www.ensembl.org/id/ENSMUSP00000110398.2" } ] } }, { "isoform_ac": "Q9WV60-1", "url": "", "sequence": { "sequence": "MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST", "length": 420, "header": "sp|Q9WV60-1|GSK3B_MOUSE Isoform 1 of Glycogen synthase kinase-3 beta OS=Mus musculus OX=10090 GN=Gsk3b PE=1 SV=2 CANONICAL=Q9WV60-1" }, "locus": { "chromosome": "16", "start_pos": 38060928, "end_pos": 37910888, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000023507", "url": "https://www.ensembl.org/id/ENSMUST00000023507" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000023507", "url": "https://www.ensembl.org/id/ENSMUSP00000023507" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 395, "start_aa": "Thr", "end_pos": 395, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr395", "evidence": [ { "id": "Q9WV60", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9WV60" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 417, "start_aa": "Ser", "end_pos": 417, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser417", "evidence": [ { "id": "Q9WV60", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9WV60" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 9, "start_aa": "Ser", "end_pos": 9, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser9", "evidence": [ { "id": "Q9WV60", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9WV60" }, { "id": "33300544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33300544" }, { "id": "31409917", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31409917" }, { "id": "37033243", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37033243" }, { "id": "11959983", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11959983" }, { "id": "22645316", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22645316" }, { "id": "14749383", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14749383" } ] } ], "phosphorylation": [ { "start_pos": 215, "end_pos": 215, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q9WV60", "url": "http://phospho.elm.eu.org/byAccession/Q9WV60.html" }, { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" }, { "database": "PubMed", "id": "17114649", "url": "https://glygen.org/publication/PubMed/17114649" } ], "site_lbl": "Ser215" }, { "start_pos": 216, "end_pos": 216, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" }, { "database": "phospho.ELM", "id": "Q9WV60", "url": "http://phospho.elm.eu.org/byAccession/Q9WV60.html" }, { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" }, { "database": "PubMed", "id": "17114649", "url": "https://glygen.org/publication/PubMed/17114649" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" }, { "database": "PubMed", "id": "16855914", "url": "https://glygen.org/publication/PubMed/16855914" }, { "database": "PubMed", "id": "19818092", "url": "https://glygen.org/publication/PubMed/19818092" }, { "database": "PubMed", "id": "20354135", "url": "https://glygen.org/publication/PubMed/20354135" }, { "database": "PubMed", "id": "21671257", "url": "https://glygen.org/publication/PubMed/21671257" }, { "database": "PubMed", "id": "21998135", "url": "https://glygen.org/publication/PubMed/21998135" }, { "database": "PubMed", "id": "22422579", "url": "https://glygen.org/publication/PubMed/22422579" }, { "database": "PubMed", "id": "23628704", "url": "https://glygen.org/publication/PubMed/23628704" }, { "database": "PubMed", "id": "24519956", "url": "https://glygen.org/publication/PubMed/24519956" }, { "database": "PubMed", "id": "26274564", "url": "https://glygen.org/publication/PubMed/26274564" }, { "database": "PubMed", "id": "27287266", "url": "https://glygen.org/publication/PubMed/27287266" }, { "database": "PubMed", "id": "28819213", "url": "https://glygen.org/publication/PubMed/28819213" }, { "database": "PubMed", "id": "29073967", "url": "https://glygen.org/publication/PubMed/29073967" }, { "database": "PubMed", "id": "29670081", "url": "https://glygen.org/publication/PubMed/29670081" }, { "database": "PubMed", "id": "30768733", "url": "https://glygen.org/publication/PubMed/30768733" } ], "site_lbl": "Tyr216" }, { "start_pos": 219, "end_pos": 219, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q9WV60", "url": "http://phospho.elm.eu.org/byAccession/Q9WV60.html" }, { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ], "site_lbl": "Ser219" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q9WV60", "url": "http://phospho.elm.eu.org/byAccession/Q9WV60.html" }, { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" }, { "database": "PubMed", "id": "15710331", "url": "https://glygen.org/publication/PubMed/15710331" }, { "database": "PubMed", "id": "15659239", "url": "https://glygen.org/publication/PubMed/15659239" }, { "database": "PubMed", "id": "16501492", "url": "https://glygen.org/publication/PubMed/16501492" }, { "database": "PubMed", "id": "16941690", "url": "https://glygen.org/publication/PubMed/16941690" }, { "database": "PubMed", "id": "16954147", "url": "https://glygen.org/publication/PubMed/16954147" }, { "database": "PubMed", "id": "19328817", "url": "https://glygen.org/publication/PubMed/19328817" }, { "database": "PubMed", "id": "19939226", "url": "https://glygen.org/publication/PubMed/19939226" }, { "database": "PubMed", "id": "20300527", "url": "https://glygen.org/publication/PubMed/20300527" }, { "database": "PubMed", "id": "22022450", "url": "https://glygen.org/publication/PubMed/22022450" }, { "database": "PubMed", "id": "22238573", "url": "https://glygen.org/publication/PubMed/22238573" }, { "database": "PubMed", "id": "22434044", "url": "https://glygen.org/publication/PubMed/22434044" }, { "database": "PubMed", "id": "23239877", "url": "https://glygen.org/publication/PubMed/23239877" }, { "database": "PubMed", "id": "25073924", "url": "https://glygen.org/publication/PubMed/25073924" }, { "database": "PubMed", "id": "31707362", "url": "https://glygen.org/publication/PubMed/31707362" }, { "database": "PubMed", "id": "31900153", "url": "https://glygen.org/publication/PubMed/31900153" } ], "site_lbl": "Ser21" }, { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" }, { "database": "PubMed", "id": "25477508", "url": "https://glygen.org/publication/PubMed/25477508" } ], "site_lbl": "Thr356" }, { "start_pos": 389, "end_pos": 389, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" }, { "database": "PubMed", "id": "15345747", "url": "https://glygen.org/publication/PubMed/15345747" }, { "database": "phospho.ELM", "id": "Q9WV60", "url": "http://phospho.elm.eu.org/byAccession/Q9WV60.html" }, { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" }, { "database": "PubMed", "id": "17114649", "url": "https://glygen.org/publication/PubMed/17114649" }, { "database": "PubMed", "id": "26822034", "url": "https://glygen.org/publication/PubMed/26822034" }, { "database": "PubMed", "id": "28832021", "url": "https://glygen.org/publication/PubMed/28832021" } ], "site_lbl": "Ser389" }, { "start_pos": 395, "end_pos": 395, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q9WV60", "url": "http://phospho.elm.eu.org/byAccession/Q9WV60.html" }, { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" }, { "database": "PubMed", "id": "17114649", "url": "https://glygen.org/publication/PubMed/17114649" } ], "site_lbl": "Thr395" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q9WV60", "url": "http://phospho.elm.eu.org/byAccession/Q9WV60.html" }, { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ], "site_lbl": "Thr7" }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "P63085-1", "kinase_gene_name": "Mapk1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" }, { "database": "PubMed", "id": "28646232", "url": "https://glygen.org/publication/PubMed/28646232" } ], "site_lbl": "Ser9" }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "Q63844-1", "kinase_gene_name": "Mapk3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" }, { "database": "PubMed", "id": "28646232", "url": "https://glygen.org/publication/PubMed/28646232" } ], "site_lbl": "Ser9" }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKB/AKT1, RPS6KA3 and SGK3", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" }, { "database": "phospho.ELM", "id": "Q9WV60", "url": "http://phospho.elm.eu.org/byAccession/Q9WV60.html" }, { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" }, { "database": "PubMed", "id": "15845746", "url": "https://glygen.org/publication/PubMed/15845746" }, { "database": "PubMed", "id": "16522636", "url": "https://glygen.org/publication/PubMed/16522636" }, { "database": "PubMed", "id": "17052453", "url": "https://glygen.org/publication/PubMed/17052453" }, { "database": "PubMed", "id": "17141160", "url": "https://glygen.org/publication/PubMed/17141160" }, { "database": "PubMed", "id": "11035810", "url": "https://glygen.org/publication/PubMed/11035810" }, { "database": "PRO", "id": "Q9WV60", "url": "http://purl.obolibrary.org/obo/Q9WV60" }, { "database": "PubMed", "id": "26582204", "url": "https://glygen.org/publication/PubMed/26582204" }, { "database": "PubMed", "id": "12095987", "url": "https://glygen.org/publication/PubMed/12095987" }, { "database": "PubMed", "id": "12489109", "url": "https://glygen.org/publication/PubMed/12489109" }, { "database": "PubMed", "id": "12504922", "url": "https://glygen.org/publication/PubMed/12504922" }, { "database": "PubMed", "id": "14745448", "url": "https://glygen.org/publication/PubMed/14745448" }, { "database": "PubMed", "id": "15039769", "url": "https://glygen.org/publication/PubMed/15039769" }, { "database": "PubMed", "id": "15659239", "url": "https://glygen.org/publication/PubMed/15659239" }, { "database": "PubMed", "id": "15791206", "url": "https://glygen.org/publication/PubMed/15791206" }, { "database": "PubMed", "id": "15878878", "url": "https://glygen.org/publication/PubMed/15878878" }, { "database": "PubMed", "id": "15888552", "url": "https://glygen.org/publication/PubMed/15888552" }, { "database": "PubMed", "id": "15961082", "url": "https://glygen.org/publication/PubMed/15961082" }, { "database": "PubMed", "id": "15980066", "url": "https://glygen.org/publication/PubMed/15980066" }, { "database": "PubMed", "id": "16039605", "url": "https://glygen.org/publication/PubMed/16039605" }, { "database": "PubMed", "id": "16374520", "url": "https://glygen.org/publication/PubMed/16374520" }, { "database": "PubMed", "id": "16434614", "url": "https://glygen.org/publication/PubMed/16434614" }, { "database": "PubMed", "id": "16489037", "url": "https://glygen.org/publication/PubMed/16489037" }, { "database": "PubMed", "id": "16501492", "url": "https://glygen.org/publication/PubMed/16501492" }, { "database": "PubMed", "id": "16510873", "url": "https://glygen.org/publication/PubMed/16510873" }, { "database": "PubMed", "id": "16530186", "url": "https://glygen.org/publication/PubMed/16530186" }, { "database": "PubMed", "id": "16565488", "url": "https://glygen.org/publication/PubMed/16565488" }, { "database": "PubMed", "id": "16762022", "url": "https://glygen.org/publication/PubMed/16762022" }, { "database": "PubMed", "id": "16941690", "url": "https://glygen.org/publication/PubMed/16941690" }, { "database": "PubMed", "id": "16954147", "url": "https://glygen.org/publication/PubMed/16954147" }, { "database": "PubMed", "id": "16987252", "url": "https://glygen.org/publication/PubMed/16987252" }, { "database": "PubMed", "id": "17053159", "url": "https://glygen.org/publication/PubMed/17053159" }, { "database": "PubMed", "id": "17241269", "url": "https://glygen.org/publication/PubMed/17241269" }, { "database": "PubMed", "id": "17475833", "url": "https://glygen.org/publication/PubMed/17475833" }, { "database": "PubMed", "id": "17560576", "url": "https://glygen.org/publication/PubMed/17560576" }, { "database": "PubMed", "id": "17714451", "url": "https://glygen.org/publication/PubMed/17714451" }, { "database": "PubMed", "id": "17975737", "url": "https://glygen.org/publication/PubMed/17975737" }, { "database": "PubMed", "id": "18322105", "url": "https://glygen.org/publication/PubMed/18322105" }, { "database": "PubMed", "id": "18701453", "url": "https://glygen.org/publication/PubMed/18701453" }, { "database": "PubMed", "id": "18801732", "url": "https://glygen.org/publication/PubMed/18801732" }, { "database": "PubMed", "id": "18824542", "url": "https://glygen.org/publication/PubMed/18824542" }, { "database": "PubMed", "id": "19011050", "url": "https://glygen.org/publication/PubMed/19011050" }, { "database": "PubMed", "id": "19070648", "url": "https://glygen.org/publication/PubMed/19070648" }, { "database": "PubMed", "id": "19106302", "url": "https://glygen.org/publication/PubMed/19106302" }, { "database": "PubMed", "id": "19126599", "url": "https://glygen.org/publication/PubMed/19126599" }, { "database": "PubMed", "id": "19328817", "url": "https://glygen.org/publication/PubMed/19328817" }, { "database": "PubMed", "id": "19356803", "url": "https://glygen.org/publication/PubMed/19356803" }, { "database": "PubMed", "id": "19379814", "url": "https://glygen.org/publication/PubMed/19379814" }, { "database": "PubMed", "id": "19818092", "url": "https://glygen.org/publication/PubMed/19818092" }, { "database": "PubMed", "id": "19939226", "url": "https://glygen.org/publication/PubMed/19939226" }, { "database": "PubMed", "id": "20111716", "url": "https://glygen.org/publication/PubMed/20111716" }, { "database": "PubMed", "id": "20332342", "url": "https://glygen.org/publication/PubMed/20332342" }, { "database": "PubMed", "id": "20592205", "url": "https://glygen.org/publication/PubMed/20592205" }, { "database": "PubMed", "id": "20690801", "url": "https://glygen.org/publication/PubMed/20690801" }, { "database": "PubMed", "id": "21079728", "url": "https://glygen.org/publication/PubMed/21079728" }, { "database": "PubMed", "id": "21540081", "url": "https://glygen.org/publication/PubMed/21540081" }, { "database": "PubMed", "id": "21544852", "url": "https://glygen.org/publication/PubMed/21544852" }, { "database": "PubMed", "id": "21659643", "url": "https://glygen.org/publication/PubMed/21659643" }, { "database": "PubMed", "id": "21671257", "url": "https://glygen.org/publication/PubMed/21671257" }, { "database": "PubMed", "id": "21821713", "url": "https://glygen.org/publication/PubMed/21821713" }, { "database": "PubMed", "id": "21998135", "url": "https://glygen.org/publication/PubMed/21998135" }, { "database": "PubMed", "id": "22019984", "url": "https://glygen.org/publication/PubMed/22019984" }, { "database": "PubMed", "id": "22022450", "url": "https://glygen.org/publication/PubMed/22022450" }, { "database": "PubMed", "id": "22064483", "url": "https://glygen.org/publication/PubMed/22064483" }, { "database": "PubMed", "id": "22238573", "url": "https://glygen.org/publication/PubMed/22238573" }, { "database": "PubMed", "id": "22434044", "url": "https://glygen.org/publication/PubMed/22434044" }, { "database": "PubMed", "id": "22471389", "url": "https://glygen.org/publication/PubMed/22471389" }, { "database": "PubMed", "id": "22672822", "url": "https://glygen.org/publication/PubMed/22672822" }, { "database": "PubMed", "id": "22714712", "url": "https://glygen.org/publication/PubMed/22714712" }, { "database": "PubMed", "id": "23051669", "url": "https://glygen.org/publication/PubMed/23051669" }, { "database": "PubMed", "id": "23239877", "url": "https://glygen.org/publication/PubMed/23239877" }, { "database": "PubMed", "id": "23301857", "url": "https://glygen.org/publication/PubMed/23301857" }, { "database": "PubMed", "id": "23324178", "url": "https://glygen.org/publication/PubMed/23324178" }, { "database": "PubMed", "id": "23369342", "url": "https://glygen.org/publication/PubMed/23369342" }, { "database": "PubMed", "id": "23444402", "url": "https://glygen.org/publication/PubMed/23444402" }, { "database": "PubMed", "id": "23455548", "url": "https://glygen.org/publication/PubMed/23455548" }, { "database": "PubMed", "id": "23807397", "url": "https://glygen.org/publication/PubMed/23807397" }, { "database": "PubMed", "id": "23816813", "url": "https://glygen.org/publication/PubMed/23816813" }, { "database": "PubMed", "id": "23853095", "url": "https://glygen.org/publication/PubMed/23853095" }, { "database": "PubMed", "id": "24025512", "url": "https://glygen.org/publication/PubMed/24025512" }, { "database": "PubMed", "id": "24227739", "url": "https://glygen.org/publication/PubMed/24227739" }, { "database": "PubMed", "id": "24278135", "url": "https://glygen.org/publication/PubMed/24278135" }, { "database": "PubMed", "id": "24462873", "url": "https://glygen.org/publication/PubMed/24462873" }, { "database": "PubMed", "id": "24670930", "url": "https://glygen.org/publication/PubMed/24670930" }, { "database": "PubMed", "id": "24675832", "url": "https://glygen.org/publication/PubMed/24675832" }, { "database": "PubMed", "id": "24788685", "url": "https://glygen.org/publication/PubMed/24788685" }, { "database": "PubMed", "id": "24969778", "url": "https://glygen.org/publication/PubMed/24969778" }, { "database": "PubMed", "id": "24983010", "url": "https://glygen.org/publication/PubMed/24983010" }, { "database": "PubMed", "id": "24987368", "url": "https://glygen.org/publication/PubMed/24987368" }, { "database": "PubMed", "id": "25029272", "url": "https://glygen.org/publication/PubMed/25029272" }, { "database": "PubMed", "id": "25073924", "url": "https://glygen.org/publication/PubMed/25073924" }, { "database": "PubMed", "id": "25107557", "url": "https://glygen.org/publication/PubMed/25107557" }, { "database": "PubMed", "id": "25172181", "url": "https://glygen.org/publication/PubMed/25172181" }, { "database": "PubMed", "id": "25355398", "url": "https://glygen.org/publication/PubMed/25355398" }, { "database": "PubMed", "id": "25972359", "url": "https://glygen.org/publication/PubMed/25972359" }, { "database": "PubMed", "id": "26342176", "url": "https://glygen.org/publication/PubMed/26342176" }, { "database": "PubMed", "id": "26750157", "url": "https://glygen.org/publication/PubMed/26750157" }, { "database": "PubMed", "id": "26854125", "url": "https://glygen.org/publication/PubMed/26854125" }, { "database": "PubMed", "id": "26872261", "url": "https://glygen.org/publication/PubMed/26872261" }, { "database": "PubMed", "id": "26883430", "url": "https://glygen.org/publication/PubMed/26883430" }, { "database": "PubMed", "id": "26950856", "url": "https://glygen.org/publication/PubMed/26950856" }, { "database": "PubMed", "id": "27000529", "url": "https://glygen.org/publication/PubMed/27000529" }, { "database": "PubMed", "id": "27074656", "url": "https://glygen.org/publication/PubMed/27074656" }, { "database": "PubMed", "id": "27497480", "url": "https://glygen.org/publication/PubMed/27497480" }, { "database": "PubMed", "id": "27568038", "url": "https://glygen.org/publication/PubMed/27568038" }, { "database": "PubMed", "id": "27688851", "url": "https://glygen.org/publication/PubMed/27688851" }, { "database": "PubMed", "id": "27778132", "url": "https://glygen.org/publication/PubMed/27778132" }, { "database": "PubMed", "id": "28005221", "url": "https://glygen.org/publication/PubMed/28005221" }, { "database": "PubMed", "id": "28114284", "url": "https://glygen.org/publication/PubMed/28114284" }, { "database": "PubMed", "id": "28146408", "url": "https://glygen.org/publication/PubMed/28146408" }, { "database": "PubMed", "id": "28228716", "url": "https://glygen.org/publication/PubMed/28228716" }, { "database": "PubMed", "id": "28591721", "url": "https://glygen.org/publication/PubMed/28591721" }, { "database": "PubMed", "id": "28764929", "url": "https://glygen.org/publication/PubMed/28764929" }, { "database": "PubMed", "id": "28832021", "url": "https://glygen.org/publication/PubMed/28832021" }, { "database": "PubMed", "id": "28865114", "url": "https://glygen.org/publication/PubMed/28865114" }, { "database": "PubMed", "id": "28967903", "url": "https://glygen.org/publication/PubMed/28967903" }, { "database": "PubMed", "id": "29058041", "url": "https://glygen.org/publication/PubMed/29058041" }, { "database": "PubMed", "id": "29127434", "url": "https://glygen.org/publication/PubMed/29127434" }, { "database": "PubMed", "id": "29331582", "url": "https://glygen.org/publication/PubMed/29331582" }, { "database": "PubMed", "id": "29346315", "url": "https://glygen.org/publication/PubMed/29346315" }, { "database": "PubMed", "id": "29434807", "url": "https://glygen.org/publication/PubMed/29434807" }, { "database": "PubMed", "id": "29452207", "url": "https://glygen.org/publication/PubMed/29452207" }, { "database": "PubMed", "id": "29504933", "url": "https://glygen.org/publication/PubMed/29504933" }, { "database": "PubMed", "id": "29670081", "url": "https://glygen.org/publication/PubMed/29670081" }, { "database": "PubMed", "id": "29753049", "url": "https://glygen.org/publication/PubMed/29753049" }, { "database": "PubMed", "id": "29951166", "url": "https://glygen.org/publication/PubMed/29951166" }, { "database": "PubMed", "id": "30021941", "url": "https://glygen.org/publication/PubMed/30021941" }, { "database": "PubMed", "id": "30075764", "url": "https://glygen.org/publication/PubMed/30075764" }, { "database": "PubMed", "id": "30252210", "url": "https://glygen.org/publication/PubMed/30252210" }, { "database": "PubMed", "id": "30381076", "url": "https://glygen.org/publication/PubMed/30381076" }, { "database": "PubMed", "id": "30954605", "url": "https://glygen.org/publication/PubMed/30954605" }, { "database": "PubMed", "id": "31102751", "url": "https://glygen.org/publication/PubMed/31102751" }, { "database": "PubMed", "id": "31119045", "url": "https://glygen.org/publication/PubMed/31119045" }, { "database": "PubMed", "id": "31155593", "url": "https://glygen.org/publication/PubMed/31155593" }, { "database": "PubMed", "id": "31222110", "url": "https://glygen.org/publication/PubMed/31222110" }, { "database": "PubMed", "id": "31232699", "url": "https://glygen.org/publication/PubMed/31232699" }, { "database": "PubMed", "id": "31233346", "url": "https://glygen.org/publication/PubMed/31233346" }, { "database": "PubMed", "id": "31672472", "url": "https://glygen.org/publication/PubMed/31672472" }, { "database": "PubMed", "id": "31707362", "url": "https://glygen.org/publication/PubMed/31707362" }, { "database": "PubMed", "id": "31789395", "url": "https://glygen.org/publication/PubMed/31789395" }, { "database": "PubMed", "id": "31815045", "url": "https://glygen.org/publication/PubMed/31815045" }, { "database": "PubMed", "id": "31875823", "url": "https://glygen.org/publication/PubMed/31875823" }, { "database": "PubMed", "id": "31900153", "url": "https://glygen.org/publication/PubMed/31900153" }, { "database": "PubMed", "id": "32348172", "url": "https://glygen.org/publication/PubMed/32348172" }, { "database": "PubMed", "id": "33066035", "url": "https://glygen.org/publication/PubMed/33066035" }, { "database": "PubMed", "id": "33495840", "url": "https://glygen.org/publication/PubMed/33495840" }, { "database": "PubMed", "id": "33516356", "url": "https://glygen.org/publication/PubMed/33516356" }, { "database": "PubMed", "id": "33807180", "url": "https://glygen.org/publication/PubMed/33807180" }, { "database": "PubMed", "id": "23395175", "url": "https://glygen.org/publication/PubMed/23395175" }, { "database": "PubMed", "id": "22057101", "url": "https://glygen.org/publication/PubMed/22057101" } ], "site_lbl": "Ser9" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Requirement for glycogen synthase kinase-3beta in cell survival and NF-kappaB activation.", "journal": "Nature", "date": "2000", "authors": "Luo J., Woodgett J.R., Hoeflich K.P., Tsao M.S., Jin O., Rubie E.A.", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "10894547", "url": "https://glygen.org/publication/PubMed/10894547" } ] }, { "title": "Phosphorylation and inactivation of glycogen synthase kinase 3 by protein kinase A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Fang X, Yu SX, Lu Y, Bast RC Jr, Woodgett JR, Mills GB", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "11035810", "url": "https://glygen.org/publication/PubMed/11035810" } ] }, { "title": "Elevated nucleocytoplasmic glycosylation by O-GlcNAc results in insulin resistance associated with defects in Akt activation in 3T3-L1 adipocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Vosseller K, Wells L, Lane MD, Hart GW", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9WV60", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "11959983", "url": "https://glygen.org/publication/PubMed/11959983" } ] }, { "title": "Fibroblast growth factor 1 regulates signaling via the glycogen synthase kinase-3beta pathway. Implications for neuroprotection.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hashimoto M, Sagara Y, Langford D, Everall IP, Mallory M, Everson A, Digicaylioglu M, Masliah E", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "12095987", "url": "https://glygen.org/publication/PubMed/12095987" } ] }, { "title": "Expression, localization, and activity of glycogen synthase kinase 3beta during mouse skin tumorigenesis.", "journal": "Molecular carcinogenesis", "date": "2002", "authors": "Leis H, Segrelles C, Ruiz S, Santos M, Paramio JM", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "12489109", "url": "https://glygen.org/publication/PubMed/12489109" } ] }, { "title": "Regulation of Akt and glycogen synthase kinase-3 beta phosphorylation by sodium valproate and lithium.", "journal": "Neuropharmacology", "date": "2002", "authors": "De Sarno P, Li X, Jope RS", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "12504922", "url": "https://glygen.org/publication/PubMed/12504922" } ] }, { "title": "Convergent evidence for impaired AKT1-GSK3beta signaling in schizophrenia.", "journal": "Nature genetics", "date": "2004", "authors": "Emamian ES, Hall D, Birnbaum MJ, Karayiorgou M, Gogos JA", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "14745448", "url": "https://glygen.org/publication/PubMed/14745448" } ] }, { "title": "Ogt-dependent X-chromosome-linked protein glycosylation is a requisite modification in somatic cell function and embryo viability.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "O'Donnell N, Zachara NE, Hart GW, Marth JD", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9WV60", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "14749383", "url": "https://glygen.org/publication/PubMed/14749383" } ] }, { "title": "In vivo regulation of glycogen synthase kinase-3beta (GSK3beta) by serotonergic activity in mouse brain.", "journal": "Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology", "date": "2004", "authors": "Li X, Zhu W, Roh MS, Friedman AB, Rosborough K, Jope RS", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "15039769", "url": "https://glygen.org/publication/PubMed/15039769" } ] }, { "title": "Phosphoproteomic analysis of the developing mouse brain.", "journal": "Molecular & cellular proteomics : MCP", "date": "2004", "authors": "Ballif BA, Villen J, Beausoleil SA, Schwartz D, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" }, { "database": "UniProtKB", "id": "E9QAQ5", "url": "https://www.uniprot.org/uniprot/E9QAQ5" }, { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "15345747", "url": "https://glygen.org/publication/PubMed/15345747" } ] }, { "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.", "journal": "Nature biotechnology", "date": "2005", "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ] }, { "title": "Anesthesia and post-mortem interval profoundly influence the regulatory serine phosphorylation of glycogen synthase kinase-3 in mouse brain.", "journal": "Journal of neurochemistry", "date": "2005", "authors": "Li X, Friedman AB, Roh MS, Jope RS", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "15659239", "url": "https://glygen.org/publication/PubMed/15659239" } ] }, { "title": "Lack of PTEN sequesters CHK1 and initiates genetic instability.", "journal": "Cancer cell", "date": "2005", "authors": "Puc J, Keniry M, Li HS, Pandita TK, Choudhury AD, Memeo L, Mansukhani M, Murty VV, Gaciong Z, Meek SE, Piwnica-Worms H, Hibshoosh H, Parsons R", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "15710331", "url": "https://glygen.org/publication/PubMed/15710331" } ] }, { "title": "Role that phosphorylation of GSK3 plays in insulin and Wnt signalling defined by knockin analysis.", "journal": "EMBO J.", "date": "2005", "authors": "McManus EJ, Sakamoto K, Armit LJ, Ronaldson L, Shpiro N, Marquez R, Alessi DR", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" }, { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "15791206", "url": "https://glygen.org/publication/PubMed/15791206" } ] }, { "title": "Progesterone inhibits the estrogen-induced phosphoinositide 3-kinase-->AKT-->GSK-3beta-->cyclin D1-->pRB pathway to block uterine epithelial cell proliferation.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "Chen B, Pan H, Zhu L, Deng Y, Pollard JW", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "15845746", "url": "https://glygen.org/publication/PubMed/15845746" } ] }, { "title": "Mechanisms of cytoplasmic {beta}-catenin accumulation and its involvement in tumorigenic activities mediated by oncogenic splicing variant of the receptor originated from Nantes tyrosine kinase.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Xu XM, Zhou YQ, Wang MH", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "15878878", "url": "https://glygen.org/publication/PubMed/15878878" } ] }, { "title": "Wnt/beta-catenin signaling activates growth-control genes during overload-induced skeletal muscle hypertrophy.", "journal": "American journal of physiology. Cell physiology", "date": "2005", "authors": "Armstrong DD, Esser KA", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "15888552", "url": "https://glygen.org/publication/PubMed/15888552" } ] }, { "title": "Role of the PDK1-PKB-GSK3 pathway in regulating glycogen synthase and glucose uptake in the heart.", "journal": "FEBS letters", "date": "2005", "authors": "Mora A, Sakamoto K, McManus EJ, Alessi DR", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "15961082", "url": "https://glygen.org/publication/PubMed/15961082" } ] }, { "title": "Ser-557-phosphorylated mCRY2 is degraded upon synergistic phosphorylation by glycogen synthase kinase-3 beta.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Harada Y, Sakai M, Kurabayashi N, Hirota T, Fukada Y", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "15980066", "url": "https://glygen.org/publication/PubMed/15980066" } ] }, { "title": "The effect of insulin deficiency on tau and neurofilament in the insulin knockout mouse.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Schechter R, Beju D, Miller KE", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16039605", "url": "https://glygen.org/publication/PubMed/16039605" } ] }, { "title": "An Akt/beta-arrestin 2/PP2A signaling complex mediates dopaminergic neurotransmission and behavior.", "journal": "Cell", "date": "2005", "authors": "Beaulieu JM, Sotnikova TD, Marion S, Lefkowitz RJ, Gainetdinov RR, Caron MG", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16051150", "url": "https://glygen.org/publication/PubMed/16051150" } ] }, { "title": "Irs1 and Irs2 signaling is essential for hepatic glucose homeostasis and systemic growth.", "journal": "The Journal of clinical investigation", "date": "2006", "authors": "Dong X, Park S, Lin X, Copps K, Yi X, White MF", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16374520", "url": "https://glygen.org/publication/PubMed/16374520" } ] }, { "title": "Implication of the phosphatidylinositol-3 kinase/protein kinase B signaling pathway in the neuroprotective effect of estradiol in the striatum of 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine mice.", "journal": "Molecular pharmacology", "date": "2006", "authors": "D'Astous M, Mendez P, Morissette M, Garcia-Segura LM, Di Paolo T", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16434614", "url": "https://glygen.org/publication/PubMed/16434614" } ] }, { "title": "Protein kinase B/Akt-dependent phosphorylation of glycogen synthase kinase-3beta in irradiated vascular endothelium.", "journal": "Cancer research", "date": "2006", "authors": "Tan J, Geng L, Yazlovitskaya EM, Hallahan DE", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16489037", "url": "https://glygen.org/publication/PubMed/16489037" } ] }, { "title": "Hepatocyte growth factor suppresses acute renal inflammation by inhibition of endothelial E-selectin.", "journal": "Kidney international", "date": "2006-04", "authors": "Gong R, Rifai A, Dworkin L D", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16501492", "url": "https://glygen.org/publication/PubMed/16501492" } ] }, { "title": "Cdc42 controls progenitor cell differentiation and beta-catenin turnover in skin.", "journal": "Genes & development", "date": "2006", "authors": "Wu X, Quondamatteo F, Lefever T, Czuchra A, Meyer H, Chrostek A, Paus R, Langbein L, Brakebusch C", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16510873", "url": "https://glygen.org/publication/PubMed/16510873" } ] }, { "title": "Leptin increases axonal growth cone size in developing mouse cortical neurons by convergent signals inactivating glycogen synthase kinase-3beta.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Valerio A, Ghisi V, Dossena M, Tonello C, Giordano A, Frontini A, Ferrario M, Pizzi M, Spano P, Carruba MO, Nisoli E", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16522636", "url": "https://glygen.org/publication/PubMed/16522636" } ] }, { "title": "Glycogen synthase kinase 3beta together with 14-3-3 protein regulates diabetic cardiomyopathy: effect of losartan and tempol.", "journal": "FEBS letters", "date": "2006", "authors": "Gurusamy N, Watanabe K, Ma M, Prakash P, Hirabayashi K, Zhang S, Muslin AJ, Kodama M, Aizawa Y", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16530186", "url": "https://glygen.org/publication/PubMed/16530186" } ] }, { "title": "Glycogen synthase kinase-3 regulates mitochondrial outer membrane permeabilization and apoptosis by destabilization of MCL-1.", "journal": "Mol. Cell", "date": "2006", "authors": "Maurer U, Charvet C, Wagman AS, Dejardin E, Green DR", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16543145", "url": "https://glygen.org/publication/PubMed/16543145" } ] }, { "title": "The critical roles of serum/glucocorticoid-regulated kinase 3 (SGK3) in the hair follicle morphogenesis and homeostasis: the allelic difference provides novel insights into hair follicle biology.", "journal": "The American journal of pathology", "date": "2006", "authors": "Okada T, Ishii Y, Masujin K, Yasoshima A, Matsuda J, Ogura A, Nakayama H, Kunieda T, Doi K", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16565488", "url": "https://glygen.org/publication/PubMed/16565488" } ] }, { "title": "Effects of endogenous beta-amyloid overproduction on tau phosphorylation in cell culture.", "journal": "Journal of neurochemistry", "date": "2006", "authors": "Wang ZF, Li HL, Li XC, Zhang Q, Tian Q, Wang Q, Xu H, Wang JZ", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16762022", "url": "https://glygen.org/publication/PubMed/16762022" } ] }, { "title": "Lithium inhibits stress-induced changes in tau phosphorylation in the mouse hippocampus.", "journal": "Journal of neural transmission (Vienna, Austria : 1996)", "date": "2006", "authors": "Yoshida S, Maeda M, Kaku S, Ikeya H, Yamada K, Nakaike S", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16855914", "url": "https://glygen.org/publication/PubMed/16855914" } ] }, { "title": "Glycogen synthase kinase-3 regulation of chromatin segregation and cytokinesis in mouse preimplantation embryos.", "journal": "Molecular reproduction and development", "date": "2007", "authors": "Acevedo N, Wang X, Dunn RL, Smith GD", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16941690", "url": "https://glygen.org/publication/PubMed/16941690" } ] }, { "title": "Neuronal polarity is regulated by glycogen synthase kinase-3 (GSK-3beta) independently of Akt/PKB serine phosphorylation.", "journal": "Journal of cell science", "date": "2006", "authors": "Gartner A, Huang X, Hall A", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16954147", "url": "https://glygen.org/publication/PubMed/16954147" } ] }, { "title": "Endogenously activated mGlu5 metabotropic glutamate receptors sustain the increase in c-Myc expression induced by leukaemia inhibitory factor in cultured mouse embryonic stem cells.", "journal": "Journal of neurochemistry", "date": "2006", "authors": "Spinsanti P, De Vita T, Di Castro S, Storto M, Formisano P, Nicoletti F, Melchiorri D", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "16987252", "url": "https://glygen.org/publication/PubMed/16987252" } ] }, { "title": "S6K1 regulates GSK3 under conditions of mTOR-dependent feedback inhibition of Akt.", "journal": "Molecular cell", "date": "2006", "authors": "Zhang HH, Lipovsky AI, Dibble CC, Sahin M, Manning BD", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "17052453", "url": "https://glygen.org/publication/PubMed/17052453" } ] }, { "title": "Dual alterations in casein kinase I-epsilon and GSK-3beta modulate beta-catenin stability in hyperproliferating colonic epithelia.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2007", "authors": "Umar S, Wang Y, Morris AP, Sellin JH", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "17053159", "url": "https://glygen.org/publication/PubMed/17053159" } ] }, { "title": "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Munton RP, Tweedie-Cullen R, Livingstone-Zatchej M, Weinandy F, Waidelich M, Longo D, Gehrig P, Potthast F, Rutishauser D, Gerrits B, Panse C, Schlapbach R, Mansuy IM", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "17114649", "url": "https://glygen.org/publication/PubMed/17114649" } ] }, { "title": "Ablation in mice of the mTORC components raptor, rictor, or mLST8 reveals that mTORC2 is required for signaling to Akt-FOXO and PKCalpha, but not S6K1.", "journal": "Developmental cell", "date": "2006", "authors": "Guertin DA, Stevens DM, Thoreen CC, Burds AA, Kalaany NY, Moffat J, Brown M, Fitzgerald KJ, Sabatini DM", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "17141160", "url": "https://glygen.org/publication/PubMed/17141160" } ] }, { "title": "Glycogen synthase kinase-3 inhibition is integral to long-term potentiation.", "journal": "The European journal of neuroscience", "date": "2007", "authors": "Hooper C, Markevich V, Plattner F, Killick R, Schofield E, Engel T, Hernandez F, Anderton B, Rosenblum K, Bliss T, Cooke SF, Avila J, Lucas JJ, Giese KP, Stephenson J, Lovestone S", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "17241269", "url": "https://glygen.org/publication/PubMed/17241269" } ] }, { "title": "Large-scale phosphorylation analysis of mouse liver.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2007", "authors": "Villen J, Beausoleil SA, Gerber SA, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" }, { "database": "UniProtKB", "id": "E9QAQ5", "url": "https://www.uniprot.org/uniprot/E9QAQ5" }, { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ] }, { "title": "GSK3 alpha and GSK3 beta are necessary for axon formation.", "journal": "FEBS Lett.", "date": "2007", "authors": "Simon D., Garrido J.J., Varea O., Wandosell F.", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "17391670", "url": "https://glygen.org/publication/PubMed/17391670" } ] }, { "title": "Unrestrained glycogen synthase kinase-3 beta activity leads to activated T cell death and can be inhibited by natural adjuvant.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Sengupta S, Jayaraman P, Chilton PM, Casella CR, Mitchell TC", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "17475833", "url": "https://glygen.org/publication/PubMed/17475833" } ] }, { "title": "GSK-3beta mediates in the progesterone inhibition of estrogen induced cyclin D2 nuclear localization and cell proliferation in cyclin D1-/- mouse uterine epithelium.", "journal": "FEBS letters", "date": "2007", "authors": "Wang Y, Feng H, Bi C, Zhu L, Pollard JW, Chen B", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "17560576", "url": "https://glygen.org/publication/PubMed/17560576" } ] }, { "title": "bFGF promotes photoreceptor cell survival in vitro by PKA-mediated inactivation of glycogen synthase kinase 3beta and CREB-dependent Bcl-2 up-regulation.", "journal": "Journal of neurochemistry", "date": "2007-11", "authors": "O'Driscoll Carolyn, Wallace Deborah, Cotter Thomas G", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "17714451", "url": "https://glygen.org/publication/PubMed/17714451" } ] }, { "title": "Effects of wortmannin on phosphorylation of PDK1, GSK3-beta, PTEN and expression of Skp2 mRNA after ischemia/reperfusion injury in the mouse kidney.", "journal": "International urology and nephrology", "date": "2008", "authors": "Zheng X, Xie L, Qin J, Shen H, Chen Z, Jin Y", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "17975737", "url": "https://glygen.org/publication/PubMed/17975737" } ] }, { "title": "Genetic deficiency of glycogen synthase kinase-3beta corrects diabetes in mouse models of insulin resistance.", "journal": "PLoS Biol.", "date": "2008", "authors": "Tanabe K, Liu Z, Patel S, Doble BW, Li L, Cras-Meneur C, Martinez SC, Welling CM, White MF, Bernal-Mizrachi E, Woodgett JR, Permutt MA", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "18288891", "url": "https://glygen.org/publication/PubMed/18288891" } ] }, { "title": "Interplay between cyclin-dependent kinase 5 and glycogen synthase kinase 3 beta mediated by neuregulin signaling leads to differential effects on tau phosphorylation and amyloid precursor protein processing.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2008", "authors": "Wen Y, Planel E, Herman M, Figueroa HY, Wang L, Liu L, Lau LF, Yu WH, Duff KE", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "18322105", "url": "https://glygen.org/publication/PubMed/18322105" } ] }, { "title": "Glycogen synthase kinase 3beta is a novel regulator of high glucose- and high insulin-induced extracellular matrix protein synthesis in renal proximal tubular epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Mariappan MM, Shetty M, Sataranatarajan K, Choudhury GG, Kasinath BS", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "18701453", "url": "https://glygen.org/publication/PubMed/18701453" } ] }, { "title": "AMP-activated protein kinase activation increases phosphorylation of glycogen synthase kinase 3beta and thereby reduces cAMP-responsive element transcriptional activity and phosphoenolpyruvate carboxykinase C gene expression in the liver.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Horike N, Sakoda H, Kushiyama A, Ono H, Fujishiro M, Kamata H, Nishiyama K, Uchijima Y, Kurihara Y, Kurihara H, Asano T", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "18801732", "url": "https://glygen.org/publication/PubMed/18801732" } ] }, { "title": "Laforin negatively regulates cell cycle progression through glycogen synthase kinase 3beta-dependent mechanisms.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Liu R, Wang L, Chen C, Liu Y, Zhou P, Wang Y, Wang X, Turnbull J, Minassian BA, Liu Y, Zheng P", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "18824542", "url": "https://glygen.org/publication/PubMed/18824542" } ] }, { "title": "Airway smooth muscle hyperplasia and hypertrophy correlate with glycogen synthase kinase-3(beta) phosphorylation in a mouse model of asthma.", "journal": "American journal of physiology. Lung cellular and molecular physiology", "date": "2009", "authors": "Bentley JK, Deng H, Linn MJ, Lei J, Dokshin GA, Fingar DC, Bitar KN, Henderson WR Jr, Hershenson MB", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "19011050", "url": "https://glygen.org/publication/PubMed/19011050" } ] }, { "title": "Neuroprotective effects of (+/-)-catechin against 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP)-induced dopaminergic neurotoxicity in mice.", "journal": "Neuroscience letters", "date": "2009", "authors": "Ruan H, Yang Y, Zhu X, Wang X, Chen R", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "19070648", "url": "https://glygen.org/publication/PubMed/19070648" } ] }, { "title": "Distinct roles of GSK-3alpha and GSK-3beta phosphorylation in the heart under pressure overload.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Matsuda T, Zhai P, Maejima Y, Hong C, Gao S, Tian B, Goto K, Takagi H, Tamamori-Adachi M, Kitajima S, Sadoshima J", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "19106302", "url": "https://glygen.org/publication/PubMed/19106302" } ] }, { "title": "Cadmium toxicity toward autophagy through ROS-activated GSK-3beta in mesangial cells.", "journal": "Toxicological sciences : an official journal of the Society of Toxicology", "date": "2009", "authors": "Wang SH, Shih YL, Kuo TC, Ko WC, Shih CM", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "19126599", "url": "https://glygen.org/publication/PubMed/19126599" } ] }, { "title": "Identification of zinc-finger BED domain-containing 3 (Zbed3) as a novel Axin-interacting protein that activates Wnt/beta-catenin signaling.", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Chen T, Li M, Ding Y, Zhang LS, Xi Y, Pan WJ, Tao DL, Wang JY, Li L", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "19141611", "url": "https://glygen.org/publication/PubMed/19141611" } ] }, { "title": "Disrupted in schizophrenia 1 regulates neuronal progenitor proliferation via modulation of GSK3beta/beta-catenin signaling.", "journal": "Cell", "date": "2009", "authors": "Mao Y, Ge X, Frank CL, Madison JM, Koehler AN, Doud MK, Tassa C, Berry EM, Soda T, Singh KK, Biechele T, Petryshen TL, Moon RT, Haggarty SJ, Tsai LH", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "19303846", "url": "https://glygen.org/publication/PubMed/19303846" } ] }, { "title": "Cocaine-induced hyperactivity and sensitization are dependent on GSK3.", "journal": "Neuropharmacology", "date": "2009", "authors": "Miller JS, Tallarida RJ, Unterwald EM", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "19328817", "url": "https://glygen.org/publication/PubMed/19328817" } ] }, { "title": "PKC theta cooperates with PKC alpha in alloimmune responses of T cells in vivo.", "journal": "Molecular immunology", "date": "2009", "authors": "Gruber T, Hermann-Kleiter N, Pfeifhofer-Obermair C, Lutz-Nicoladoni C, Thuille N, Letschka T, Barsig J, Baudler M, Li J, Metzler B, Nusslein-Hildesheim B, Wagner J, Leitges M, Baier G", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "19356803", "url": "https://glygen.org/publication/PubMed/19356803" } ] }, { "title": "GSK3beta, a centre-staged kinase in neuropsychiatric disorders, modulates long term memory by inhibitory phosphorylation at serine-9.", "journal": "Neurobiology of disease", "date": "2009", "authors": "Dewachter I, Ris L, Jaworski T, Seymour CM, Kremer A, Borghgraef P, De Vijver H, Godaux E, Van Leuven F", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "19379814", "url": "https://glygen.org/publication/PubMed/19379814" } ] }, { "title": "BiP, an endoplasmic reticulum chaperone, modulates the development of morphine antinociceptive tolerance.", "journal": "Journal of cellular and molecular medicine", "date": "2010", "authors": "Dobashi T, Tanabe S, Jin H, Mimura N, Yamamoto T, Nishino T, Aoe T", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "19818092", "url": "https://glygen.org/publication/PubMed/19818092" } ] }, { "title": "Diet-induced hyperhomocysteinemia increases amyloid-beta formation and deposition in a mouse model of Alzheimer's disease.", "journal": "Current Alzheimer research", "date": "2010", "authors": "Zhuo JM, Portugal GS, Kruger WD, Wang H, Gould TJ, Pratico D", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "19939226", "url": "https://glygen.org/publication/PubMed/19939226" } ] }, { "title": "Regulation of BMAL1 protein stability and circadian function by GSK3beta-mediated phosphorylation.", "journal": "PLoS ONE", "date": "2010", "authors": "Sahar S, Zocchi L, Kinoshita C, Borrelli E, Sassone-Corsi P", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "20049328", "url": "https://glygen.org/publication/PubMed/20049328" } ] }, { "title": "Light and electron microscopy study of glycogen synthase kinase-3beta in the mouse brain.", "journal": "PloS one", "date": "2010", "authors": "Perez-Costas E, Gandy JC, Melendez-Ferro M, Roberts RC, Bijur GN", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "20111716", "url": "https://glygen.org/publication/PubMed/20111716" } ] }, { "title": "DYRK1A and glycogen synthase kinase 3beta, a dual-kinase mechanism directing proteasomal degradation of CRY2 for circadian timekeeping.", "journal": "Mol. Cell. Biol.", "date": "2010", "authors": "Kurabayashi N, Hirota T, Sakai M, Sanada K, Fukada Y", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "20123978", "url": "https://glygen.org/publication/PubMed/20123978" } ] }, { "title": "GSK3 influences social preference and anxiety-related behaviors during social interaction in a mouse model of fragile X syndrome and autism.", "journal": "PloS one", "date": "2010", "authors": "Mines MA, Yuskaitis CJ, King MK, Beurel E, Jope RS", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "20300527", "url": "https://glygen.org/publication/PubMed/20300527" } ] }, { "title": "Fat cell-specific ablation of rictor in mice impairs insulin-regulated fat cell and whole-body glucose and lipid metabolism.", "journal": "Diabetes", "date": "2010", "authors": "Kumar A, Lawrence JC Jr, Jung DY, Ko HJ, Keller SR, Kim JK, Magnuson MA, Harris TE", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "20332342", "url": "https://glygen.org/publication/PubMed/20332342" } ] }, { "title": "Tau-tubulin kinase 1 enhances prefibrillar tau aggregation and motor neuron degeneration in P301L FTDP-17 tau-mutant mice.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Xu J, Sato S, Okuyama S, Swan RJ, Jacobsen MT, Strunk E, Ikezu T", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "20354135", "url": "https://glygen.org/publication/PubMed/20354135" } ] }, { "title": "Protein Phosphatase 2a and glycogen synthase kinase 3 signaling modulate prepulse inhibition of the acoustic startle response by altering cortical M-Type potassium channel activity.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2010", "authors": "Kapfhamer D, Berger KH, Hopf FW, Seif T, Kharazia V, Bonci A, Heberlein U", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "20592205", "url": "https://glygen.org/publication/PubMed/20592205" } ] }, { "title": "CRH and SRIF have opposite effects on the Wnt/beta-catenin signalling pathway through PKA/GSK-3beta in corticotroph pituitary cells.", "journal": "Cancer investigation", "date": "2010", "authors": "Khattak MN, Buchfelder M, Kleindienst A, Schofl C, Kremenevskaja N", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "20690801", "url": "https://glygen.org/publication/PubMed/20690801" } ] }, { "title": "Inhibition of glioblastoma growth by the thiadiazolidinone compound TDZD-8.", "journal": "PloS one", "date": "2010", "authors": "Aguilar-Morante D, Morales-Garcia JA, Sanz-SanCristobal M, Garcia-Cabezas MA, Santos A, Perez-Castillo A", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "21079728", "url": "https://glygen.org/publication/PubMed/21079728" } ] }, { "title": "Skin stem cells orchestrate directional migration by regulating microtubule-ACF7 connections through GSK3beta.", "journal": "Cell", "date": "2011", "authors": "Wu X, Shen QT, Oristian DS, Lu CP, Zheng Q, Wang HW, Fuchs E", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "21295697", "url": "https://glygen.org/publication/PubMed/21295697" } ] }, { "title": "Progranulin enhances neural progenitor cell proliferation through glycogen synthase kinase 3beta phosphorylation.", "journal": "Neuroscience", "date": "2011", "authors": "Nedachi T, Kawai T, Matsuwaki T, Yamanouchi K, Nishihara M", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "21540081", "url": "https://glygen.org/publication/PubMed/21540081" } ] }, { "title": "Interplay between glycogen synthase kinase-3beta and tau in the cerebellum of Hsp27 transgenic mouse.", "journal": "Journal of neuroscience research", "date": "2011", "authors": "Wang S, Toth ME, Bereczki E, Santha M, Guan ZZ, Winblad B, Pei JJ", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "21544852", "url": "https://glygen.org/publication/PubMed/21544852" } ] }, { "title": "Cdc42 controls vascular network assembly through protein kinase Ciota during embryonic vasculogenesis.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2011", "authors": "Qi Y, Liu J, Wu X, Brakebusch C, Leitges M, Han Y, Corbett SA, Lowry SF, Graham AM, Li S", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "21659643", "url": "https://glygen.org/publication/PubMed/21659643" } ] }, { "title": "Cyanidin-3-glucoside ameliorates ethanol neurotoxicity in the developing brain.", "journal": "Journal of neuroscience research", "date": "2011", "authors": "Ke Z, Liu Y, Wang X, Fan Z, Chen G, Xu M, Bower KA, Frank JA, Ou X, Shi X, Luo J", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "21671257", "url": "https://glygen.org/publication/PubMed/21671257" } ] }, { "title": "An important role for Akt3 in platelet activation and thrombosis.", "journal": "Blood", "date": "2011", "authors": "O'Brien KA, Stojanovic-Terpo A, Hay N, Du X", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "21821713", "url": "https://glygen.org/publication/PubMed/21821713" } ] }, { "title": "Endoplasmic reticulum stress and glycogen synthase kinase-3beta activation in apolipoprotein E-deficient mouse models of accelerated atherosclerosis.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2012", "authors": "McAlpine CS, Bowes AJ, Khan MI, Shi Y, Werstuck GH", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "21998135", "url": "https://glygen.org/publication/PubMed/21998135" } ] }, { "title": "GSK-3beta activation mediates Nogo-66-induced inhibition of neurite outgrowth in N2a cells.", "journal": "Neuroscience letters", "date": "2011", "authors": "Shen JY, Yi XX, Xiong NX, Wang HJ, Duan XW, Zhao HY", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "22019984", "url": "https://glygen.org/publication/PubMed/22019984" } ] }, { "title": "HDAC6 regulates LPS-tolerance in astrocytes.", "journal": "PloS one", "date": "2011", "authors": "Beurel E", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "22022450", "url": "https://glygen.org/publication/PubMed/22022450" } ] }, { "title": "ZNRF1 promotes Wallerian degeneration by degrading AKT to induce GSK3B-dependent CRMP2 phosphorylation.", "journal": "Nat. Cell Biol.", "date": "2011", "authors": "Wakatsuki S, Saitoh F, Araki T", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" }, { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "22057101", "url": "https://glygen.org/publication/PubMed/22057101" } ] }, { "title": "Frat is a phosphatidylinositol 3-kinase/Akt-regulated determinant of glycogen synthase kinase 3beta subcellular localization in pluripotent cells.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Bechard M, Trost R, Singh AM, Dalton S", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "22064483", "url": "https://glygen.org/publication/PubMed/22064483" } ] }, { "title": "B7-H4 Treatment of T Cells Inhibits ERK, JNK, p38, and AKT Activation.", "journal": "PloS one", "date": "2012", "authors": "Wang X, Hao J, Metzger DL, Ao Z, Chen L, Ou D, Verchere CB, Mui A, Warnock GL", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "22238573", "url": "https://glygen.org/publication/PubMed/22238573" } ] }, { "title": "Protection by cilostazol against amyloid-beta(1-40)-induced suppression of viability and neurite elongation through activation of CK2alpha in HT22 mouse hippocampal cells.", "journal": "Journal of neuroscience research", "date": "2012", "authors": "Lee HR, Park SY, Kim HY, Shin HK, Lee WS, Rhim BY, Hong KW, Kim CD", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "22422579", "url": "https://glygen.org/publication/PubMed/22422579" } ] }, { "title": "Brain region differences in regulation of Akt and GSK3 by chronic stimulant administration in mice.", "journal": "Cellular signalling", "date": "2012", "authors": "Mines MA, Jope RS", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "22434044", "url": "https://glygen.org/publication/PubMed/22434044" } ] }, { "title": "Citrus aurantium flavonoids inhibit adipogenesis through the Akt signaling pathway in 3T3-L1 cells.", "journal": "BMC complementary and alternative medicine", "date": "2012", "authors": "Kim GS, Park HJ, Woo JH, Kim MK, Koh PO, Min W, Ko YG, Kim CH, Won CK, Cho JH", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "22471389", "url": "https://glygen.org/publication/PubMed/22471389" } ] }, { "title": "GSK3-TIP60-ULK1 signaling pathway links growth factor deprivation to autophagy.", "journal": "Science", "date": "2012", "authors": "Lin SY, Li TY, Liu Q, Zhang C, Li X, Chen Y, Zhang SM, Lian G, Liu Q, Ruan K, Wang Z, Zhang CS, Chien KY, Wu J, Li Q, Han J, Lin SC", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "22539723", "url": "https://glygen.org/publication/PubMed/22539723" } ] }, { "title": "Global identification and characterization of both O-GlcNAcylation and phosphorylation at the murine synapse.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Trinidad JC, Barkan DT, Gulledge BF, Thalhammer A, Sali A, Schoepfer R, Burlingame AL", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9WV60", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "22645316", "url": "https://glygen.org/publication/PubMed/22645316" } ] }, { "title": "Inhibition of GSK-3beta ameliorates hepatic ischemia-reperfusion injury through GSK-3beta/beta-catenin signaling pathway in mice.", "journal": "Hepatobiliary & pancreatic diseases international : HBPD INT", "date": "2012", "authors": "Xia YX, Lu L, Wu ZS, Pu LY, Sun BC, Wang XH", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "22672822", "url": "https://glygen.org/publication/PubMed/22672822" } ] }, { "title": "Flurbiprofen, a cyclooxygenase inhibitor, protects mice from hepatic ischemia/reperfusion injury by inhibiting GSK-3beta signaling and mitochondrial permeability transition.", "journal": "Molecular medicine (Cambridge, Mass.)", "date": "2012", "authors": "Fu H, Chen H, Wang C, Xu H, Liu F, Guo M, Wang Q, Shi X", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "22714712", "url": "https://glygen.org/publication/PubMed/22714712" } ] }, { "title": "Lithium exacerbates hepatic ischemia/reperfusion injury by inhibiting GSK-3beta/NF-kappaB-mediated protective signaling in mice.", "journal": "European journal of pharmacology", "date": "2012", "authors": "Xia Y, Rao J, Yao A, Zhang F, Li G, Wang X, Lu L", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "23051669", "url": "https://glygen.org/publication/PubMed/23051669" } ] }, { "title": "Dual regulation of glycogen synthase kinase 3 (GSK3)alpha/beta by protein kinase C (PKC)alpha and Akt promotes thrombin-mediated integrin alphaIIbbeta3 activation and granule secretion in platelets.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Moore SF, van den Bosch MT, Hunter RW, Sakamoto K, Poole AW, Hers I", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "23239877", "url": "https://glygen.org/publication/PubMed/23239877" } ] }, { "title": "Acute inhibition of central c-Jun N-terminal kinase restores hypothalamic insulin signalling and alleviates glucose intolerance in diabetic mice.", "journal": "Journal of neuroendocrinology", "date": "2013", "authors": "Benzler J, Ganjam GK, Legler K, Stohr S, Kruger M, Steger J, Tups A", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "23301857", "url": "https://glygen.org/publication/PubMed/23301857" } ] }, { "title": "Inhibitory phosphorylation of GSK-3beta by AKT, PKA, and PI3K contributes to high NaCl-induced activation of the transcription factor NFAT5 (TonEBP/OREBP).", "journal": "American journal of physiology. Renal physiology", "date": "2013", "authors": "Zhou X, Wang H, Burg MB, Ferraris JD", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "23324178", "url": "https://glygen.org/publication/PubMed/23324178" } ] }, { "title": "6-gingerol prevents adipogenesis and the accumulation of cytoplasmic lipid droplets in 3T3-L1 cells.", "journal": "Phytomedicine : international journal of phytotherapy and phytopharmacology", "date": "2013", "authors": "Tzeng TF, Liu IM", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "23369342", "url": "https://glygen.org/publication/PubMed/23369342" } ] }, { "title": "Glucose sensor O-GlcNAcylation coordinates with phosphorylation to regulate circadian clock.", "journal": "Cell Metab.", "date": "2013", "authors": "Kaasik K, Kivimae S, Allen JJ, Chalkley RJ, Huang Y, Baer K, Kissel H, Burlingame AL, Shokat KM, Ptacek LJ, Fu YH", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" }, { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "23395175", "url": "https://glygen.org/publication/PubMed/23395175" } ] }, { "title": "PDK1 regulates platelet activation and arterial thrombosis.", "journal": "Blood", "date": "2013", "authors": "Chen X, Zhang Y, Wang Y, Li D, Zhang L, Wang K, Luo X, Yang Z, Wu Y, Liu J", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "23444402", "url": "https://glygen.org/publication/PubMed/23444402" } ] }, { "title": "Over-expression of calpastatin aggravates cardiotoxicity induced by doxorubicin.", "journal": "Cardiovascular research", "date": "2013", "authors": "Wang Y, Zheng D, Wei M, Ma J, Yu Y, Chen R, Lacefield JC, Xu H, Peng T", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "23455548", "url": "https://glygen.org/publication/PubMed/23455548" } ] }, { "title": "A combinatorial F box protein directed pathway controls TRAF adaptor stability to regulate inflammation.", "journal": "Nat. Immunol.", "date": "2013", "authors": "Chen BB, Coon TA, Glasser JR, McVerry BJ, Zhao J, Zhao Y, Zou C, Ellis B, Sciurba FC, Zhang Y, Mallampalli RK", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "23542741", "url": "https://glygen.org/publication/PubMed/23542741" } ] }, { "title": "Formaldehyde induces hyperphosphorylation and polymerization of Tau protein both in vitro and in vivo.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Lu J, Miao J, Su T, Liu Y, He R", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "23628704", "url": "https://glygen.org/publication/PubMed/23628704" } ] }, { "title": "Effects of acute and chronic electroconvulsive shocks on glycogen synthase kinase 3beta level and phosphorylation in mice.", "journal": "The journal of ECT", "date": "2013", "authors": "Basar K, Eren-Kocak E, Ozdemir H, Ertugrul A", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "23807397", "url": "https://glygen.org/publication/PubMed/23807397" } ] }, { "title": "Antidepressant-like effect of alpha-tocopherol in a mouse model of depressive-like behavior induced by TNF-alpha.", "journal": "Progress in neuro-psychopharmacology & biological psychiatry", "date": "2013", "authors": "Manosso LM, Neis VB, Moretti M, Daufenbach JF, Freitas AE, Colla AR, Rodrigues AL", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "23816813", "url": "https://glygen.org/publication/PubMed/23816813" } ] }, { "title": "Per-Arnt-Sim kinase regulates pancreatic duodenal homeobox-1 protein stability via phosphorylation of glycogen synthase kinase 3beta in pancreatic beta-cells.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Semache M, Zarrouki B, Fontes G, Fogarty S, Kikani C, Chawki MB, Rutter J, Poitout V", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "23853095", "url": "https://glygen.org/publication/PubMed/23853095" } ] }, { "title": "[APPL1-mediated effects of leptin on activity of GSK-3beta in C2C12 cell].", "journal": "Zhonghua yi xue za zhi", "date": "2013", "authors": "Xu M, Xiao YY, Han JF, Yin J, Lu JX, Liu RB, Wei L, Bao YQ, Jia WP", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "24025512", "url": "https://glygen.org/publication/PubMed/24025512" } ] }, { "title": "CRMP2 tethers kainate receptor activity to cytoskeleton dynamics during neuronal maturation.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2013", "authors": "Marques JM, Rodrigues RJ, Valbuena S, Rozas JL, Selak S, Marin P, Aller MI, Lerma J", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "24227739", "url": "https://glygen.org/publication/PubMed/24227739" } ] }, { "title": "Differential effects of beta-catenin and NF-kappaB interplay in the regulation of cell proliferation, inflammation and tumorigenesis in response to bacterial infection.", "journal": "PloS one", "date": "2013", "authors": "Chandrakesan P, Jakkula LU, Ahmed I, Roy B, Anant S, Umar S", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "24278135", "url": "https://glygen.org/publication/PubMed/24278135" } ] }, { "title": "Effect of adiponectin on cardiac beta-catenin signaling pathway under angiotensin II infusion.", "journal": "Biochemical and biophysical research communications", "date": "2014", "authors": "Fujishima Y, Maeda N, Matsuda K, Komura N, Hirata A, Mori T, Sekimoto R, Tsushima Y, Nishizawa H, Funahashi T, Shimomura I", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "24462873", "url": "https://glygen.org/publication/PubMed/24462873" } ] }, { "title": "Targeting Src-mediated Tyr216 phosphorylation and activation of GSK-3 in prostate cancer cells inhibit prostate cancer progression in vitro and in vivo.", "journal": "Oncotarget", "date": "2014-02-15", "authors": "Goc Anna, Al-Husein Belal, Katsanevas Katerina, Steinbach Alison, Lou Uvette, Sabbineni Harika, DeRemer David L, Somanath Payaningal R", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "24519956", "url": "https://glygen.org/publication/PubMed/24519956" } ] }, { "title": "DIF-1 inhibits tumor growth in vivo reducing phosphorylation of GSK-3beta and expressions of cyclin D1 and TCF7L2 in cancer model mice.", "journal": "Biochemical pharmacology", "date": "2014", "authors": "Takahashi-Yanaga F, Yoshihara T, Jingushi K, Igawa K, Tomooka K, Watanabe Y, Morimoto S, Nakatsu Y, Tsuzuki T, Nakabeppu Y, Sasaguri T", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "24670930", "url": "https://glygen.org/publication/PubMed/24670930" } ] }, { "title": "Effects of resveratrol on the insulin signaling pathway of obese mice.", "journal": "Journal of veterinary science", "date": "2014", "authors": "Hong HJ, Kang W, Kim DG, Lee DH, Lee Y, Han CH", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "24675832", "url": "https://glygen.org/publication/PubMed/24675832" } ] }, { "title": "Linoleic acid derivative DCP-LA ameliorates stress-induced depression-related behavior by promoting cell surface 5-HT1A receptor translocation, stimulating serotonin release, and inactivating GSK-3beta.", "journal": "Molecular neurobiology", "date": "2015", "authors": "Kanno T, Tanaka A, Nishizaki T", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "24788685", "url": "https://glygen.org/publication/PubMed/24788685" } ] }, { "title": "Platelet endothelial cell adhesion molecule-1 inhibits platelet response to thrombin and von Willebrand factor by regulating the internalization of glycoprotein Ib via AKT/glycogen synthase kinase-3/dynamin and integrin \u03b1IIb\u03b23.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2014-09", "authors": "Jones Chris I, Sage Tanya, Moraes Leonardo A, Vaiyapuri Sakthivel, Hussain Umara, Tucker Katherine L, Barrett Natasha E, Gibbins Jonathan M", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "24969778", "url": "https://glygen.org/publication/PubMed/24969778" } ] }, { "title": "Glycogen synthase kinase-3 regulates production of amyloid-beta peptides and tau phosphorylation in diabetic rat brain.", "journal": "TheScientificWorldJournal", "date": "2014", "authors": "Qu ZS, Li L, Sun XJ, Zhao YW, Zhang J, Geng Z, Fu JL, Ren QG", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "24983010", "url": "https://glygen.org/publication/PubMed/24983010" } ] }, { "title": "Silencing [Formula: see text] Rescues Tau Pathologies and Memory Deficits through Rescuing PP2A and Inhibiting GSK-3beta Signaling in Human Tau Transgenic Mice.", "journal": "Frontiers in aging neuroscience", "date": "2014", "authors": "Zhang Y, Ma RH, Li XC, Zhang JY, Shi HR, Wei W, Luo DJ, Wang Q, Wang JZ, Liu GP", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "24987368", "url": "https://glygen.org/publication/PubMed/24987368" } ] }, { "title": "Pax6 regulates the expression of Dkk3 in murine and human cell lines, and altered responses to Wnt signaling are shown in FlpIn-3T3 cells stably expressing either the Pax6 or the Pax6(5a) isoform.", "journal": "PloS one", "date": "2014", "authors": "Forsdahl S, Kiselev Y, Hogseth R, Mjelle JE, Mikkola I", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "25029272", "url": "https://glygen.org/publication/PubMed/25029272" } ] }, { "title": "GSK-3 signaling in developing cortical neurons is essential for radial migration and dendritic orientation.", "journal": "eLife", "date": "2014", "authors": "Morgan-Smith M, Wu Y, Zhu X, Pringle J, Snider WD", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "25073924", "url": "https://glygen.org/publication/PubMed/25073924" } ] }, { "title": "Activation of \u03b2-catenin signalling by TFF1 loss promotes cell proliferation and gastric tumorigenesis.", "journal": "Gut", "date": "2015-07", "authors": "Soutto Mohammed, Peng DunFa, Katsha Ahmed, Chen Zheng, Piazuelo Maria Blanca, Washington Mary Kay, Belkhiri Abbes, Correa Pelayo, El-Rifai Wael", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "25107557", "url": "https://glygen.org/publication/PubMed/25107557" } ] }, { "title": "Hyperphosphorylation of Tau at Ser396 occurs in the much earlier stage than appearance of learning and memory disorders in 5XFAD mice.", "journal": "Behavioural brain research", "date": "2014", "authors": "Kanno T, Tsuchiya A, Nishizaki T", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "25172181", "url": "https://glygen.org/publication/PubMed/25172181" } ] }, { "title": "Acute restraint stress impairs induction of long-term potentiation by activating GSK-3beta.", "journal": "Neurochemical research", "date": "2015", "authors": "Jin Y, Kanno T, Nishizaki T", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "25355398", "url": "https://glygen.org/publication/PubMed/25355398" } ] }, { "title": "Phosphorylation and inactivation of glycogen synthase kinase 3beta (GSK3beta) by dual-specificity tyrosine phosphorylation-regulated kinase 1A (Dyrk1A).", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Song WJ, Song EA, Jung MS, Choi SH, Baik HH, Jin BK, Kim JH, Chung SH", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "25477508", "url": "https://glygen.org/publication/PubMed/25477508" } ] }, { "title": "Long-term oral exposure to bisphenol A induces glucose intolerance and insulin resistance.", "journal": "The Journal of endocrinology", "date": "2015", "authors": "Moon MK, Jeong IK, Jung Oh T, Ahn HY, Kim HH, Park YJ, Jang HC, Park KS", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "25972359", "url": "https://glygen.org/publication/PubMed/25972359" } ] }, { "title": "FXR1P is a GSK3beta substrate regulating mood and emotion processing.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2015", "authors": "Del'Guidice Thomas, Latapy Camille, Rampino Antonio, Khlghatyan Jivan, Lemasson Morgane, Gelao Barbara, Quarto Tiziana, Rizzo Giuseppe, Barbeau Annie, Lamarre Claude, Bertolino Alessandro, Blasi Giuseppe, Beaulieu Jean-Martin", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "26240334", "url": "https://glygen.org/publication/PubMed/26240334" } ] }, { "title": "FAK/PYK2 promotes the Wnt/beta-catenin pathway and intestinal tumorigenesis by phosphorylating GSK3beta.", "journal": "eLife", "date": "2015", "authors": "Gao C, Chen G, Kuan SF, Zhang DH, Schlaepfer DD, Hu J", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "26274564", "url": "https://glygen.org/publication/PubMed/26274564" } ] }, { "title": "Soluble amyloid precursor protein alpha inhibits tau phosphorylation through modulation of GSK3beta signaling pathway.", "journal": "Journal of neurochemistry", "date": "2015", "authors": "Deng J, Habib A, Obregon DF, Barger SW, Giunta B, Wang YJ, Hou H, Sawmiller D, Tan J", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "26342176", "url": "https://glygen.org/publication/PubMed/26342176" } ] }, { "title": "The A-kinase Anchoring Protein GSKIP Regulates GSK3beta Activity and Controls Palatal Shelf Fusion in Mice.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Deak VA, Skroblin P, Dittmayer C, Knobeloch KP, Bachmann S, Klussmann E", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "26582204", "url": "https://glygen.org/publication/PubMed/26582204" } ] }, { "title": "The synthetic progesterone Norgestrel is neuroprotective in stressed photoreceptor-like cells and retinal explants, mediating its effects via basic fibroblast growth factor, protein kinase A and glycogen synthase kinase 3beta signalling.", "journal": "The European journal of neuroscience", "date": "2016", "authors": "Wyse Jackson AC, Cotter TG", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "26750157", "url": "https://glygen.org/publication/PubMed/26750157" } ] }, { "title": "Inactivation of nuclear GSK3beta by Ser(389) phosphorylation promotes lymphocyte fitness during DNA double-strand break response.", "journal": "Nature communications", "date": "2016", "authors": "Thornton TM, Delgado P, Chen L, Salas B, Krementsov D, Fernandez M, Vernia S, Davis RJ, Heimann R, Teuscher C, Krangel MS, Ramiro AR, Rincon M", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "26822034", "url": "https://glygen.org/publication/PubMed/26822034" } ] }, { "title": "Allosteric Modulation of Sigma-1 Receptors Elicits Rapid Antidepressant Activity.", "journal": "CNS neuroscience & therapeutics", "date": "2016", "authors": "Wang Y, Guo L, Jiang HF, Zheng LT, Zhang A, Zhen XC", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "26854125", "url": "https://glygen.org/publication/PubMed/26854125" } ] }, { "title": "CTGF/CCN2 Postconditioning Increases Tolerance of Murine Hearts towards Ischemia-Reperfusion Injury.", "journal": "PloS one", "date": "2016", "authors": "Kaasboll OJ, Moe IT, Ahmed MS, Stang E, Hagelin EM, Attramadal H", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "26872261", "url": "https://glygen.org/publication/PubMed/26872261" } ] }, { "title": "Atorvastatin ameliorates cognitive impairment, Abeta1-42 production and Tau hyperphosphorylation in APP/PS1 transgenic mice.", "journal": "Metabolic brain disease", "date": "2016", "authors": "Zhou D, Liu H, Li C, Wang F, Shi Y, Liu L, Zhao X, Liu A, Zhang J, Wang C, Chen Z", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "26883430", "url": "https://glygen.org/publication/PubMed/26883430" } ] }, { "title": "Soluble guanylate cyclase activation during ischemic injury in mice protects against postischemic inflammation at the mitochondrial level.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2016", "authors": "Wang DZ, Jones AW, Wang WZ, Wang M, Korthuis RJ", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "26950856", "url": "https://glygen.org/publication/PubMed/26950856" } ] }, { "title": "Sakuranetin Induces Melanogenesis in B16BL6 Melanoma Cells through Inhibition of ERK and PI3K/AKT Signaling Pathways.", "journal": "Phytotherapy research : PTR", "date": "2016-06", "authors": "Drira Riadh, Sakamoto Kazuichi", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "27000529", "url": "https://glygen.org/publication/PubMed/27000529" } ] }, { "title": "Brief Isoflurane Anesthesia Produces Prominent Phosphoproteomic Changes in the Adult Mouse Hippocampus.", "journal": "ACS chemical neuroscience", "date": "2016", "authors": "Kohtala S, Theilmann W, Suomi T, Wigren HK, Porkka-Heiskanen T, Elo LL, Rokka A, Rantamaki T", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "27074656", "url": "https://glygen.org/publication/PubMed/27074656" } ] }, { "title": "Neuronal seipin knockout facilitates Abeta-induced neuroinflammation and neurotoxicity via reduction of PPARgamma in hippocampus of mouse.", "journal": "Journal of neuroinflammation", "date": "2016", "authors": "Qian Y, Yin J, Hong J, Li G, Zhang B, Liu G, Wan Q, Chen L", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "27287266", "url": "https://glygen.org/publication/PubMed/27287266" } ] }, { "title": "Multi-Vitamin B Supplementation Reverses Hypoxia-Induced Tau Hyperphosphorylation and Improves Memory Function in Adult Mice.", "journal": "Journal of Alzheimer's disease : JAD", "date": "2016", "authors": "Yu L, Chen Y, Wang W, Xiao Z, Hong Y", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "27497480", "url": "https://glygen.org/publication/PubMed/27497480" } ] }, { "title": "20-HETE attenuates the response of glucose-stimulated insulin secretion through the AKT/GSK-3beta/Glut2 pathway.", "journal": "Endocrine", "date": "2016", "authors": "Zhang B, Lai G, Wu J, Sun R, Xu R, Yang X, Qi Y, Zhao Y", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "27568038", "url": "https://glygen.org/publication/PubMed/27568038" } ] }, { "title": "Anti-malarial Activities of Two Soil Actinomycete Isolates from Sabah via Inhibition of Glycogen Synthase Kinase 3beta.", "journal": "Tropical life sciences research", "date": "2016", "authors": "Dahari DE, Salleh RM, Mahmud F, Chin LP, Embi N, Sidek HM", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "27688851", "url": "https://glygen.org/publication/PubMed/27688851" } ] }, { "title": "Insights on the involvement of (-)-epigallocatechin gallate in ER stress-mediated apoptosis in age-related macular degeneration.", "journal": "Apoptosis : an international journal on programmed cell death", "date": "2017", "authors": "Karthikeyan B, Harini L, Krishnakumar V, Kannan VR, Sundar K, Kathiresan T", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "27778132", "url": "https://glygen.org/publication/PubMed/27778132" } ] }, { "title": "Control of diabetic hyperglycaemia and insulin resistance through TSC22D4.", "journal": "Nat. Commun.", "date": "2016", "authors": "Ekim Ustunel B, Friedrich K, Maida A, Wang X, Krones-Herzig A, Seibert O, Sommerfeld A, Jones A, Sijmonsma TP, Sticht C, Gretz N, Fleming T, Nawroth PP, Stremmel W, Rose AJ, Berriel-Diaz M, Bluher M, Herzig S", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "27827363", "url": "https://glygen.org/publication/PubMed/27827363" } ] }, { "title": "Tetramethylpyrazine Analogue CXC195 Protects Against Dopaminergic Neuronal Apoptosis via Activation of PI3K/Akt/GSK3beta Signaling Pathway in 6-OHDA-Induced Parkinson's Disease Mice.", "journal": "Neurochemical research", "date": "2017", "authors": "Chen L, Cheng L, Wei X, Yuan Z, Wu Y, Wang S, Ren Z, Liu X, Liu H", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28005221", "url": "https://glygen.org/publication/PubMed/28005221" } ] }, { "title": "A ZIP6-ZIP10 heteromer controls NCAM1 phosphorylation and integration into focal adhesion complexes during epithelial-to-mesenchymal transition.", "journal": "Sci. Rep.", "date": "2017", "authors": "Brethour D, Mehrabian M, Williams D, Wang X, Ghodrati F, Ehsani S, Rubie EA, Woodgett JR, Sevalle J, Xi Z, Rogaeva E, Schmitt-Ulms G", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28098160", "url": "https://glygen.org/publication/PubMed/28098160" } ] }, { "title": "Infiltrating mast cells promote renal cell carcinoma angiogenesis by modulating PI3K-->AKT-->GSK3beta-->AM signaling.", "journal": "Oncogene", "date": "2017", "authors": "Chen Y, Li C, Xie H, Fan Y, Yang Z, Ma J, He D, Li L", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28114284", "url": "https://glygen.org/publication/PubMed/28114284" } ] }, { "title": "The Antimalarial Effect of Curcumin Is Mediated by the Inhibition of Glycogen Synthase Kinase-3beta.", "journal": "Journal of medicinal food", "date": "2017", "authors": "Ali AH, Sudi S, Basir R, Embi N, Sidek HM", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28146408", "url": "https://glygen.org/publication/PubMed/28146408" } ] }, { "title": "Intranasal BMP9 Ameliorates Alzheimer Disease-Like Pathology and Cognitive Deficits in APP/PS1 Transgenic Mice.", "journal": "Frontiers in molecular neuroscience", "date": "2017", "authors": "Wang Zigao, Xiong Lu, Wan Wenbin, Duan Lijie, Bai Xiaojing, Zu Hengbing", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28228716", "url": "https://glygen.org/publication/PubMed/28228716" } ] }, { "title": "GSK3 activity regulates rhythms in hippocampal clock gene expression and synaptic plasticity.", "journal": "Hippocampus", "date": "2017", "authors": "Besing RC, Rogers CO, Paul JR, Hablitz LM, Johnson RL, McMahon LL, Gamble KL", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28556462", "url": "https://glygen.org/publication/PubMed/28556462" } ] }, { "title": "Ginkgolide K attenuates neuronal injury after ischemic stroke by inhibiting mitochondrial fission and GSK-3beta-dependent increases in mitochondrial membrane permeability.", "journal": "Oncotarget", "date": "2017", "authors": "Zhou X, Wang HY, Wu B, Cheng CY, Xiao W, Wang ZZ, Yang YY, Li P, Yang H", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28591721", "url": "https://glygen.org/publication/PubMed/28591721" } ] }, { "title": "Inhibition of ERK1/2 Restores GSK3\u03b2 Activity and Protein Synthesis Levels in a Model of Tuberous Sclerosis.", "journal": "Scientific reports", "date": "2017-06-23", "authors": "Pal Rituraj, Bondar Vitaliy V, Adamski Carolyn J, Rodney George G, Sardiello Marco", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28646232", "url": "https://glygen.org/publication/PubMed/28646232" } ] }, { "title": "Inhibition of Aurora Kinase A Induces Necroptosis in Pancreatic Carcinoma.", "journal": "Gastroenterology", "date": "2017", "authors": "Xie Y, Zhu S, Zhong M, Yang M, Sun X, Liu J, Kroemer G, Lotze M, Zeh HJ 3rd, Kang R, Tang D", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28764929", "url": "https://glygen.org/publication/PubMed/28764929" } ] }, { "title": "In vivo regulation of glycogen synthase kinase 3\u03b2 activity in neurons and brains.", "journal": "Scientific reports", "date": "2017-08-17", "authors": "Krishnankutty Ambika, Kimura Taeko, Saito Taro, Aoyagi Kyota, Asada Akiko, Takahashi Shin-Ichiro, Ando Kanae, Ohara-Imaizumi Mica, Ishiguro Koichi, Hisanaga Shin-Ichi", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28819213", "url": "https://glygen.org/publication/PubMed/28819213" } ] }, { "title": "Failure to Inactivate Nuclear GSK3beta by Ser(389)-Phosphorylation Leads to Focal Neuronal Death and Prolonged Fear Response.", "journal": "Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology", "date": "2018", "authors": "Thornton TM, Hare B, Colie S, Pendlebury WW, Nebreda AR, Falls W, Jaworski DM, Rincon M", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28832021", "url": "https://glygen.org/publication/PubMed/28832021" } ] }, { "title": "Prenatal Alcohol Exposure Leads to Enhanced Serine 9 Phosphorylation of Glycogen Synthase Kinase-3\u03b2 (GSK-3\u03b2) in the Hippocampal Dentate Gyrus of Adult Mouse.", "journal": "Alcoholism, clinical and experimental research", "date": "2017-11", "authors": "Cunningham Lee Anna, Newville Jessie, Li Lu, Tapia Phillip, Allan Andrea M, Valenzuela C Fernando", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28865114", "url": "https://glygen.org/publication/PubMed/28865114" } ] }, { "title": "Cancer/testis antigen PIWIL2 suppresses circadian rhythms by regulating the stability and activity of BMAL1 and CLOCK.", "journal": "Oncotarget", "date": "2017", "authors": "Lu Y, Zheng X, Hu W, Bian S, Zhang Z, Tao D, Liu Y, Ma Y", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28903391", "url": "https://glygen.org/publication/PubMed/28903391" } ] }, { "title": "Loss of protein phosphatase 2A regulatory subunit B56delta promotes spontaneous tumorigenesis in vivo.", "journal": "Oncogene", "date": "2018", "authors": "Lambrecht C, Libbrecht L, Sagaert X, Pauwels P, Hoorne Y, Crowther J, Louis JV, Sents W, Sablina A, Janssens V", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "28967903", "url": "https://glygen.org/publication/PubMed/28967903" } ] }, { "title": "Dihydromyricetin exerts a rapid antidepressant-like effect in association with enhancement of BDNF expression and inhibition of neuroinflammation.", "journal": "Psychopharmacology", "date": "2018-01", "authors": "Ren Zhaoxiang, Yan Pengju, Zhu Liushuai, Yang Huicui, Zhao Yafei, Kirby Brian P, Waddington John L, Zhen Xuechu", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "29058041", "url": "https://glygen.org/publication/PubMed/29058041" } ] }, { "title": "Inhibition of Glycogen Synthase Kinase 3beta Blocks Mesomesenchymal Transition and Attenuates Streptococcus pneumonia-Mediated Pleural Injury in Mice.", "journal": "The American journal of pathology", "date": "2017", "authors": "Boren J, Shryock G, Fergis A, Jeffers A, Owens S, Qin W, Koenig KB, Tsukasaki Y, Komatsu S, Ikebe M, Idell S, Tucker TA", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "29073967", "url": "https://glygen.org/publication/PubMed/29073967" } ] }, { "title": "BRD7 regulates the insulin-signaling pathway by increasing phosphorylation of GSK3beta.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2018", "authors": "Golick L, Han Y, Kim Y, Park SW", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "29127434", "url": "https://glygen.org/publication/PubMed/29127434" } ] }, { "title": "Fbxo4-mediated degradation of Fxr1 suppresses tumorigenesis in head and neck squamous cell carcinoma.", "journal": "Nat. Commun.", "date": "2017", "authors": "Qie S, Majumder M, Mackiewicz K, Howley BV, Peterson YK, Howe PH, Palanisamy V, Diehl JA", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "29142209", "url": "https://glygen.org/publication/PubMed/29142209" } ] }, { "title": "Inositol polyphosphates contribute to cellular circadian rhythms: Implications for understanding lithium's molecular mechanism.", "journal": "Cellular signalling", "date": "2018", "authors": "Wei H, Landgraf D, Wang G, McCarthy MJ", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "29331582", "url": "https://glygen.org/publication/PubMed/29331582" } ] }, { "title": "Dietary Total Prenylflavonoids from the Fruits of Psoralea corylifolia L. Prevents Age-Related Cognitive Deficits and Down-Regulates Alzheimer's Markers in SAMP8 Mice.", "journal": "Molecules (Basel, Switzerland)", "date": "2018", "authors": "Chen ZJ, Yang YF, Zhang YT, Yang DH", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "29346315", "url": "https://glygen.org/publication/PubMed/29346315" } ] }, { "title": "Influence of sevoflurane exposure on mitogen-activated protein kinases and Akt/GSK-3beta/CRMP-2 signaling pathways in the developing rat brain.", "journal": "Experimental and therapeutic medicine", "date": "2018", "authors": "Liu Y, Liu C, Zeng M, Han X, Zhang K, Fu Y, Li J, Li Y", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "29434807", "url": "https://glygen.org/publication/PubMed/29434807" } ] }, { "title": "Glycogen synthase kinase 3beta promotes liver innate immune activation by restraining AMP-activated protein kinase activation.", "journal": "Journal of hepatology", "date": "2018", "authors": "Zhou H, Wang H, Ni M, Yue S, Xia Y, Busuttil RW, Kupiec-Weglinski JW, Lu L, Wang X, Zhai Y", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "29452207", "url": "https://glygen.org/publication/PubMed/29452207" } ] }, { "title": "SIRT2 deacetylase regulates the activity of GSK3 isoforms independent of inhibitory phosphorylation.", "journal": "eLife", "date": "2018", "authors": "Sarikhani M, Mishra S, Maity S, Kotyada C, Wolfgeher D, Gupta MP, Singh M, Sundaresan NR", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "29504933", "url": "https://glygen.org/publication/PubMed/29504933" } ] }, { "title": "Seipin deficiency in mice causes loss of dopaminergic neurons via aggregation and phosphorylation of alpha-synuclein and neuroinflammation.", "journal": "Cell death & disease", "date": "2018", "authors": "Wang L, Hong J, Wu Y, Liu G, Yu W, Chen L", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "29670081", "url": "https://glygen.org/publication/PubMed/29670081" } ] }, { "title": "Antidepressant effects of creatine on amyloid beta1-40-treated mice: The role of GSK-3beta/Nrf2 pathway.", "journal": "Progress in neuro-psychopharmacology & biological psychiatry", "date": "2018", "authors": "Rosa JM, Pazini FL, Cunha MP, Colla ARS, Manosso LM, Mancini G, Souza ACG, de Bem AF, Prediger RD, Rodrigues ALS", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "29753049", "url": "https://glygen.org/publication/PubMed/29753049" } ] }, { "title": "Geranylgeraniol Prevents Statin-Dependent Myotoxicity in C2C12 Muscle Cells through RAP1 GTPase Prenylation and Cytoprotective Autophagy.", "journal": "Oxidative medicine and cellular longevity", "date": "2018", "authors": "Jaskiewicz A, Pajak B, Litwiniuk A, Urbanska K, Orzechowski A", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "29951166", "url": "https://glygen.org/publication/PubMed/29951166" } ] }, { "title": "Protective Effects of 6-(Methylsulfinyl)hexyl Isothiocyanate on Abeta1-42-Induced Cognitive Deficit, Oxidative Stress, Inflammation, and Apoptosis in Mice.", "journal": "International journal of molecular sciences", "date": "2018", "authors": "Morroni F, Sita G, Graziosi A, Turrini E, Fimognari C, Tarozzi A, Hrelia P", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "30021941", "url": "https://glygen.org/publication/PubMed/30021941" } ] }, { "title": "Enrichment of cancer stem cells via beta-catenin contributing to the tumorigenesis of hepatocellular carcinoma.", "journal": "BMC cancer", "date": "2018", "authors": "Pandit H, Li Y, Li X, Zhang W, Li S, Martin RCG", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "30075764", "url": "https://glygen.org/publication/PubMed/30075764" } ] }, { "title": "Myostatin inhibits glucose uptake via suppression of insulin-dependent and -independent signaling pathways in myoblasts.", "journal": "Physiological reports", "date": "2018", "authors": "Liu XH, Bauman WA, Cardozo CP", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "30252210", "url": "https://glygen.org/publication/PubMed/30252210" } ] }, { "title": "Intranasal Insulin Prevents Anesthesia-induced Cognitive Impairments in Aged Mice.", "journal": "Current Alzheimer research", "date": "2019", "authors": "Li Xing, Run Xiaoqin, Wei Zhen, Zeng Kuan, Liang Zhihou, Huang Fang, Ke Dan, Wang Qun, Wang Jian-Zhi, Liu Rong, Zhang Bin, Wang Xiaochuan", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "30381076", "url": "https://glygen.org/publication/PubMed/30381076" } ] }, { "title": "N-(3-methoxybenzyl)-(9Z,12Z,15Z)-octadecatrienamide promotes bone formation via the canonical Wnt/beta-catenin signaling pathway.", "journal": "Phytotherapy research : PTR", "date": "2019", "authors": "Wang T, Sun CH, Zhong HB, Gong Y, Cui ZK, Xie J, Wang YP, Liang C, Cao HH, Chen XR, Zou ZP, Li SF, Bai XC", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "30768733", "url": "https://glygen.org/publication/PubMed/30768733" } ] }, { "title": "Chronic cerebral hypoperfusion upregulates leptin receptor expression in astrocytes and tau phosphorylation in tau transgenic mice.", "journal": "Neuroscience letters", "date": "2019", "authors": "Shimada T, Shindo A, Matsuyama H, Yata K, Niwa A, Sasaki R, Ayaki T, Maki T, Wakita H, Tomimoto H", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "30954605", "url": "https://glygen.org/publication/PubMed/30954605" } ] }, { "title": "Underlying mechanisms of recombinant adeno-associated virus-mediated bicaudal C homolog 1 overexpression in the medial prefrontal cortex of mice with induced depressive-like behaviors.", "journal": "Brain research bulletin", "date": "2019", "authors": "Wang Z, Zhou D, Li S, Zhang Y, Wang C", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "31102751", "url": "https://glygen.org/publication/PubMed/31102751" } ] }, { "title": "The PI3K/Akt/GSK-3beta/ROS/eIF2B pathway promotes breast cancer growth and metastasis via suppression of NK cell cytotoxicity and tumor cell susceptibility.", "journal": "Cancer biology & medicine", "date": "2019", "authors": "Jin F, Wu Z, Hu X, Zhang J, Gao Z, Han X, Qin J, Li C, Wang Y", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "31119045", "url": "https://glygen.org/publication/PubMed/31119045" } ] }, { "title": "Adenosine N1-Oxide Exerts Anti-inflammatory Effects through the PI3K/Akt/GSK-3beta Signaling Pathway and Promotes Osteogenic and Adipocyte Differentiation.", "journal": "Biological & pharmaceutical bulletin", "date": "2019", "authors": "Ohashi E, Kohno K, Arai N, Harashima A, Ariyasu T, Ushio S", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "31155593", "url": "https://glygen.org/publication/PubMed/31155593" } ] }, { "title": "Adiponectin improves long-term potentiation in the 5XFAD mouse brain.", "journal": "Scientific reports", "date": "2019", "authors": "Wang M, Jo J, Song J", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "31222110", "url": "https://glygen.org/publication/PubMed/31222110" } ] }, { "title": "Grape seed proanthocyanidins ameliorate neuronal oxidative damage by inhibiting GSK-3beta-dependent mitochondrial permeability transition pore opening in an experimental model of sporadic Alzheimer's disease.", "journal": "Aging", "date": "2019", "authors": "Sun Q, Jia N, Li X, Yang J, Chen G", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "31232699", "url": "https://glygen.org/publication/PubMed/31232699" } ] }, { "title": "Isorhynchophylline exerts antidepressant-like effects in mice via modulating neuroinflammation and neurotrophins: involvement of the PI3K/Akt/GSK-3beta signaling pathway.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2019", "authors": "Xian YF, Ip SP, Li HQ, Qu C, Su ZR, Chen JN, Lin ZX", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "31233346", "url": "https://glygen.org/publication/PubMed/31233346" } ] }, { "title": "Augmented O-GlcNAcylation attenuates intermittent hypoxia-induced cardiac remodeling through the suppression of NFAT and NF-kappaB activities in mice.", "journal": "Hypertension research : official journal of the Japanese Society of Hypertension", "date": "2019", "authors": "Nakagawa T, Furukawa Y, Hayashi T, Nomura A, Yokoe S, Moriwaki K, Kato R, Ijiri Y, Yamaguchi T, Izumi Y, Yoshiyama M, Asahi M", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9WV60", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "31409917", "url": "https://glygen.org/publication/PubMed/31409917" } ] }, { "title": "Isoflurane aggravates peripheral and central insulin resistance in high-fat diet/streptozocin-induced type 2 diabetic mice.", "journal": "Brain research", "date": "2020-01-15", "authors": "Fang Xin, Xia Tianjiao, Xu Fangxia, Wu Hao, Ma Zhengliang, Zhao Xin, Gu Xiaoping", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "31672472", "url": "https://glygen.org/publication/PubMed/31672472" } ] }, { "title": "Innate sensitivity to stress facilitates inflammation, alters metabolism and shortens lifespan in a mouse model of social hierarchy.", "journal": "Aging", "date": "2019-11-09", "authors": "Bairachnaya Maryia, Agranyoni Oryan, Antoch Marina, Michaelevski Izhak, Pinhasov Albert", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "31707362", "url": "https://glygen.org/publication/PubMed/31707362" } ] }, { "title": "Inhibitory effects on melanogenesis by thymoquinone are mediated through the \u03b2\u2011catenin pathway in B16F10 mouse melanoma cells.", "journal": "International journal of oncology", "date": "2020-01", "authors": "Jeong Han, Yu Seon-Mi, Kim Song Ja", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "31789395", "url": "https://glygen.org/publication/PubMed/31789395" } ] }, { "title": "Disulfiram combined with copper induces immunosuppression via PD-L1 stabilization in hepatocellular carcinoma.", "journal": "American journal of cancer research", "date": "2019", "authors": "Zhou Binghai, Guo Lei, Zhang Bo, Liu Shuang, Zhang Kewei, Yan Jiuliang, Zhang Wentao, Yu Mincheng, Chen Zheng, Xu Yongfeng, Xiao Yongsheng, Zhou Jian, Fan Jia, Li Hui, Ye Qinghai", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "31815045", "url": "https://glygen.org/publication/PubMed/31815045" } ] }, { "title": "[The role of GSK3\u03b2 in adipose tissue inflammation induced by bisphenol-A in high fat diet fed mice].", "journal": "Wei sheng yan jiu = Journal of hygiene research", "date": "2019-11", "authors": "Zhang Xiaofei, Ge Xiaolei, Lu Xiaotong, Yuan Shaoyun, Ji Keke, Du Zhiyuan, Zhu Qixing, Shen Tong", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "31875823", "url": "https://glygen.org/publication/PubMed/31875823" } ] }, { "title": "Dopamine D3 receptor and GSK3beta signaling mediate deficits in novel object recognition memory within dopamine transporter knockdown mice.", "journal": "Journal of biomedical science", "date": "2020", "authors": "Chang PK, Chu J, Tsai YT, Lai YH, Chen JC", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "31900153", "url": "https://glygen.org/publication/PubMed/31900153" } ] }, { "title": "A peroxidase mimetic protects skeletal muscle cells from peroxide challenge and stimulates insulin signaling.", "journal": "American journal of physiology. Cell physiology", "date": "2020-06-01", "authors": "Eccardt Amanda M, Pelzel Ross J, Mattathil Lyn, Moon Yerin A, Mannino Mark H, Janowiak Blythe E, Fisher Jonathan S", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "32348172", "url": "https://glygen.org/publication/PubMed/32348172" } ] }, { "title": "Age-related loss of neural stem cell O-GlcNAc promotes a glial fate switch through STAT3 activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "White CW 3rd, Fan X, Maynard JC, Wheatley EG, Bieri G, Couthouis J, Burlingame AL, Villeda SA", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "Q9WV60", "url": "https://oglcnac.org/atlas/detail/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "32848054", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "title": "Pharmacological Chaperones Attenuate the Development of Opioid Tolerance.", "journal": "International journal of molecular sciences", "date": "2020-10-13", "authors": "Okuyama Youta, Jin Hisayo, Kokubun Hiroshi, Aoe Tomohiko", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "33066035", "url": "https://glygen.org/publication/PubMed/33066035" } ] }, { "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.", "journal": "Brain : a journal of neurology", "date": "2020", "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9WV60", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "33300544", "url": "https://glygen.org/publication/PubMed/33300544" } ] }, { "title": "\u03b2\u2011Lapachone ameliorates L\u2011DOPA\u2011induced dyskinesia in\u00a0a\u00a06\u2011OHDA\u2011induced mouse model of Parkinson's disease.", "journal": "Molecular medicine reports", "date": "2021-03", "authors": "Ryu Young-Kyoung, Park Hye-Yeon, Go Jun, Lee In-Bok, Choi Young-Keun, Lee Chul-Ho, Kim Kyoung-Shim", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "33495840", "url": "https://glygen.org/publication/PubMed/33495840" } ] }, { "title": "Silencing of Sphingosine kinase 1 Affects Maturation Pathways in Mouse Neonatal Cardiomyocytes.", "journal": "International journal of molecular sciences", "date": "2021-03-31", "authors": "Jozefczuk Ewelina, Szczepaniak Piotr, Guzik Tomasz Jan, Siedlinski Mateusz", "evidence": [ { "database": "iPTMnet", "id": "Q9WV60", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "33807180", "url": "https://glygen.org/publication/PubMed/33807180" } ] }, { "title": "O-GlcNAcylation-induced GSK-3\u03b2 activation deteriorates pressure overload-induced heart failure via lack of compensatory cardiac hypertrophy in mice.", "journal": "Frontiers in endocrinology", "date": "2023", "authors": "Matsuno Mahito, Yokoe Shunichi, Nagatsuka Takehiro, Morihara Hirofumi, Moriwaki Kazumasa, Asahi Michio", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9WV60", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9WV60" } ], "reference": [ { "type": "PubMed", "id": "37033243", "url": "https://glygen.org/publication/PubMed/37033243" } ] }, { "title": "REDD1-dependent GSK3\u03b2 dephosphorylation promotes NF-\u03baB activation and macrophage infiltration in the retina of diabetic mice.", "journal": "The Journal of biological chemistry", "date": "2023-08", "authors": "Sunilkumar Siddharth, VanCleave Ashley M, McCurry Christopher M, Toro Allyson L, Stevens Shaunaci A, Kimball Scot R, Dennis Michael D", "evidence": [ { "database": "RefSeq", "id": "NP_062801", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062801" }, { "database": "RefSeq", "id": "NP_001334161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334161" } ], "reference": [ { "type": "PubMed", "id": "37392853", "url": "https://glygen.org/publication/PubMed/37392853" } ] }, { "title": "GSK3\u03b2 Inhibition Ameliorates Atherosclerotic Calcification.", "journal": "International journal of molecular sciences", "date": "2023-07-19", "authors": "Cai Xinjiang, Zhao Yan, Yang Yang, Wu Xiuju, Zhang Li, Ma Jocelyn A, Ji Jaden, Bostr\u00f6m Kristina I, Yao Yucheng", "evidence": [ { "database": "RefSeq", "id": "NP_062801", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062801" }, { "database": "RefSeq", "id": "NP_001334161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334161" } ], "reference": [ { "type": "PubMed", "id": "37511396", "url": "https://glygen.org/publication/PubMed/37511396" } ] }, { "title": "Glycogen synthase kinase 3 controls T-cell exhaustion by regulating NFAT activation.", "journal": "Cellular & molecular immunology", "date": "2023-10", "authors": "Fu Yubing, Wang Jinjia, Liu Chenfeng, Liao Kunyu, Gao Xianjun, Tang Ronghan, Fan Binbin, Hong Yazhen, Xiao Nengming, Xiao Changchun, Liu Wen-Hsien", "evidence": [ { "database": "RefSeq", "id": "NP_001334161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334161" }, { "database": "RefSeq", "id": "NP_062801", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062801" } ], "reference": [ { "type": "PubMed", "id": "37553428", "url": "https://glygen.org/publication/PubMed/37553428" } ] }, { "title": "Diabetic Endothelial Cell Glycogen Synthase Kinase 3\u03b2 Activation Induces VCAM1 Ectodomain Shedding.", "journal": "International journal of molecular sciences", "date": "2023-09-14", "authors": "Brishti Masuma Akter, Raghavan Somasundaram, Lamar Kennedy, Singh Udai P, Collier Daniel M, Leo M Dennis", "evidence": [ { "database": "RefSeq", "id": "NP_062801", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062801" }, { "database": "RefSeq", "id": "NP_001334161", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334161" } ], "reference": [ { "type": "PubMed", "id": "37762417", "url": "https://glygen.org/publication/PubMed/37762417" } ] } ], "pathway": [ { "id": "mmu:56637", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56637", "resource": "KEGG Pathway" }, { "id": "R-MMU-195253", "name": "Degradation of beta-catenin by the destruction complex", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-195253", "resource": "Reactome", "description": "Degradation of beta-catenin by the destruction complex" }, { "id": "R-MMU-196299", "name": "Beta-catenin phosphorylation cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-196299", "resource": "Reactome", "description": "Beta-catenin phosphorylation cascade" }, { "id": "R-MMU-3371453", "name": "Regulation of HSF1-mediated heat shock response", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3371453", "resource": "Reactome", "description": "Regulation of HSF1-mediated heat shock response" }, { "id": "R-MMU-399956", "name": "CRMPs in Sema3A signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-399956", "resource": "Reactome", "description": "CRMPs in Sema3A signaling" }, { "id": "R-MMU-4641262", "name": "Disassembly of the destruction complex and recruitment of AXIN to the membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-4641262", "resource": "Reactome", "description": "Disassembly of the destruction complex and recruitment of AXIN to the membrane" }, { "id": "R-MMU-5250924", "name": "B-WICH complex positively regulates rRNA expression", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5250924", "resource": "Reactome", "description": "B-WICH complex positively regulates rRNA expression" }, { "id": "R-MMU-5610785", "name": "GLI3 is processed to GLI3R by the proteasome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5610785", "resource": "Reactome", "description": "GLI3 is processed to GLI3R by the proteasome" }, { "id": "R-MMU-9762114", "name": "GSK3B and BTRC:CUL1-mediated-degradation of NFE2L2", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9762114", "resource": "Reactome", "description": "GSK3B and BTRC:CUL1-mediated-degradation of NFE2L2" } ], "orthologs": [ { "uniprot_canonical_ac": "P18266-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "Gsk3b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDMWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST", "length": 420 }, "evidence": [ { "id": "45224673", "url": "http://www.informatics.jax.org/homology/45224673", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P38615-1", "protein_name": "Serine/threonine-protein kinase RIM11/MSD1", "gene_name": "RIM11", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MNIQSNNSPNLSNNIVSKQVYYAHPPPTIDPNDPVQISFPTTEVVGHGSFGVVFATVIQETNEKVAIKKVLQDKRFKNRELEIMKMLSHINIIDLKYFFYERDSQDEIYLNLILEYMPQSLYQRLRHFVHQRTPMSRLEIKYYMFQLFKSLNYLHHFANVCHRDIKPQNLLVDPETWSLKLCDFGSAKQLKPTEPNVSYICSRYYRAPELIFGATNYTNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPSKQEICSMNPNYMEHKFPQIKPIPLSRVFKKEDDQTVEFLADVLKYDPLERFNALQCLCSPYFDELKLDDGKINQITTDLKLLEFDENVELGHLSPDELSSVKKKLYPKSK", "length": 370 }, "evidence": [ { "id": "Q9WV60", "url": "https://omabrowser.org/oma/group/Q9WV60/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST", "length": 420 }, "evidence": [ { "id": "45224673", "url": "http://www.informatics.jax.org/homology/45224673", "database": "MGI" }, { "id": "Q9WV60", "url": "https://omabrowser.org/oma/group/Q9WV60/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 26, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "glutamatergic synapse", "id": "GO:0098978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098978", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "microtubule", "id": "GO:0005874", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005874", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "postsynaptic density", "id": "GO:0014069", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014069", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "axon", "id": "GO:0030424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030424", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "growth cone", "id": "GO:0030426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030426", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "dendritic spine", "id": "GO:0043197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043197", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "dendritic shaft", "id": "GO:0043198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043198", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "beta-catenin destruction complex", "id": "GO:0030877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030877", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "Wnt signalosome", "id": "GO:1990909", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990909", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "meiotic spindle", "id": "GO:0072687", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072687", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "presynapse", "id": "GO:0098793", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098793", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "membrane-bounded organelle", "id": "GO:0043227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043227", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "Schaffer collateral - CA1 synapse", "id": "GO:0098685", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098685", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 126, "go_terms": [ { "name": "negative regulation of insulin receptor signaling pathway", "id": "GO:0046627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046627", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of axonogenesis", "id": "GO:0050770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050770", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of neuron maturation", "id": "GO:0014043", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014043", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "hepatic stellate cell activation", "id": "GO:0035733", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035733", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "protein phosphorylation", "id": "GO:0006468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006468", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "axonogenesis", "id": "GO:0007409", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007409", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "response to zinc ion", "id": "GO:0010043", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010043", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-threonine phosphorylation", "id": "GO:0010800", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010800", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "cell migration", "id": "GO:0016477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016477", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "neuron projection development", "id": "GO:0031175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031175", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of protein binding", "id": "GO:0032092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032092", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "intracellular signal transduction", "id": "GO:0035556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035556", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of GTPase activity", "id": "GO:0043547", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043547", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of dendrite morphogenesis", "id": "GO:0048814", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048814", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "stem cell differentiation", "id": "GO:0048863", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048863", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "cellular response to retinoic acid", "id": "GO:0071300", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071300", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of canonical Wnt signaling pathway", "id": "GO:0090090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090090", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of protein localization to nucleus", "id": "GO:1900181", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900181", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "cellular response to amyloid-beta", "id": "GO:1904646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904646", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of excitatory postsynaptic potential", "id": "GO:2000463", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000463", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "glycogen metabolic process", "id": "GO:0005977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005977", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "hippocampus development", "id": "GO:0021766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021766", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of protein binding", "id": "GO:0032091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032091", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of protein export from nucleus", "id": "GO:0046827", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046827", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of neuron projection development", "id": "GO:0010977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010977", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "cytoskeleton organization", "id": "GO:0007010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007010", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of protein-containing complex assembly", "id": "GO:0031334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031334", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of cell differentiation", "id": "GO:0045597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045597", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "protein autophosphorylation", "id": "GO:0046777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046777", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of smooth muscle cell proliferation", "id": "GO:0048661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048661", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of dendrite morphogenesis", "id": "GO:0050774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050774", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of cell growth", "id": "GO:0001558", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001558", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "circadian rhythm", "id": "GO:0007623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007623", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "animal organ morphogenesis", "id": "GO:0009887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009887", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of axon extension", "id": "GO:0030516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030516", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of osteoblast proliferation", "id": "GO:0033690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033690", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "bone remodeling", "id": "GO:0046849", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046849", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "cell growth involved in cardiac muscle cell development", "id": "GO:0061049", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061049", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "myoblast fusion", "id": "GO:0007520", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007520", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of autophagy", "id": "GO:0010508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010508", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "Wnt signaling pathway", "id": "GO:0016055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016055", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of protein ubiquitination", "id": "GO:0031398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031398", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of TOR signaling", "id": "GO:0032007", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032007", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of circadian rhythm", "id": "GO:0042752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042752", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "fat cell differentiation", "id": "GO:0045444", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045444", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "transcription by RNA polymerase II", "id": "GO:0006366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006366", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "insulin receptor signaling pathway", "id": "GO:0008286", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008286", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "peptidyl-threonine phosphorylation", "id": "GO:0018107", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018107", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of protein-containing complex assembly", "id": "GO:0031333", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031333", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of apoptotic process", "id": "GO:0042981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042981", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of calcineurin-NFAT signaling cascade", "id": "GO:0070885", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070885", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway", "id": "GO:0097191", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097191", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of microtubule-based process", "id": "GO:0032886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032886", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of neuron apoptotic process", "id": "GO:0043525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043525", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of protein catabolic process", "id": "GO:0045732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045732", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of axon extension", "id": "GO:0045773", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045773", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "canonical Wnt signaling pathway", "id": "GO:0060070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060070", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "cellular response to mechanical stimulus", "id": "GO:0071260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071260", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of protein localization to centrosome", "id": "GO:1904781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904781", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "beta-catenin destruction complex disassembly", "id": "GO:1904886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904886", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of smooth muscle cell apoptotic process", "id": "GO:0034392", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034392", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of neuron migration", "id": "GO:2001223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001223", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "epithelial to mesenchymal transition", "id": "GO:0001837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001837", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of mitochondrial membrane potential", "id": "GO:0010918", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010918", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "peptidyl-serine phosphorylation", "id": "GO:0018105", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018105", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of proteasomal ubiquitin-dependent protein catabolic process", "id": "GO:0032436", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032436", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of MAP kinase activity", "id": "GO:0043407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043407", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of nitric-oxide synthase activity", "id": "GO:0051001", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051001", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of neuron projection development", "id": "GO:0010975", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010975", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "protein kinase B signaling", "id": "GO:0043491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043491", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of synaptic assembly at neuromuscular junction", "id": "GO:0045887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045887", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress", "id": "GO:0070059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070059", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of gene expression by genomic imprinting", "id": "GO:0006349", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006349", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of neuronal synaptic plasticity", "id": "GO:0048168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048168", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "hepatocyte apoptotic process", "id": "GO:0097284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097284", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of long-term synaptic potentiation", "id": "GO:1900271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900271", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of dendrite development", "id": "GO:2000171", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000171", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of DNA biosynthetic process", "id": "GO:2000573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000573", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of cardiac muscle cell differentiation", "id": "GO:2000727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000727", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "cellular response to glucocorticoid stimulus", "id": "GO:0071385", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071385", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of extrinsic apoptotic signaling pathway via death domain receptors", "id": "GO:1902042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902042", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "protein export from nucleus", "id": "GO:0006611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006611", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "establishment of cell polarity", "id": "GO:0030010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030010", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of protein export from nucleus", "id": "GO:0046825", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046825", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "establishment or maintenance of cell polarity", "id": "GO:0007163", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007163", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "maintenance of cell polarity", "id": "GO:0030011", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030011", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "ER overload response", "id": "GO:0006983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006983", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "axon extension", "id": "GO:0048675", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048675", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway in absence of ligand", "id": "GO:0097192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097192", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway", "id": "GO:1901030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901030", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of protein localization to cilium", "id": "GO:1903566", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903566", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of stem cell differentiation", "id": "GO:2000738", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000738", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of mesenchymal stem cell differentiation", "id": "GO:2000740", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000740", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "myotube differentiation", "id": "GO:0014902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014902", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "cellular response to hepatocyte growth factor stimulus", "id": "GO:0035729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035729", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of osteoblast differentiation", "id": "GO:0045667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045667", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of neurotransmitter receptor localization to postsynaptic specialization membrane", "id": "GO:0098696", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098696", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of microtubule cytoskeleton organization", "id": "GO:0070507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070507", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of osteoclast differentiation", "id": "GO:0045672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045672", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of cilium assembly", "id": "GO:0045724", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045724", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of protein localization to centrosome", "id": "GO:1904780", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904780", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "re-entry into mitotic cell cycle", "id": "GO:0000320", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000320", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of cell-matrix adhesion", "id": "GO:0001954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001954", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of cardiac muscle hypertrophy", "id": "GO:0010614", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010614", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "superior temporal gyrus development", "id": "GO:0071109", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071109", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of canonical Wnt signaling pathway involved in osteoblast differentiation", "id": "GO:1905240", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905240", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "meiosis I", "id": "GO:0007127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007127", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "protein localization to microtubule", "id": "GO:0035372", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035372", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of osteoclast proliferation", "id": "GO:0090290", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090290", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "cellular response to interleukin-3", "id": "GO:0036016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036016", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of gene expression via CpG island methylation", "id": "GO:0044027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044027", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of protein acetylation", "id": "GO:1901984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901984", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "positive regulation of mitochondrion organization", "id": "GO:0010822", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010822", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of dopaminergic neuron differentiation", "id": "GO:1904339", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904339", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "presynaptic modulation of chemical synaptic transmission", "id": "GO:0099171", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099171", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of modification of postsynaptic structure", "id": "GO:0099159", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099159", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "neuron projection organization", "id": "GO:0106027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106027", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "regulation of microtubule anchoring at centrosome", "id": "GO:0150101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150101", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "negative regulation of synaptic assembly at neuromuscular junction", "id": "GO:0045886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045886", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 20, "go_terms": [ { "name": "protein kinase A catalytic subunit binding", "id": "GO:0034236", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034236", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "protein kinase activity", "id": "GO:0004672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004672", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "protein serine/threonine kinase activity", "id": "GO:0004674", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004674", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "integrin binding", "id": "GO:0005178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005178", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "tau protein binding", "id": "GO:0048156", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048156", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "NF-kappaB binding", "id": "GO:0051059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051059", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "tau-protein kinase activity", "id": "GO:0050321", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050321", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "beta-catenin binding", "id": "GO:0008013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008013", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "dynein complex binding", "id": "GO:0070840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070840", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "kinase activity", "id": "GO:0016301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016301", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "p53 binding", "id": "GO:0002039", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002039", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "dynactin binding", "id": "GO:0034452", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034452", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "ionotropic glutamate receptor binding", "id": "GO:0035255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035255", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "protein serine kinase activity", "id": "GO:0106310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106310", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" }, { "name": "protein serine/threonine kinase binding", "id": "GO:0120283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120283", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 213, "end_pos": 215, "annotation": "n_glycosylation_sequon" }, { "start_pos": 287, "end_pos": 289, "annotation": "n_glycosylation_sequon" }, { "start_pos": 361, "end_pos": 363, "annotation": "n_glycosylation_sequon" }, { "start_pos": 393, "end_pos": 395, "annotation": "n_glycosylation_sequon" }, { "start_pos": 418, "end_pos": 420, "annotation": "n_glycosylation_sequon" }, { "start_pos": 64, "end_pos": 66, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Mono-ADP-ribosylation by PARP10 negatively regulates kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" }, { "database": "PubMed", "id": "P49841", "url": "https://glygen.org/publication/PubMed/P49841" } ] }, { "annotation": "Phosphorylated by AKT1 and ILK1. Upon insulin-mediated signaling, the activated PKB/AKT1 protein kinase phosphorylates and deactivates GSK3B, resulting in the dephosphorylation and activation of GYS1. Activated by phosphorylation at Tyr-216. Phosphorylation of Ser-9 in the hippocampus peaks at CT0, whereas in the liver it peaks at CT12. Inactivated by phosphorylation at Ser-9 (By similarity). Phosphorylated in a circadian manner in the hippocampus (PubMed:28556462).", "evidence": [ { "database": "UniProtKB", "id": "Q9WV60", "url": "https://www.uniprot.org/uniprot/Q9WV60" }, { "database": "PubMed", "id": "P49841", "url": "https://glygen.org/publication/PubMed/P49841" }, { "database": "PubMed", "id": "23395175", "url": "https://glygen.org/publication/PubMed/23395175" }, { "database": "PubMed", "id": "22057101", "url": "https://glygen.org/publication/PubMed/22057101" }, { "database": "PubMed", "id": "28556462", "url": "https://glygen.org/publication/PubMed/28556462" } ] } ], "interactions": [], "reactions": [ { "id": "12801", "name": "", "equation": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "B2DD29-1", "D3ZML2-1", "P54645-1", "P18265-1", "O08678-1", "O08679-1", "P13286-1", "Q06486-1", "P18266-1", "Q13131-1", "Q8IWQ3-1", "Q8TDC3-1", "P49840-1", "P49841-1", "P48730-1", "Q7KZI7-1", "Q9P0L2-1", "Q16816-1", "Q5EG47-1", "Q5RJI5-1", "Q69Z98-1", "Q05512-1", "Q2NL51-1", "Q8VHJ5-1", "Q9WV60-1", "Q9DC28-1", "P07934-1", "P51136-1", "Q55C57-1", "P83101-1" ], "evidence": [ { "id": "12801", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/12801" } ] }, { "id": "17989", "name": "", "equation": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "B2DD29-1", "D3ZML2-1", "O08875-1", "O35831-1", "D3ZHP7-1", "D4A280-1", "E9PTG8-1", "O35832-1", "O54748-1", "P57760-1", "Q62868-1", "D3ZBE5-1", "P59895-1", "O55099-1", "O88764-1", "P59241-1", "Q91XS8-1", "Q63644-1", "Q7TQP6-1", "Q9Z2P5-1", "P11345-1", "F1LYY7-1", "F1LN87-1", "Q9JIH7-1", "P14056-1", "P35426-1", "P51952-1", "P63086-1", "Q5U2X5-1", "Q5XIT0-1", "Q63117-1", "F1M7Y5-1", "P47196-1", "P47197-1", "P97874-1", "Q03114-1", "Q3MJK5-1", "Q09137-1", "P54645-1", "Q63686-1", "P11275-1", "P08413-1", "P0C1X8-1", "P19139-1", "D4A7V9-1", "Q63184-1", "Q63484-1", "Q9Z1Z1-1", "Q4KM34-1", "Q4KM47-1", "B2GUY1-1", "O08874-1", "O70444-1", "O88831-1", "P0C0R5-1", "P26794-1", "P46892-1", "Q66HE7-1", "Q6XUX2-1", "Q4V8A3-1", "Q62915-1", "Q63185-1", "Q63470-1", "Q62673-1", "Q63433-1", "P53669-1", "P53670-1", "Q63699-1", "Q641Z4-1", "A0A0G2K344-1", "P18265-1", "P39951-1", "B0LT89-1", "A1A5Q6-1", "F1LP90-1", "O08815-1", "O88850-1", "P00539-1", "P0C865-1", "P27791-1", "P63319-1", "P68182-1", "P97924-1", "Q01986-1", "Q06226-1", "Q53UA7-1", "Q62862-1", "Q63454-1", "Q63531-1", "Q63562-1", "Q63572-1", "Q64617-1", "Q66HA1-1", "P09215-1", "O55173-1", "O70150-1", "P05696-1", "P09216-1", "P11730-1", "P13234-1", "P15791-1", "P68403-1", "P97633-1", "P97756-1", "Q62761-1", "Q62762-1", "Q62763-1", "B1WBU5-1", "D3ZGQ5-1", "D4AE59-1", "F1M0Z1-1", "P13286-1", "P49187-1", "Q5RKH1-1", "Q62829-1", "Q63638-1", "Q9JLS3-1", "Q9JM01-1", "Q9R011-1", "Q9R012-1", "D3ZSZ3-1", "Q06486-1", "Q62726-1", "Q63450-1", "Q4KSH7-1", "Q5XIS9-1", "Q63285-1", "Q63553-1", "P67999-1", "O88664-1", "O08678-1", "O08679-1", "Q91ZN7-1", "Q99J82-1", "Q7TNJ7-1", "Q64303-1", "Q66HE5-1", "Q7TPK6-1", "Q64595-1", "P49185-1", "P09217-1", "P36506-1", "P35465-1", "P20793-1", "O88506-1", "Q9Z335-1", "Q7TNL4-1", "Q8R4U9-1", "Q8R4V0-1", "Q8VHF0-1", "Q924U5-1", "Q9WTQ1-1", "Q9Z2A6-1", "D3ZG83-1", "P21708-1", "P27704-1", "Q4V793-1", "Q5MPA9-1", "Q5U2N4-1", "Q62925-1", "Q63538-1", "Q66H84-1", "Q9WTY9-1", "A0A8I6AQN6-1", "O54874-1", "P42346-1", "Q4G050-1", "P70618-1", "Q925B3-1", "Q63796-1", "Q7TT49-1", "Q810W7-1", "Q924I2-1", "Q9R1U5-1", "Q9WTQ0-1", "P0C8E4-1", "P18266-1", "D3Z8E0-1", "D4AE24-1", "D3ZSB7-1", "A4L9P5-1", "D4A6T9-1", "E9PSL7-1", "F1M7N7-1", "F1LXF1-1", "D3Z822-1", "P49186-1", "A0A8I6AWX7-1", "Q9QY78-1", "E9PSK5-1", "A0A0G2JZW9-1", "A0A0G2KB60-1", "D3ZHL6-1", "Q63945-1", "F1LNN8-1", "A0A0G2K5L3-1", "A0A1W2Q671-1", "Q80ZF4-1", "F7FMK8-1", "A0A8I6ATY6-1", "P0C0A1-1", "M0RD40-1", "A0A0G2JVL3-1", "F1LRA7-1", "A0A8I5ZP97-1", "A0A8I6AC38-1", "D3Z837-1", "D3ZL21-1", "A0A8I6AUJ4-1", "F1M7G0-1", "D4A454-1", "D3ZCD7-1", "D3ZFL3-1", "D3ZXB1-1", "A0A8I5ZZZ6-1", "A0A0G2JUP3-1", "D3Z8I4-1", "A0A8I5ZNK2-1", "D3ZRJ7-1", "D4AD76-1", "F1M419-1", "D3ZTD1-1", "A0A8I6ANX6-1", "A0A8I6A165-1", "B5DFG1-1", "A0A8I6A0F8-1", "F1LNJ1-1", "A0A8I6AEL0-1", "M0RBT0-1", "A0A8I6GK52-1", "D4A6T6-1", "A0A8I6A9E8-1", "A0A8I6G1H3-1", "D3ZMG0-1", "F1LUY7-1", "A0A8I6A7D1-1", "A0A8J8XEH6-1", "A0A8I6AD01-1", "A6KB61-1", "Q9Z1L0-1", "G3V783-1", "Q9HCP0-1", "P0C263-1", "Q6ZMQ8-1", "Q2M2I8-1", "P31751-1", "Q13131-1", "Q07912-1", "Q5VT25-1", "O43293-1", "Q9P0L2-1", "P21127-1", "Q9BWU1-1", "Q9UQ88-1", "Q00537-1", "Q8IZL9-1", "Q9UQB9-1", "Q8IWQ3-1", "Q9NYV4-1", "Q13315-1", "Q96GD4-1", "P06493-1", "Q00526-1", "O60566-1", "Q13535-1", "O76039-2", "O94921-1", "Q00535-1", "Q8IVW4-1", "Q9Y243-1", "Q07002-2", "P50613-1", "Q92772-1", "P10398-1", "Q8NFD2-1", "O43683-1", "O14965-1", "P24941-1", "Q15131-1", "Q9NSY1-1", "P33076-1", "Q86TB3-1", "P50750-1", "Q14004-1", "P11802-1", "Q8TDC3-1", "P54646-1", "O00311-1", "Q00536-1", "P11274-1", "P49336-1", "Q96QP1-1", "Q96L96-1", "P31749-1", "O96017-1", "P49760-1", "Q5MAI5-1", "Q00532-1", "Q00534-1", "P49761-4", "Q9HAZ1-1", "P49759-1", "Q96Q40-1", "P41279-1", "P15056-1", "O14757-1", "P68400-1", "Q6XUX3-1", "Q9Y463-1", "Q76MJ5-1", "Q9P2K8-1", "P19525-1", "Q8N568-1", "Q09013-9", "Q9NR20-1", "Q9NZJ5-1", "O15075-1", "Q9C098-1", "P19784-1", "O14578-1", "P53355-1", "O14936-1", "Q8IXL6-1", "Q13627-1", "Q9Y4B6-1", "Q9BQI3-1", "Q9UIK4-1", "Q92630-1", "Q8NEV1-1", "O43781-1", "O75460-1", "Q13557-1", "Q13976-1", "P17252-1", "P41743-1", "Q15418-1", "P51617-1", "Q15349-1", "Q9UQM7-1", "Q13554-1", "Q9NRM7-1", "O95835-1", "Q9H2X6-1", "P49674-1", "Q86Z02-1", "Q16566-1", "Q6P2M8-1", "P78368-1", "Q96NX5-1", "Q9Y6M4-1", "P22612-1", "P57058-1", "Q9H422-1", "Q9NWZ3-1", "Q8IWU2-1", "Q8N5S9-1", "O14976-1", "Q8NE63-1", "Q13555-1", "Q96RR4-1", "Q15139-1", "P11801-1", "O94806-1", "Q13237-1", "Q96S38-1", "Q9UK32-1", "Q8N752-1", "Q14012-1", "P05129-1", "Q9UBS0-1", "O60229-1", "P51812-1", "P05771-1", "Q05655-1", "Q02156-1", "P53667-1", "Q9UPZ9-1", "Q13418-1", "P23443-1", "Q8TF76-1", "Q04759-1", "Q9BZL6-1", "Q05513-1", "Q6VAB6-1", "P49840-1", "P49841-1", "P48730-1", "O75676-1", "O75582-1", "P24723-1", "Q8IVT5-1", "Q8IU85-1", "Q96GX5-1", "P48729-1", "P22694-1", "P17612-1", "Q16659-1", "Q02750-1", "O14733-1", "Q8TD08-1", "Q96RG2-1", "Q9Y2U5-1", "Q6P0Q8-1", "P46734-1", "P51957-1", "Q6DT37-1", "Q5VST9-1", "Q9Y5S2-1", "Q9UQ07-1", "P28482-1", "P27361-1", "P00540-1", "O75914-1", "Q99759-1", "Q99558-1", "P51955-1", "Q8IW41-1", "Q9Y6R4-1", "Q13164-1", "P53779-1", "P51956-1", "Q6P3R8-1", "Q13163-1", "Q13233-1", "O60307-1", "Q56UN5-1", "O95382-1", "Q02779-1", "O15021-5", "P45985-1", "Q86SG6-1", "Q6ZWH5-1", "Q86YV6-1", "Q8WXR4-1", "Q8NEV4-1", "Q6A1A2-1", "P80192-1", "P31152-1", "O15264-1", "P52564-1", "P27448-5", "Q96QS6-1", "O60285-1", "Q7Z2Y5-1", "Q15759-1", "P49137-1", "Q16644-1", "Q96L34-1", "P53778-1", "Q9UBE8-1", "O95819-1", "Q8N4C8-1", "P36507-1", "Q96Q04-1", "P53671-1", "Q8NG66-1", "Q9Y4K4-1", "Q9HBH9-1", "Q96PY6-1", "Q9H093-1", "O43318-1", "Q16584-1", "Q7KZI7-1", "Q9BUB5-1", "Q8IY84-1", "P45984-1", "Q99683-1", "O43283-1", "Q12852-1", "Q16539-1", "Q38SD2-1", "Q92918-1", "Q9Y2H9-1", "Q8TD19-1", "Q5TCX8-1", "Q9NYL2-1", "P42345-1", "P20794-1", "Q8IVH8-1", "Q12851-1", "Q14680-1", "P45983-1", "Q13153-1", "Q6ZN16-1", "Q5S007-1", "Q9NYY3-1", "Q9Y6S9-1", "Q15772-5", "Q16816-1", "Q16513-1", "Q99570-1", "Q86V86-1", "Q16512-1", "P57059-1", "Q9BXM7-1", "Q13464-1", "Q9P286-1", "Q8N165-1", "Q99640-1", "P57078-1", "O14730-1", "O96013-1", "Q9H4B4-1", "O43930-1", "Q13523-1", "Q9HBY8-2", "O75116-1", "Q52WX2-1", "O00141-1", "P0C264-1", "Q96BR1-1", "Q9P1W9-1", "Q6P5Z2-1", "Q96LW2-1", "Q9H2G2-1", "O15530-1", "Q9NQU5-1", "Q13177-1", "Q9BRS2-1", "P48736-1", "P11309-1", "Q13546-1", "Q9NRH2-1", "P53350-1", "Q9H0K1-1", "P42336-1", "P51817-1", "P04049-1", "O00444-1", "P78527-1", "Q96Q15-1", "Q9Y2K2-5", "Q96S44-1", "Q9Y572-1", "Q9BVS4-1", "O43353-1", "O95747-1", "O00506-1", "Q15208-1", "Q8N2I9-1", "Q9BXU1-1", "Q9BYT3-1", "Q9UEE5-1", "Q9UEW8-1", "O94768-1", "Q8TDR2-1", "Q9BX84-1", "Q96QT4-1", "Q96KB5-1", "A0A0B4J2F2-1", "Q9NRP7-1", "P78362-1", "Q9BXA7-1", "O75385-1", "Q5TCY1-1", "Q9Y3S1-1", "Q8WZ42-1", "O75716-1", "Q13188-1", "Q13043-1", "Q96PN8-1", "Q9Y2H1-1", "O75962-1", "Q9UPE1-1", "Q15569-1", "Q8IYT8-1", "Q6PHR2-1", "Q96C45-1", "Q9H2K8-1", "Q9Y6E0-1", "Q96S53-1", "P21675-1", "Q7L7X3-1", "Q9UL54-1", "Q9UKE5-1", "Q96SB4-2", "Q15831-1", "Q96J92-1", "Q9BXA6-1", "Q96PF2-1", "Q59H18-2", "Q6SA08-1", "Q6IQ55-1", "Q8TAS1-1", "P33981-1", "Q99986-1", "O94804-1", "Q9P289-1", "Q8WU08-1", "Q9NY57-1", "Q86UX6-1", "Q9UKI8-1", "Q86UE8-1", "Q86Y07-1", "Q9BYP7-1", "Q9H4A3-1", "Q9UHD2-1", "Q9HC98-1", "Q8TDX7-1", "Q9Y2I7-1", "O14920-1", "Q14296-1", "P42338-1", "Q5SYL1-1", "E9Q3S4-1", "Q62070-1", "O54967-1", "Q9Z188-1", "Q9JKK8-1", "Q8R4K2-1", "Q05512-1", "Q8C050-1", "Q3UHJ0-1", "Q7TT50-1", "O70405-1", "Q99MQ3-1", "P49025-1", "Q03141-1", "Q9Z0R0-1", "P04627-1", "Q60823-1", "Q8BZ25-1", "Q924C5-1", "Q8BRK8-1", "Q91ZB0-1", "P31750-1", "Q5EG47-1", "Q9CXB8-1", "O88445-1", "Q5RJI5-1", "Q9Z1S0-1", "O08901-1", "P49615-1", "Q04899-1", "Q3TZA2-1", "Q8BLF2-1", "Q8R3L8-1", "Q9WUA6-1", "P24788-1", "O35495-1", "Q14AX6-1", "Q3UMM4-1", "Q64261-1", "Q8BWD8-1", "Q3UTQ8-1", "Q8CEQ0-1", "Q03147-1", "Q8K0D0-1", "O35491-1", "O35493-1", "Q9Z265-1", "Q69ZA1-1", "Q80YP0-1", "Q9JHU3-1", "Q9QUK0-1", "P11440-1", "Q62388-1", "Q91Z96-1", "O35280-1", "O35492-1", "P28028-3", "Q99J95-1", "P30285-1", "P97377-1", "Q9Z0H0-1", "O70126-1", "O70589-1", "P97477-1", "P79621-1", "Q04735-1", "Q3V3A1-1", "Q69Z98-1", "Q6PAJ1-1", "P22518-1", "P54265-1", "Q6XUX1-1", "Q03963-1", "O54833-1", "Q80TR8-1", "Q60737-1", "Q80YE7-1", "Q8BWQ5-1", "Q9JLM8-1", "Q6PGN3-1", "Q99KY4-1", "Q61214-1", "Q8VDF3-1", "Q922Y0-1", "O54784-1", "Q9EQY0-1", "Q8BI55-1", "Q9Z2B5-1", "Q9Z2E3-1", "Q5U4C9-1", "Q5MJS3-1", "Q9Z2R9-1", "Q9QZ05-1", "Q91YS8-1", "P68404-1", "Q91YA2-1", "P68181-1", "Q7TPS0-1", "Q8BTH8-1", "Q8C4X2-1", "Q8K1Y2-1", "P16054-1", "P28867-1", "O88904-1", "Q9ERH7-1", "Q3V016-1", "Q8BVP5-1", "Q8BW96-1", "Q9QYK9-1", "P08414-1", "Q8C078-1", "P53349-1", "Q3U1V8-1", "Q66L42-1", "Q80XI6-1", "Q80YE4-1", "Q3TYD6-1", "O08648-1", "Q07174-1", "Q1HKZ5-1", "Q61083-1", "Q3U214-1", "Q8VBY2-1", "P49138-1", "Q02111-1", "P53668-1", "Q9Z2B9-1", "P70218-1", "Q62406-1", "Q61084-1", "O88866-1", "Q61410-1", "P20444-1", "Q62074-1", "Q9WUT3-1", "P0C605-1", "P23298-1", "P63318-1", "P18653-1", "Q8BLK9-1", "Q9WUL6-1", "Q9Z1M4-1", "O08911-1", "Q8C0P0-1", "P28652-1", "Q8BZ03-1", "Q60700-1", "Q61161-1", "Q923T9-1", "Q91VB2-1", "Q8VHJ5-1", "Q9QZR5-1", "O55222-1", "Q9JMK2-1", "O54785-1", "O35099-1", "O54992-1", "Q5S006-1", "P18654-1", "Q8BSK8-1", "Q8CIP4-1", "Q811L6-1", "Q8BPM2-1", "Q62101-1", "A2CG49-1", "Q6PHZ2-1", "O08605-1", "Q62073-1", "Q8BYR2-1", "Q9R1L5-1", "Q9WTR2-1", "A2AQW0-1", "Q8VDG6-1", "P11798-1", "Q9WV60-1", "Q02956-1", "Q04859-1", "Q99JP0-1", "P97820-1", "Q2NL51-1", "Q61097-1", "Q3UHC2-1", "Q3UVC0-1", "Q5XJV6-1", "Q60592-1", "Q7TSJ6-1", "Q9DC28-1", "Q9JKV2-1", "Q9ESL4-1", "Q8BK63-1", "P05132-1", "P63085-1", "P31938-1", "Q9WVS7-1", "P00536-1", "Q3UMW7-1", "Q61532-1", "Q61846-1", "Q9WVS8-1", "Q6P5G0-1", "Q1EG27-1", "Q8K3H5-1", "Q5SUV5-1", "Q9Z2A0-1", "Q8VD65-1", "Q8C015-1", "Q61831-1", "P47809-1", "Q3UU96-1", "P70236-1", "Q91ZR4-1", "Q7TSC3-1", "Q9R0A5-1", "Q641K5-1", "Q9R0G8-1", "Q3ULB5-1", "Q61036-1", "Q8BTW9-1", "Q8CEE6-1", "P58750-1", "Q64702-1", "P06803-1", "P53351-1", "Q60806-1", "Q8K045-1", "P07934-1", "P70268-1", "Q63844-1", "Q80Y86-1", "Q9WUI1-1", "Q9Z1B7-1", "O35942-1", "Q8QZR7-1", "Q8BWW9-1", "Q8K1R7-1", "Q91Y86-1", "Q63932-1", "Q8BHI9-1", "O09110-1", "O54949-1", "P42337-1", "Q8CE90-1", "Q8C0Q4-1", "A2AAJ9-1", "P47811-1", "Q8CDB0-1", "P51954-1", "Q8CIN4-1", "Q80UW5-1", "Q8BZN4-1", "Q9WVS4-1", "Q9WTU6-1", "Q9Z1J2-1", "Q9JLN9-1", "O88643-1", "Q07832-1", "Q3UGM2-1", "Q9JHG7-1", "Q9JM52-1", "Q6P9R2-1", "Q61136-1", "Q922R0-1", "P70336-1", "Q8R2S1-1", "P0C5K0-1", "P0C5K1-1", "Q9Z0G2-1", "Q8C0X8-1", "Q9QYZ4-1", "Q62407-1", "Q8C0V7-1", "O54988-1", "Q9JJ78-1", "Q3UVR3-1", "Q9D2E1-1", "Q6PCN3-1", "Q9ESG9-1", "A2KF29-1", "Q8BKX6-1", "A0AUV4-1", "Q7TSE6-1", "Q9JI10-1", "Q0KL02-1", "Q3U3Q1-1", "Q3V129-1", "Q9QY01-1", "P70335-1", "Q8CFH6-1", "Q9WUN2-1", "Q923J1-1", "Q8QZX0-1", "Q8C0N0-1", "Q9ERE3-1", "Q9QZS5-1", "Q9WVC6-1", "O88697-1", "Q80ZW0-1", "O55098-1", "Q924X7-1", "Q99KH8-1", "Q99MW1-1", "Q9Z2W1-1", "Q7TNL3-1", "Q91VJ4-1", "Q9JI11-1", "Q8CIR4-1", "Q9DBU3-1", "Q9ERK0-1", "Q9QYZ6-1", "Q5F2E8-1", "Q6ZQ29-1", "Q8BYC6-1", "Q80UV9-1", "O70146-1", "Q8VCT9-1", "Q9QZL0-1", "Q61241-1", "Q99JT2-1", "Q8QZV4-1", "O54781-1", "O55047-1", "O54863-1", "Q99N57-1", "Q60855-1", "Q8C0V0-1", "Q8BGW6-1", "Q8C1R0-1", "A2ASS6-1", "P35761-1", "Q8BG48-1", "C0HKC8-1", "Q9QYZ3-1", "Q922Q2-1", "Q8VDU5-1", "O70551-1", "P97313-1", "P83510-1", "P97343-1", "Q60670-1", "Q5GIG6-1", "Q6P4S6-1", "Q69ZM6-1", "Q99PW4-1", "Q9CQS5-1", "Q9WTK7-1", "Q9D411-1", "C0HKC9-1", "Q9JJX8-1", "P58801-1", "Q9Z1W9-1", "Q80UE6-1", "Q925K9-1", "Q8BN21-1", "Q80X41-1", "Q80XP9-1", "P83741-1", "Q3UH66-1", "O88351-1", "Q5U452-1", "Q9Z1T6-2", "Q9ES70-1", "Q9ES74-1", "Q9JIX9-1", "Q8BTI9-1", "P32490-1", "P13185-1", "P13186-1", "P14680-1", "P15442-1", "P15790-1", "P18961-1", "P19454-1", "P21965-1", "P22204-1", "P22216-1", "P22517-1", "P23292-1", "P23293-1", "P23561-1", "P25333-1", "P25341-1", "P25389-1", "P27466-1", "P27636-1", "P29295-1", "P32600-1", "P32944-1", "P35169-1", "P36003-1", "P38615-1", "P40494-1", "P41695-1", "P43565-1", "P53894-1", "P53974-1", "Q03497-1", "Q12263-1", "P06784-1", "P00546-1", "P05986-1", "P06243-1", "P06244-1", "P06245-1", "P06782-1", "P08018-1", "P08458-1", "P11792-1", "P12688-1", "P14681-1", "P16892-1", "P17157-1", "P22211-1", "P22219-1", "P23291-1", "P24583-1", "P32485-1", "P32562-1", "P39009-1", "P40160-1", "P41808-1", "P43568-1", "P48562-1", "P53233-1", "P53739-1", "Q00772-1", "Q03407-1", "P32491-1", "P32581-1", "P28708-1", "P31374-1", "P32328-1", "P32350-1", "P32361-1", "P32789-1", "P32801-1", "P22209-1", "P24719-1", "P25390-1", "P36002-1", "P36004-1", "P38147-1", "P38622-1", "Q01919-1", "P39073-1", "P38692-1", "P38970-1", "P38990-1", "P38991-1", "P39962-1", "P43633-1", "P47116-1", "P53599-1", "P34244-1", "P36005-1", "P38070-1", "P38080-1", "P38110-1", "P38111-1", "P38623-1", "P38691-1", "P53104-1", "P53323-1", "P54199-1", "Q01389-1", "Q03656-1", "Q08217-1", "Q03306-1", "Q03533-1", "Q03785-1", "Q12003-1", "Q12100-1", "Q12196-1", "Q12236-1", "Q12469-1", "Q12505-1", "P43637-1", "P47042-1", "P50873-1", "Q03002-1", "Q06098-1", "Q08732-1", "Q12152-1", "Q12222-1", "Q12310-1", "Q54R98-1", "Q54FH3-1", "Q54RP7-1", "Q54P26-1", "Q54PK8-1", "Q54VV7-1", "Q54XZ5-1", "Q54Y90-1", "Q55A09-1", "Q55BA0-1", "Q86HW6-1", "Q54C38-1", "Q54DY0-1", "Q54E34-1", "Q54EM1-1", "Q54ER4-1", "Q54ET3-1", "Q54F40-1", "Q54FR9-1", "Q54G43-1", "Q54H05-1", "Q54HD2-1", "Q54IF2-1", "Q54IH8-1", "Q54IP4-1", "Q54JQ1-1", "Q54L00-1", "Q54L81-1", "Q54LH8-1", "Q54LU8-1", "Q54MH0-1", "Q54MV2-1", "Q54PX0-1", "Q54QD5-1", "Q54R95-1", "Q54RB2-1", "Q54RJ4-1", "Q54RR9-1", "Q54RV3-1", "Q54RZ7-1", "Q54SC4-1", "Q54SK3-1", "Q54TA3-1", "Q54TH6-1", "Q54TN4-1", "Q54U31-1", "Q54U65-1", "Q54UA9-1", "Q54UZ1-1", "Q54V35-1", "Q54V83-1", "Q54VC0-1", "Q54VU4-1", "Q54WC0-1", "Q54WD7-1", "Q54WE5-1", "Q54WW7-1", "Q54XJ4-1", "Q54XX5-1", "Q54XY6-1", "Q54Y06-1", "Q54Y55-1", "Q54YZ5-1", "Q54ZN3-1", "Q552C1-1", "Q552E9-1", "Q552Z2-1", "Q553E9-1", "Q556J6-1", "Q559A2-1", "Q559T8-1", "Q55A55-1", "Q55CA6-1", "Q55CE0-1", "Q55CW2-1", "Q55CW3-1", "Q55DJ9-1", "Q55DK2-1", "Q55DU7-1", "Q55EI8-1", "Q55F45-1", "Q55FJ6-1", "Q55FV4-1", "Q55FV5-1", "Q55GC2-1", "Q55GE6-1", "Q55GG4-1", "Q55GS4-1", "Q55GU0-1", "Q6XHA7-1", "Q75JN1-1", "Q76P07-1", "Q869L4-1", "Q869T7-1", "Q869X3-1", "Q86A12-1", "Q86HG9-1", "Q86I06-1", "Q8MYF1-1", "Q8SSV3-1", "Q9NGW9-1", "P34099-1", "Q1ZXI5-1", "Q54D75-1", "Q54EY4-1", "Q54UL8-1", "Q558U1-1", "Q5VJL3-1", "B0G126-1", "O61122-1", "O61125-1", "P0CD62-1", "P28178-1", "P34100-1", "P34101-1", "P34102-1", "P34103-1", "P34112-1", "P34117-1", "P42525-1", "P54644-1", "P54685-1", "Q02720-1", "Q1ZXC8-1", "Q1ZXD6-1", "Q1ZXH2-1", "Q1ZXR2-1", "Q23915-1", "Q54B33-1", "Q54B48-1", "Q54BC9-1", "Q54BF0-1", "Q54C18-1", "Q54C71-1", "Q54DC8-1", "Q54DF2-1", "Q54DK3-1", "Q54EG9-1", "Q54GY6-1", "Q54H45-1", "Q54H46-1", "Q54HC6-1", "Q54I36-1", "Q54IE8-1", "Q54JC7-1", "Q54JG7-1", "Q54LR6-1", "Q54M77-1", "Q54MY9-1", "Q54P47-1", "Q54PK9-1", "Q54Q69-1", "Q54QB1-1", "Q54QI2-1", "Q54QQ1-1", "Q54QV3-1", "Q54R82-1", "Q54RB7-1", "Q54S77-1", "Q54T05-1", "Q54TA1-1", "Q54TM7-1", "Q54TW2-1", "Q54UC0-1", "Q54VD8-1", "Q54VI1-1", "Q54W07-1", "Q54WJ0-1", "Q54WS5-1", "Q54WX4-1", "Q54XL6-1", "Q54XQ2-1", "Q54Y26-1", "Q54YF2-1", "Q550K8-1", "Q550L8-1", "Q551H4-1", "Q552C6-1", "Q556Q3-1", "Q556S2-1", "Q556Y4-1", "Q557G1-1", "Q55BN8-1", "Q55CL6-1", "Q55CY9-1", "Q55CZ1-1", "Q55D99-1", "Q55DD4-1", "Q55DJ8-1", "Q55E58-1", "Q55EC7-1", "Q55FS2-1", "Q55FT4-1", "Q55GJ2-1", "Q55GV3-1", "Q6B9X6-1", "Q6XHA5-1", "Q6XHB2-1", "Q75JK0-1", "Q76NV1-1", "Q869N2-1", "Q86AE1-1", "Q86AT8-1", "Q86C65-1", "Q86CS2-1", "Q86HN7-1", "Q86IX1-1", "Q8MVR1-1", "Q8SSS9-1", "Q8SSY6-1", "Q8T2I8-1", "Q95YH0-1", "O61267-1", "P13677-1", "P23573-1", "P51123-1", "Q00168-1", "Q23977-1", "Q24210-3", "Q9VKN7-1", "O62618-1", "P10676-1", "P18431-2", "P23647-1", "P52304-1", "P83098-1", "P83104-1", "Q03042-1", "Q70PP2-1", "Q8T0S6-1", "P12370-1", "Q05652-1", "Q9VXE5-1", "P83103-1", "Q7KRY6-1", "Q95UN8-1", "Q8INB9-1", "Q9W002-1", "A0A0B4KHX7-1", "A1Z9X0-1", "P08181-1", "P11346-1", "A1ZBH7-1", "Q9VM90-1", "Q9VHH2-1", "Q9VXE3-1", "P83099-1", "Q9NIV1-1", "O76324-1", "P13678-1", "P16912-1", "P23572-1", "P40417-3", "P48609-1", "P49071-1", "P49762-1", "P54367-1", "P83100-1", "P83102-1", "P92208-1", "Q03043-1", "Q0KHT7-1", "Q24324-1", "Q5EAK6-1", "Q9VPC0-1", "Q9VXG8-1", "Q9W354-1", "A1Z7T0-1", "O61443-1", "O97143-1", "P05130-1", "P16911-1", "P49657-1", "Q9NI63-1", "Q9V3Q6-1", "Q9VA38-1", "Q9VK45-1", "Q9W0V1-4", "P54360-1", "Q9VT57-1", "Q9VI13-1", "A1ZBC4-1", "Q8IMC6-1", "Q8IR79-1", "Q9V3D5-1", "Q0KHQ5-1", "Q0KHV6-1", "Q9NBK5-1", "Q7PLI7-1", "X2JAG8-1", "O61661-1", "A4VCL2-2", "A0A0B4KHT3-1", "A0A4D6K823-1", "A1ZBL9-1", "Q9VP22-1", "Q9W1B0-1", "Q9V3I5-1", "A0A126GUV7-1", "Q9VRJ6-1", "Q8T9L5-1", "Q24216-1", "Q94533-1", "Q9VUQ9-1", "Q9VR61-1", "Q9VW24-1", "Q9VGF9-1", "Q9VBU2-1", "Q9VR42-1", "Q9VL34-1", "Q9VTL5-1", "Q9VCV0-1", "M9PGC5-1", "Q9VD82-1" ], "evidence": [ { "id": "17989", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17989" } ] }, { "id": "46608", "name": "", "equation": "ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "B2DD29-1", "D3ZML2-1", "O08875-1", "O35831-1", "P57760-1", "D3ZHP7-1", "D4A280-1", "E9PTG8-1", "O35832-1", "O54748-1", "Q62868-1", "D3ZBE5-1", "P59895-1", "O55099-1", "O88764-1", "P59241-1", "Q91XS8-1", "Q63644-1", "Q7TQP6-1", "Q9Z2P5-1", "P11345-1", "F1LYY7-1", "F1LN87-1", "Q9JIH7-1", "Q5XIT0-1", "P14056-1", "P35426-1", "P51952-1", "P63086-1", "Q5U2X5-1", "Q63117-1", "F1M7Y5-1", "P08413-1", "P47196-1", "P47197-1", "P97874-1", "Q03114-1", "Q3MJK5-1", "Q09137-1", "P54645-1", "Q63686-1", "P11275-1", "P0C1X8-1", "P19139-1", "D4A7V9-1", "Q62915-1", "Q63184-1", "Q63484-1", "Q9Z1Z1-1", "O70444-1", "P0C0R5-1", "B2GUY1-1", "O08874-1", "O88831-1", "P18265-1", "P26794-1", "P46892-1", "Q4KM34-1", "Q4KM47-1", "Q66HE7-1", "Q6XUX2-1", "Q4V8A3-1", "Q63185-1", "Q63470-1", "Q62673-1", "Q63433-1", "P53669-1", "P53670-1", "Q63699-1", "Q641Z4-1", "P39951-1", "A1A5Q6-1", "B0LT89-1", "F1LP90-1", "O08815-1", "O88850-1", "P00539-1", "P0C865-1", "P27791-1", "P63319-1", "P68182-1", "P97924-1", "Q01986-1", "Q06226-1", "Q53UA7-1", "Q62862-1", "Q63454-1", "Q63531-1", "Q63562-1", "Q63572-1", "Q64617-1", "Q66HA1-1", "Q62762-1", "O55173-1", "O70150-1", "P05696-1", "P09216-1", "P11730-1", "P13234-1", "P15791-1", "P68403-1", "P97633-1", "P97756-1", "Q62761-1", "Q62763-1", "D4AE59-1", "B1WBU5-1", "D3ZGQ5-1", "F1M0Z1-1", "P13286-1", "P49187-1", "Q5RKH1-1", "Q62829-1", "Q63638-1", "Q9JLS3-1", "Q9JM01-1", "Q9R011-1", "Q9R012-1", "D3ZSZ3-1", "Q06486-1", "Q62726-1", "Q63450-1", "Q4KSH7-1", "Q5XIS9-1", "Q63285-1", "Q63553-1", "P67999-1", "O88664-1", "O08678-1", "O08679-1", "D4A229-1", "Q91ZN7-1", "Q99J82-1", "Q7TNJ7-1", "Q64303-1", "Q66HE5-1", "Q64595-1", "P09215-1", "P49185-1", "P09217-1", "P36506-1", "P35465-1", "P20793-1", "Q7TPK6-1", "O88506-1", "Q8R4V0-1", "Q7TNL4-1", "Q8R4U9-1", "Q8VHF0-1", "Q924U5-1", "Q9WTQ0-1", "Q9WTQ1-1", "Q9Z2A6-1", "Q9Z335-1", "D3ZG83-1", "P21708-1", "P27704-1", "Q4V793-1", "Q5MPA9-1", "Q5U2N4-1", "Q62925-1", "Q63538-1", "Q66H84-1", "Q9WTY9-1", "A0A8I6AQN6-1", "O54874-1", "A0A0G2JZW9-1", "Q924I2-1", "P42346-1", "Q4G050-1", "P70618-1", "Q925B3-1", "Q63796-1", "Q7TT49-1", "Q810W7-1", "Q9R1U5-1", "F1LRA7-1", "D3ZHL6-1", "D4A454-1", "D3ZXB1-1", "P0C8E4-1", "P18266-1", "D3Z8E0-1", "D3Z8I4-1", "D3ZY07-1", "D4AE24-1", "F1M419-1", "D3ZSB7-1", "A0A0G2K5L3-1", "A0A8I6A165-1", "A4L9P5-1", "D4A6T9-1", "E9PSL7-1", "D4ACL8-1", "F1M7N7-1", "F1LXF1-1", "D3Z822-1", "P49186-1", "A0A8I6AWX7-1", "A0A8I5ZZZ6-1", "D3ZMG0-1", "Q9QY78-1", "E9PSK5-1", "A0A0G2KB60-1", "Q63945-1", "F1LNN8-1", "A0A1W2Q671-1", "Q80ZF4-1", "A0A8I6ATY6-1", "P0C0A1-1", "M0RD40-1", "A0A0G2JVL3-1", "A0A8I5ZP97-1", "A0A8I6AC38-1", "D3Z837-1", "D3ZL21-1", "A0A8I6AUJ4-1", "F1M7G0-1", "D3ZCD7-1", "D3ZFL3-1", "A0A0G2JUP3-1", "A0A8I5ZNK2-1", "D3ZRJ7-1", "D4AD76-1", "D3ZTD1-1", "A0A8I6ANX6-1", "B5DFG1-1", "A0A8I6A0F8-1", "F1LNJ1-1", "A0A8I6AEL0-1", "A0A8I6G1H3-1", "M0RBT0-1", "F7FMK8-1", "A0A8I6GK52-1", "D4A6T6-1", "A0A8I6A9E8-1", "F1LUY7-1", "A0A8I6A7D1-1", "A0A8J8XEH6-1", "A0A8I6AJX5-1", "A0A8I6AD01-1", "A6KB61-1", "P11980-1", "G3V783-1", "Q9HCP0-1", "P0C263-1", "Q6ZMQ8-1", "Q13164-1", "Q2M2I8-1", "P80192-1", "P31751-1", "Q13131-1", "Q07912-1", "Q5VT25-1", "O43293-1", "Q9P0L2-1", "P21127-1", "Q9BWU1-1", "Q9UQ88-1", "Q00537-1", "Q8IZL9-1", "Q9UQB9-1", "Q8IWQ3-1", "Q9NYV4-1", "Q13315-1", "Q96GD4-1", "P06493-1", "Q00526-1", "O60566-1", "Q13535-1", "O76039-2", "O94921-1", "Q00535-1", "Q8IVW4-1", "Q9Y243-1", "Q07002-2", "P50613-1", "Q92772-1", "P10398-1", "Q8NFD2-1", "O43683-1", "O14965-1", "P24941-1", "Q15131-1", "Q9NSY1-1", "P33076-1", "Q86TB3-1", "P50750-1", "Q14004-1", "P11802-1", "Q8TDC3-1", "P54646-1", "O00311-1", "Q00536-1", "P11274-1", "P49336-1", "Q96QP1-1", "Q96L96-1", "P31749-1", "O96017-1", "P49760-1", "Q5MAI5-1", "Q00532-1", "Q00534-1", "P49761-4", "Q9HAZ1-1", "P49759-1", "Q96Q40-1", "P41279-1", "P15056-1", "O14757-1", "P68400-1", "O14936-1", "Q6XUX3-1", "Q9Y463-1", "Q76MJ5-1", "Q9P2K8-1", "P19525-1", "Q8N568-1", "Q09013-9", "Q9NR20-1", "Q9NZJ5-1", "O15075-1", "Q9C098-1", "P19784-1", "O14578-1", "P53355-1", "Q8IXL6-1", "Q13627-1", "Q9Y4B6-1", "Q9BQI3-1", "Q9UIK4-1", "Q92630-1", "Q8NEV1-1", "O43781-1", "O75460-1", "Q13557-1", "Q13976-1", "P41743-1", "P48729-1", "Q15418-1", "P51617-1", "Q15349-1", "Q9UQM7-1", "Q9NRM7-1", "O95835-1", "Q9H2X6-1", "Q86Z02-1", "Q16566-1", "Q6P2M8-1", "P78368-1", "Q96NX5-1", "Q9Y6M4-1", "P22612-1", "P57058-1", "Q13554-1", "Q9H422-1", "Q9NWZ3-1", "Q8IWU2-1", "Q8N5S9-1", "O14976-1", "Q8NE63-1", "Q13555-1", "Q96RR4-1", "Q15139-1", "P11801-1", "O94806-1", "Q13237-1", "Q96S38-1", "Q9UK32-1", "Q8N752-1", "Q14012-1", "P05129-1", "P51812-1", "Q9UBS0-1", "O60229-1", "Q05655-1", "Q02156-1", "P17252-1", "P05771-1", "P53667-1", "Q9UPZ9-1", "Q13418-1", "P23443-1", "P49674-1", "Q8TF76-1", "Q04759-1", "Q9BZL6-1", "Q05513-1", "Q6VAB6-1", "P49840-1", "P49841-1", "P48730-1", "O75676-1", "O75582-1", "P24723-1", "Q8IVT5-1", "Q8IU85-1", "Q96GX5-1", "P22694-1", "P17612-1", "Q16659-1", "Q9UBE8-1", "Q02750-1", "O14733-1", "Q8TD08-1", "Q96RG2-1", "Q9Y2U5-1", "Q5S007-1", "Q6P0Q8-1", "P46734-1", "P51957-1", "Q6ZN16-1", "Q6DT37-1", "Q5VST9-1", "Q9Y5S2-1", "Q9UQ07-1", "P28482-1", "P27361-1", "P00540-1", "O75914-1", "Q99759-1", "Q99558-1", "P51955-1", "Q8IW41-1", "Q9Y6R4-1", "P53779-1", "P51956-1", "Q6P3R8-1", "Q13163-1", "Q13233-1", "O60307-1", "Q56UN5-1", "O95382-1", "Q02779-1", "O15021-5", "P45985-1", "Q86SG6-1", "Q6ZWH5-1", "Q86YV6-1", "Q8WXR4-1", "Q8NEV4-1", "Q6A1A2-1", "P31152-1", "O15264-1", "P52564-1", "P27448-5", "Q96QS6-1", "O60285-1", "Q7Z2Y5-1", "Q15759-1", "P49137-1", "Q16644-1", "Q96L34-1", "P53778-1", "O95819-1", "Q8N4C8-1", "P36507-1", "Q96Q04-1", "P53671-1", "Q8NG66-1", "Q9Y4K4-1", "Q9HBH9-1", "Q96PY6-1", "Q9H093-1", "O43318-1", "P45983-1", "Q16584-1", "Q7KZI7-1", "Q9BUB5-1", "Q8IY84-1", "P45984-1", "Q99683-1", "O43283-1", "Q12852-1", "Q16539-1", "Q38SD2-1", "Q92918-1", "Q9Y2H9-1", "Q8TD19-1", "Q5TCX8-1", "Q13153-1", "Q9NYL2-1", "P42345-1", "P20794-1", "Q8IVH8-1", "Q12851-1", "Q14680-1", "Q9NYY3-1", "Q9Y6S9-1", "Q15772-5", "Q16816-1", "Q16513-1", "Q99570-1", "Q86V86-1", "Q16512-1", "P57059-1", "Q13464-1", "Q9P286-1", "Q8N165-1", "Q99640-1", "P57078-1", "O14730-1", "O43353-1", "O96013-1", "Q9H4B4-1", "O43930-1", "Q13523-1", "Q9HBY8-2", "O75116-1", "Q52WX2-1", "O00141-1", "P0C264-1", "Q96BR1-1", "Q9P1W9-1", "Q6P5Z2-1", "Q96LW2-1", "Q9H2G2-1", "O15530-1", "Q9NQU5-1", "Q9BRS2-1", "Q13546-1", "P11309-1", "Q9NRH2-1", "P53350-1", "Q9H0K1-1", "Q13177-1", "P51817-1", "P04049-1", "O00444-1", "P78527-1", "Q96Q15-1", "Q9Y2K2-5", "Q96S44-1", "Q9Y572-1", "Q9BVS4-1", "Q9BXM7-1", "O95747-1", "O00506-1", "Q15208-1", "Q8N2I9-1", "Q9BXU1-1", "Q9BYT3-1", "Q9UEE5-1", "O94768-1", "Q8TDR2-1", "Q9BX84-1", "Q96QT4-1", "Q96KB5-1", "A0A0B4J2F2-1", "Q9NRP7-1", "P78362-1", "Q9BXA7-1", "O75385-1", "Q5TCY1-1", "Q9Y3S1-1", "Q8WZ42-1", "O75716-1", "Q13188-1", "Q13043-1", "Q96PN8-1", "Q9Y2H1-1", "O75962-1", "Q9UPE1-1", "Q15569-1", "Q8IYT8-1", "Q6PHR2-1", "Q96C45-1", "Q9H2K8-1", "Q9Y6E0-1", "Q96S53-1", "P21675-1", "Q7L7X3-1", "Q9UL54-1", "Q9UKE5-1", "Q96SB4-2", "Q9UEW8-1", "Q15831-1", "Q9BXA6-1", "Q96PF2-1", "Q59H18-2", "Q6SA08-1", "Q6IQ55-1", "Q8TAS1-1", "P33981-1", "Q99986-1", "O94804-1", "Q9P289-1", "Q8WU08-1", "Q9NY57-1", "Q9UHD2-1", "Q86UX6-1", "Q9UKI8-1", "Q86UE8-1", "Q86Y07-1", "Q9BYP7-1", "Q96J92-1", "Q9H4A3-1", "Q9HC98-1", "Q8TDX7-1", "O14920-1", "Q14296-1", "P14618-1", "Q9Y4A5-1", "Q5SYL1-1", "E9Q3S4-1", "Q62070-1", "O54967-1", "Q9Z188-1", "Q9JKK8-1", "Q05512-1", "Q8C050-1", "Q3UHJ0-1", "Q7TT50-1", "Q99MQ3-1", "P49025-1", "Q03141-1", "Q9Z0R0-1", "P04627-1", "Q60823-1", "Q8BZ25-1", "Q924C5-1", "Q8BRK8-1", "Q91ZB0-1", "P31750-1", "Q5EG47-1", "Q9CXB8-1", "O88445-1", "Q5RJI5-1", "Q9Z1S0-1", "O08901-1", "P49615-1", "Q04899-1", "Q3TZA2-1", "Q8BLF2-1", "Q8R3L8-1", "Q9WUA6-1", "P24788-1", "O35495-1", "Q14AX6-1", "Q3UMM4-1", "Q64261-1", "Q8BWD8-1", "Q3UTQ8-1", "Q8CEQ0-1", "Q03147-1", "Q8K0D0-1", "O70589-1", "O35491-1", "O35493-1", "Q9Z265-1", "Q69ZA1-1", "Q80YP0-1", "Q9JHU3-1", "Q9QUK0-1", "P11440-1", "Q62388-1", "Q91Z96-1", "O35280-1", "O35492-1", "P28028-3", "Q99J95-1", "P30285-1", "P97377-1", "Q9Z0H0-1", "O70126-1", "P97477-1", "P79621-1", "Q04735-1", "Q3V3A1-1", "Q69Z98-1", "Q6PAJ1-1", "P22518-1", "P54265-1", "Q6XUX1-1", "Q03963-1", "Q9Z2B5-1", "O54833-1", "Q80TR8-1", "Q60737-1", "Q80YE7-1", "Q8BWQ5-1", "Q9JLM8-1", "Q6PGN3-1", "Q99KY4-1", "Q61214-1", "Q8VDF3-1", "Q922Y0-1", "O54784-1", "Q9EQY0-1", "Q8BI55-1", "Q9Z2E3-1", "Q5U4C9-1", "Q5MJS3-1", "Q9Z2R9-1", "Q9QZ05-1", "Q6PHZ2-1", "Q91YS8-1", "Q923T9-1", "P68404-1", "Q91YA2-1", "P68181-1", "Q7TPS0-1", "Q8BK63-1", "Q8BTH8-1", "Q8C4X2-1", "Q62101-1", "Q8K1Y2-1", "P16054-1", "O88904-1", "Q9ERH7-1", "Q3V016-1", "Q8R4K2-1", "Q8BVP5-1", "Q8BW96-1", "Q9QYK9-1", "P08414-1", "Q8C078-1", "P53349-1", "Q3U1V8-1", "Q66L42-1", "Q80XI6-1", "Q80YE4-1", "Q3TYD6-1", "O08648-1", "Q07174-1", "Q1HKZ5-1", "Q61083-1", "Q3U214-1", "Q2NL51-1", "Q8VBY2-1", "P49138-1", "P53668-1", "Q9Z2B9-1", "P70218-1", "Q62406-1", "Q61084-1", "O88866-1", "Q61410-1", "P20444-1", "Q62074-1", "Q9WUT3-1", "P0C605-1", "P23298-1", "P63318-1", "P18653-1", "P18654-1", "Q02111-1", "Q8BLK9-1", "Q9WUL6-1", "Q9Z1M4-1", "O08911-1", "Q8C0P0-1", "P28652-1", "Q9WV60-1", "Q8BZ03-1", "Q60700-1", "Q61161-1", "Q91VB2-1", "Q8VHJ5-1", "Q9QZR5-1", "O55222-1", "Q9JMK2-1", "O54785-1", "O35099-1", "O54992-1", "Q5S006-1", "P28867-1", "Q8BSK8-1", "Q8CIP4-1", "Q811L6-1", "Q8BPM2-1", "A2CG49-1", "O08605-1", "Q62073-1", "Q8BYR2-1", "Q9R1L5-1", "Q9WTR2-1", "A2AQW0-1", "Q8VDG6-1", "P11798-1", "Q02956-1", "Q04859-1", "Q99JP0-1", "P97820-1", "Q61097-1", "Q3UHC2-1", "Q3UVC0-1", "Q5XJV6-1", "Q60592-1", "Q7TSJ6-1", "Q9DC28-1", "Q9JKV2-1", "Q9ESL4-1", "P05132-1", "P63085-1", "P31938-1", "Q9WVS7-1", "P00536-1", "Q3UMW7-1", "Q61532-1", "Q61846-1", "Q9WVS8-1", "Q6P5G0-1", "Q1EG27-1", "Q8K3H5-1", "Q5SUV5-1", "Q9Z2A0-1", "Q8VD65-1", "Q8C015-1", "Q61831-1", "P47809-1", "Q3UU96-1", "P70236-1", "Q91ZR4-1", "Q7TSC3-1", "Q9R0A5-1", "Q641K5-1", "Q9R0G8-1", "Q3ULB5-1", "Q61036-1", "Q8BTW9-1", "Q8CEE6-1", "P58750-1", "Q64702-1", "P06803-1", "P53351-1", "Q60806-1", "Q8K045-1", "P07934-1", "P70268-1", "Q63844-1", "Q80Y86-1", "Q9WUI1-1", "Q9Z1B7-1", "O35942-1", "Q8QZR7-1", "Q8BWW9-1", "Q8K1R7-1", "Q63932-1", "Q8BHI9-1", "O09110-1", "O54949-1", "Q8CE90-1", "Q8C0Q4-1", "A2AAJ9-1", "P47811-1", "Q8CDB0-1", "P51954-1", "Q8CIN4-1", "Q80UW5-1", "Q8BZN4-1", "Q9WVS4-1", "Q9WTU6-1", "Q9Z1J2-1", "Q9JLN9-1", "O88643-1", "Q91Y86-1", "Q07832-1", "Q3UGM2-1", "Q9JM52-1", "Q6P9R2-1", "Q61136-1", "Q922R0-1", "P70336-1", "Q8R2S1-1", "P0C5K0-1", "P0C5K1-1", "Q9Z0G2-1", "Q8C0X8-1", "Q9QYZ4-1", "Q62407-1", "Q8C0V7-1", "O54988-1", "Q9JJ78-1", "Q3UVR3-1", "Q9D2E1-1", "Q6PCN3-1", "Q9ESG9-1", "A2KF29-1", "Q8BKX6-1", "A0AUV4-1", "Q7TSE6-1", "Q9JI10-1", "Q0KL02-1", "Q3U3Q1-1", "Q3V129-1", "Q9QY01-1", "P70335-1", "Q8CFH6-1", "Q9WUN2-1", "Q923J1-1", "Q8QZX0-1", "Q8C0N0-1", "Q9ERE3-1", "Q9QZS5-1", "Q9WVC6-1", "O88697-1", "Q80ZW0-1", "O55098-1", "Q924X7-1", "Q99KH8-1", "Q99MW1-1", "Q9Z2W1-1", "Q7TNL3-1", "Q91VJ4-1", "Q9JI11-1", "Q8CIR4-1", "Q9DBU3-1", "Q9ERK0-1", "Q9QYZ6-1", "Q5F2E8-1", "Q6ZQ29-1", "Q8BYC6-1", "Q80UV9-1", "O70146-1", "Q8VCT9-1", "Q9QZL0-1", "Q61241-1", "Q99JT2-1", "Q8QZV4-1", "O54781-1", "O55047-1", "O54863-1", "Q99N57-1", "Q60855-1", "Q8C0V0-1", "Q8BGW6-1", "Q8C1R0-1", "A2ASS6-1", "P35761-1", "Q8BG48-1", "C0HKC8-1", "Q9QYZ3-1", "Q922Q2-1", "Q8VDU5-1", "O70551-1", "O70405-1", "P97313-1", "P83510-1", "P97343-1", "Q60670-1", "Q5GIG6-1", "Q6P4S6-1", "Q69ZM6-1", "Q99PW4-1", "Q9CQS5-1", "Q9WTK7-1", "Q9D411-1", "C0HKC9-1", "Q9JJX8-1", "P58801-1", "Q9Z1W9-1", "Q925K9-1", "Q8BN21-1", "Q80X41-1", "Q80XP9-1", "Q4FZD7-1", "P83741-1", "Q3UH66-1", "Q80UE6-1", "O88351-1", "Q5U452-1", "Q9ES70-1", "Q9ES74-1", "P52480-1", "Q9JIX9-1", "P13185-1", "P13186-1", "P14680-1", "P15442-1", "P15790-1", "P18961-1", "P19454-1", "P21965-1", "P22204-1", "P22216-1", "P22517-1", "P23292-1", "P23293-1", "P23561-1", "P25333-1", "P25341-1", "P25389-1", "P27466-1", "P27636-1", "P29295-1", "P32490-1", "P32600-1", "P32944-1", "P35169-1", "P36003-1", "P38615-1", "P40494-1", "P41695-1", "P43565-1", "P53894-1", "P53974-1", "Q03497-1", "Q12263-1", "P00546-1", "P05986-1", "P06243-1", "P06244-1", "P06245-1", "P06782-1", "P06784-1", "P08018-1", "P08458-1", "P11792-1", "P12688-1", "P14681-1", "P16892-1", "P17157-1", "P22211-1", "P22219-1", "P23291-1", "P24583-1", "P32485-1", "P32562-1", "P39009-1", "P40160-1", "P41808-1", "P43568-1", "P48562-1", "P53233-1", "P53739-1", "Q00772-1", "Q03407-1", "P28708-1", "P31374-1", "P32328-1", "P32350-1", "P32361-1", "P32491-1", "P32581-1", "P32789-1", "P32801-1", "P22209-1", "P24719-1", "P25390-1", "P36002-1", "P36004-1", "P38147-1", "P38622-1", "Q01919-1", "P43633-1", "P38692-1", "P38970-1", "P38990-1", "P38991-1", "P39073-1", "P39962-1", "P47116-1", "P53599-1", "P34244-1", "P36005-1", "P38070-1", "P38080-1", "P38110-1", "P38111-1", "P38623-1", "P38691-1", "P53104-1", "P53323-1", "P54199-1", "Q01389-1", "Q03656-1", "Q08217-1", "Q03306-1", "Q03533-1", "Q03785-1", "Q12003-1", "Q12100-1", "Q12196-1", "Q12236-1", "Q12469-1", "Q12505-1", "P43637-1", "P47042-1", "P50873-1", "Q03002-1", "Q06098-1", "Q08732-1", "Q12152-1", "Q12222-1", "Q12310-1", "Q54FH3-1", "Q54R98-1", "Q54RP7-1", "Q55FJ6-1", "Q55GG4-1", "Q54C38-1", "Q54DY0-1", "Q54E34-1", "Q54EM1-1", "Q54ER4-1", "Q54ET3-1", "Q54F40-1", "Q54FR9-1", "Q54G43-1", "Q54H05-1", "Q54HD2-1", "Q54IF2-1", "Q54IH8-1", "Q54IP4-1", "Q54JQ1-1", "Q54L00-1", "Q54L81-1", "Q54LH8-1", "Q54LU8-1", "Q54MH0-1", "Q54MV2-1", "Q54P26-1", "Q54PK8-1", "Q54PX0-1", "Q54QD5-1", "Q54R95-1", "Q54RB2-1", "Q54RJ4-1", "Q54RR9-1", "Q54RV3-1", "Q54RZ7-1", "Q54SC4-1", "Q54SK3-1", "Q54TA3-1", "Q54TH6-1", "Q54TN4-1", "Q54U31-1", "Q54U65-1", "Q54UA9-1", "Q54UZ1-1", "Q54V35-1", "Q54V83-1", "Q54VC0-1", "Q54VU4-1", "Q54VV7-1", "Q54WC0-1", "Q54WD7-1", "Q54WE5-1", "Q54WW7-1", "Q54XJ4-1", "Q54XX5-1", "Q54XY6-1", "Q54XZ5-1", "Q54Y06-1", "Q54Y55-1", "Q54Y90-1", "Q54YZ5-1", "Q54ZN3-1", "Q552C1-1", "Q552E9-1", "Q552Z2-1", "Q553E9-1", "Q556J6-1", "Q559A2-1", "Q559T8-1", "Q55A09-1", "Q55A55-1", "Q55BA0-1", "Q55CA6-1", "Q55CE0-1", "Q55CW2-1", "Q55CW3-1", "Q55DJ9-1", "Q55DK2-1", "Q55DU7-1", "Q55EI8-1", "Q55F45-1", "Q55FV4-1", "Q55FV5-1", "Q55GC2-1", "Q55GE6-1", "Q55GS4-1", "Q55GU0-1", "Q6XHA7-1", "Q75JN1-1", "Q76P07-1", "Q869L4-1", "Q869T7-1", "Q869X3-1", "Q86A12-1", "Q86HG9-1", "Q86HW6-1", "Q86I06-1", "Q8MYF1-1", "Q8SSV3-1", "Q9NGW9-1", "P0CD62-1", "P34100-1", "P34102-1", "P34103-1", "Q1ZXC8-1", "Q1ZXH2-1", "Q1ZXI5-1", "Q1ZXR2-1", "Q23915-1", "Q54B48-1", "Q54BC9-1", "Q54C18-1", "Q54D75-1", "Q54DC8-1", "Q54DF2-1", "Q54DK3-1", "O61122-1", "O61125-1", "P28178-1", "P34099-1", "P34101-1", "P34112-1", "P34117-1", "P42525-1", "P54644-1", "P54685-1", "Q02720-1", "Q1ZXD6-1", "Q54B33-1", "Q54BF0-1", "Q54C71-1", "Q54EG9-1", "Q54EY4-1", "Q54GY6-1", "Q54H45-1", "Q54H46-1", "Q54HC6-1", "Q54I36-1", "Q54IE8-1", "Q54JC7-1", "Q54JG7-1", "Q54LR6-1", "Q54M77-1", "Q54MY9-1", "Q54P47-1", "Q54PK9-1", "Q54Q69-1", "Q54QB1-1", "Q54QI2-1", "Q54QQ1-1", "Q54QV3-1", "Q54R82-1", "Q54RB7-1", "Q54S77-1", "Q54T05-1", "Q54TA1-1", "Q54TM7-1", "Q54TW2-1", "Q54UC0-1", "Q54UL8-1", "Q54VD8-1", "Q54VI1-1", "Q54W07-1", "Q54WJ0-1", "Q54WS5-1", "Q54WX4-1", "Q54XL6-1", "Q54XQ2-1", "Q54Y26-1", "Q54YF2-1", "Q550K8-1", "Q550L8-1", "Q551H4-1", "Q552C6-1", "Q556Q3-1", "Q556S2-1", "Q556Y4-1", "Q557G1-1", "Q558U1-1", "Q55BN8-1", "Q55CL6-1", "Q55CY9-1", "Q55CZ1-1", "Q55D99-1", "Q55DD4-1", "Q55DJ8-1", "Q55E58-1", "Q55EC7-1", "Q55FS2-1", "Q55FT4-1", "Q55GJ2-1", "Q55GV3-1", "Q5VJL3-1", "Q6B9X6-1", "Q6XHA5-1", "Q6XHB2-1", "Q75JK0-1", "Q76NV1-1", "Q869N2-1", "Q86AE1-1", "Q86AT8-1", "Q86C65-1", "Q86CS2-1", "Q86HN7-1", "Q86IX1-1", "Q8MVR1-1", "Q8SSS9-1", "Q8SSY6-1", "Q8T2I8-1", "Q95YH0-1", "O61267-1", "P13677-1", "P23573-1", "P51123-1", "Q00168-1", "Q23977-1", "Q24210-3", "Q9VKN7-1", "O62618-1", "P10676-1", "P18431-2", "P23647-1", "P52304-1", "P83098-1", "P83104-1", "Q03042-1", "Q70PP2-1", "Q8T0S6-1", "P12370-1", "Q05652-1", "Q9VXE5-1", "P83103-1", "Q7KRY6-1", "Q95UN8-1", "Q8INB9-1", "A0A0B4KHX7-1", "A1Z9X0-1", "P08181-1", "P11346-1", "Q9VM90-1", "Q9VHH2-1", "O76324-1", "P13678-1", "P16912-1", "P23572-1", "P40417-3", "P48609-1", "P49071-1", "P49762-1", "P54367-1", "P83099-1", "P83100-1", "P83102-1", "P92208-1", "Q03043-1", "Q0KHT7-1", "Q24324-1", "Q5EAK6-1", "Q9NIV1-1", "Q9VPC0-1", "Q9VXG8-1", "Q9W354-1", "A1Z7T0-1", "O61443-1", "O97143-1", "P05130-1", "P16911-1", "P49657-1", "Q9NI63-1", "Q9V3Q6-1", "Q9VA38-1", "Q9VK45-1", "Q9W0V1-4", "P54360-1", "Q9VT57-1", "Q9VI13-1", "A1ZBC4-1", "Q8IMC6-1", "Q8IR79-1", "Q9V3D5-1", "Q0KHQ5-1", "Q0KHV6-1", "Q9NBK5-1", "Q9W002-1", "Q7PLI7-1", "X2JAG8-1", "O61661-1", "A4VCL2-2", "A0A0B4KHT3-1", "A1ZBH7-1", "A0A4D6K823-1", "A1ZBL9-1", "Q9VP22-1", "Q9VZI2-1", "Q9W1B0-1", "Q9V3I5-1", "A0A126GUV7-1", "Q9VRJ6-1", "Q8T9L5-1", "Q24216-1", "Q94533-1", "A0A0B4KHC3-1", "Q9VUQ9-1", "Q9VR61-1", "Q9VW24-1", "Q9VXE3-1", "Q9VGF9-1", "Q9VBU2-1", "Q9VR42-1", "Q9VL34-1", "Q9VTL5-1", "Q9VCV0-1", "M9PGC5-1", "Q9VD82-1" ], "evidence": [ { "id": "46608", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46608" } ] }, { "id": "53904", "name": "", "equation": "ATP + L-threonyl-[tau protein] = ADP + H(+) + O-phospho-L-threonyl-[tau protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "B2DD29-1", "D3ZML2-1", "P54645-1", "P18265-1", "O08678-1", "O08679-1", "P13286-1", "Q06486-1", "P18266-1", "Q13131-1", "Q8IWQ3-1", "Q8TDC3-1", "P49840-1", "P49841-1", "P48730-1", "Q7KZI7-1", "Q9P0L2-1", "Q16816-1", "Q5EG47-1", "Q5RJI5-1", "Q69Z98-1", "Q05512-1", "Q2NL51-1", "Q8VHJ5-1", "Q9WV60-1", "Q9DC28-1", "P07934-1", "P51136-1", "Q55C57-1", "P83101-1" ], "evidence": [ { "id": "53904", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/53904" } ] }, { "id": "R-MMU-1504186", "name": "DVL recruits GSK3beta:AXIN1 to the receptor complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-1504186", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1504186" } ] }, { "id": "R-MMU-182564", "name": "Phosphorylation of Cyclin D1 on Thr-286 by GSK-3 beta", "equation": "", "summary": "Phosphorylation of cyclin D1 on Thr-286 by glycogen synthase kinase-3beta (GSK-3beta) positively regulates proteasomal degradation of D1 (Diehl et al., 1998).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P30285-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-182564", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-182564" } ] }, { "id": "R-MMU-195251", "name": "Assembly of the destruction complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BK63-1", "P62715-1", "P63330-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-195251", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-195251" } ] }, { "id": "R-MMU-195275", "name": "Phosphorylation of APC component of the destruction complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BK63-1", "P62715-1", "P63330-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-195275", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-195275" } ] }, { "id": "R-MMU-195280", "name": "Dissociation of beta-catenin from Axin and association of beta catenin with phospho-(20 aa) APC in the detruction complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BK63-1", "P62715-1", "P63330-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-195280", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-195280" } ] }, { "id": "R-MMU-195283", "name": "Phosphorylation of phospho- (Ser45, Thr41) beta-catenin at Ser37 by GSK-3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BK63-1", "P62715-1", "P63330-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-195283", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-195283" } ] }, { "id": "R-MMU-195287", "name": "Phosphorylation of phospho-(Ser45 ) at Thr 41 by GSK-3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BK63-1", "P62715-1", "P63330-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-195287", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-195287" } ] }, { "id": "R-MMU-195300", "name": "Phosphorylation of phospho-(Ser45,Thr41,Ser37) at Ser33 by GSK-3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BK63-1", "P62715-1", "P63330-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-195300", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-195300" } ] }, { "id": "R-MMU-195304", "name": "Association of beta-catenin with the destruction complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BK63-1", "P62715-1", "P63330-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-195304", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-195304" } ] }, { "id": "R-MMU-195318", "name": "Phosphorylation of beta-catenin at Ser45 by CK1 alpha", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BK63-1", "P62715-1", "P63330-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-195318", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-195318" } ] }, { "id": "R-MMU-201677", "name": "Phosphorylation of LRP5/6 cytoplasmic domain by membrane-associated GSK3beta", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-201677", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-201677" } ] }, { "id": "R-MMU-201685", "name": "Beta-catenin is released from the destruction complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BK63-1", "P62715-1", "P63330-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-201685", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-201685" } ] }, { "id": "R-MMU-2130279", "name": "Association of beta-catenin with the RBX1:SCF(beta-TrCP1) ubiquitin ligase complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BK63-1", "P62715-1", "P63330-1", "P62878-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-2130279", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2130279" } ] }, { "id": "R-MMU-2130282", "name": "Degradation of ubiquitinated beta catenin by the proteasome", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O55234-1", "P28063-1", "P28076-1", "P70195-1", "Q8BK63-1", "O35955-1", "O35593-1", "P62715-1", "P63330-1", "Q60692-1", "Q8BG41-1", "P62878-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-2130282", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2130282" } ] }, { "id": "R-MMU-2130286", "name": "Multi-ubiquitination of phospho-beta-catenin by RBX1:SCF(beta-TrCP1)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BK63-1", "P62715-1", "P63330-1", "P62878-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-2130286", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2130286" } ] }, { "id": "R-MMU-3371435", "name": "Constitutive phosphorylation by GSK3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-MMU-4793927" ], "enzyme_list": [ "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-3371435", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3371435" } ] }, { "id": "R-MMU-399951", "name": "Phosphorylation of CRMPs by GSK3beta", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P49615-1", "P39688-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-399951", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-399951" } ] }, { "id": "R-MMU-5229343", "name": "AXIN is phosphorylated in the destruction complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BK63-1", "P62715-1", "P63330-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-5229343", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5229343" } ] }, { "id": "R-MMU-5250947", "name": "B-WICH complex binds rDNA promoter", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [ "R-ALL-73682", "R-MMU-417140", "R-MMU-417153", "R-MMU-5250643", "R-MMU-5250650", "R-MMU-5250652", "R-MMU-71968" ], "output_participant_list": [ "R-MMU-3321990" ], "enzyme_list": [ "Q91ZW3-1", "Q9JIK5-1", "O35134-1", "Q9Z277-1", "P70700-1", "F8VPZ5-1", "Q9WV60-1", "P63260-1" ], "evidence": [ { "id": "R-MMU-5250947", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5250947" } ] }, { "id": "R-MMU-5323526", "name": "FRAT proteins bind GSK3beta", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-5323526", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5323526" } ] }, { "id": "R-MMU-5368596", "name": "WNT3A stimulates the caveolin-dependent internalization of FZD5:p-LRP6", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "early endosome membrane, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-5368596", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5368596" } ] }, { "id": "R-MMU-5610732", "name": "GSK3 phosphorylates p-GLI3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-5610732", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5610732" } ] }, { "id": "R-MMU-9008677", "name": "Fbxw7 binds Runx2 and Gsk3b", "equation": "", "summary": "In mouse cells, it was shown that Fbxw7alpha, an E3 ubiquitin ligase which is part of an SCF complex, binds to Runx2 in the presence of Gsk3b. Gsk3b-mediated phosphorylation of Runx2 is probably a pre-requisite for Fbxw7alpha binding to Runx2 (Kumar et al. 2015). The presence of other subunits of the SCF complex in the Runx2 co-immunoprecipitate has not been tested but is assumed.", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P62878-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-9008677", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9008677" } ] }, { "id": "R-MMU-9008715", "name": "Fbxw7 polyubiquitinates Runx2", "equation": "", "summary": "In mouse cells, the E3 ubiquitin ligase Fbxw7alpha, a component of an SCF complex, polyubiquitinates Runx2 in the presence of Gsk3b (Kumar et al. 2015).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P62878-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-9008715", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9008715" } ] }, { "id": "R-MMU-9008717", "name": "Proteasome degrades polyubiquitinated Runx2", "equation": "", "summary": "In mouse cells, Runx2 polyubiquitinated by Fbxw7alpha is degraded by the proteasome (Kumar et al. 2015).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O55234-1", "P28063-1", "P28076-1", "P70195-1", "O35955-1", "Q60692-1", "Q8BG41-1", "P62878-1", "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-9008717", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9008717" } ] }, { "id": "R-MMU-9762094", "name": "GSK3B phosphorylates p-NFE2L2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9WV60-1" ], "evidence": [ { "id": "R-MMU-9762094", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9762094" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-73682", "participant_name": "rDNA Promoter [nucleoplasm]", "crossref": [ { "id": "61120", "database": "ChEBI", "url": "" }, { "id": "61120", "database": "ChEBI", "url": "" }, { "id": "61120", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-MMU-3321990", "participant_name": "Actg1 [nucleoplasm]", "crossref": [ { "id": "P63260", "database": "UniProt", "url": "" }, { "id": "ENSMUSG00000062825", "database": "Ensembl", "url": "" }, { "id": "NP_033739.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUST00000106215", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000071555", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000071486", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000101822", "database": "Ensembl", "url": "" }, { "id": "P63260", "database": "PRO", "url": "" }, { "id": "87906", "database": "MGI", "url": "" } ] }, { "participant_id": "R-MMU-417140", "participant_name": "SMARCA5 [nucleoplasm]", "crossref": [ { "id": "ENSMUSG00000031715", "database": "Ensembl", "url": "" }, { "id": "Q91ZW3", "database": "UniProt", "url": "" }, { "id": "1935129", "database": "MGI", "url": "" }, { "id": "NP_444354.2", "database": "RefSeq", "url": "" }, { "id": "ENSMUST00000043359", "database": "Ensembl", "url": "" }, { "id": "Q91ZW3", "database": "PRO", "url": "" }, { "id": "ENSMUSP00000044361", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-MMU-417153", "participant_name": "Baz1b [nucleoplasm]", "crossref": [ { "id": "NP_035844.2", "database": "RefSeq", "url": "" }, { "id": "1353499", "database": "MGI", "url": "" }, { "id": "Q9Z277", "database": "UniProt", "url": "" }, { "id": "ENSMUST00000002825", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000002825", "database": "Ensembl", "url": "" }, { "id": "ENSMUSG00000002748", "database": "Ensembl", "url": "" }, { "id": "Q9Z277", "database": "PRO", "url": "" }, { "id": "2.7.10.2", "database": "IntEnz", "url": "" }, { "id": "XP_011239182.1", "database": "RefSeq", "url": "" } ] }, { "participant_id": "R-MMU-4793927", "participant_name": "phospho-Hsf1 [cytosol]", "crossref": [ { "id": "P38532", "database": "UniProt", "url": "" }, { "id": "P38532", "database": "PRO", "url": "" }, { "id": "NP_001318083.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSG00000022556", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000072838", "database": "Ensembl", "url": "" }, { "id": "96238", "database": "MGI", "url": "" }, { "id": "ENSMUSP00000072617", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000154602", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000227478", "database": "Ensembl", "url": "" }, { "id": "NP_032322.1", "database": "RefSeq", "url": "" } ] }, { "participant_id": "R-MMU-5250643", "participant_name": "Dek [nucleoplasm]", "crossref": [ { "id": "Q7TNV0", "database": "PRO", "url": "" }, { "id": "ENSMUST00000021807", "database": "Ensembl", "url": "" }, { "id": "Q7TNV0", "database": "UniProt", "url": "" }, { "id": "ENSMUSG00000021377", "database": "Ensembl", "url": "" }, { "id": "NP_080176.2", "database": "RefSeq", "url": "" }, { "id": "1926209", "database": "MGI", "url": "" }, { "id": "ENSMUSP00000021807", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-MMU-5250650", "participant_name": "Mybbp1a [nucleoplasm]", "crossref": [ { "id": "Q7TPV4", "database": "PRO", "url": "" }, { "id": "ENSMUST00000045633", "database": "Ensembl", "url": "" }, { "id": "106181", "database": "MGI", "url": "" }, { "id": "NP_058056.2", "database": "RefSeq", "url": "" }, { "id": "ENSMUSG00000040463", "database": "Ensembl", "url": "" }, { "id": "Q7TPV4", "database": "UniProt", "url": "" }, { "id": "ENSMUSP00000044827", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-MMU-5250652", "participant_name": "DDX21 [nucleoplasm]", "crossref": [ { "id": "ENSMUST00000045866", "database": "Ensembl", "url": "" }, { "id": "3ZIN", "database": "PDB", "url": "" }, { "id": "NP_062426.2", "database": "RefSeq", "url": "" }, { "id": "3.6.4.13", "database": "IntEnz", "url": "" }, { "id": "Q9JIK5", "database": "UniProt", "url": "" }, { "id": "ENSMUSG00000020075", "database": "Ensembl", "url": "" }, { "id": "Q9JIK5", "database": "PRO", "url": "" }, { "id": "1860494", "database": "MGI", "url": "" }, { "id": "ENSMUSP00000042691", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-MMU-71968", "participant_name": "Sf3b1 [nucleoplasm]", "crossref": [ { "id": "1932339", "database": "MGI", "url": "" }, { "id": "Q99NB9", "database": "UniProt", "url": "" }, { "id": "Q99NB9", "database": "PRO", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0B4J2F2", "gene_name": "SIK1B", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A0B4J2F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4J2F2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A0B4J2F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4J2F2" } ] } ] }, { "uniprot_ac": "A0A0B4KHC3", "gene_name": "PKD", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A0B4KHC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KHC3" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "A0A0B4KHC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KHC3" } ] } ] }, { "uniprot_ac": "A0A0B4KHT3", "gene_name": "Lrrk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A0B4KHT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KHT3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A0B4KHT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KHT3" } ] } ] }, { "uniprot_ac": "A0A0B4KHX7", "gene_name": "Gcn2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A0B4KHX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KHX7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A0B4KHX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KHX7" } ] } ] }, { "uniprot_ac": "A0A0G2JUP3", "gene_name": "Obscn", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A0G2JUP3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JUP3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A0G2JUP3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JUP3" } ] } ] }, { "uniprot_ac": "A0A0G2JVL3", "gene_name": "Mast3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A0G2JVL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JVL3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A0G2JVL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JVL3" } ] } ] }, { "uniprot_ac": "A0A0G2JZW9", "gene_name": "ENSRNOG00000068522", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A0G2JZW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZW9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A0G2JZW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZW9" } ] } ] }, { "uniprot_ac": "A0A0G2K344", "gene_name": "Pik3ca", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A0G2K344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K344" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "A0A0G2K344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K344" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "A0A0G2K344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K344" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "A0A0G2K344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K344" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "A0A0G2K344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K344" } ] } ] }, { "uniprot_ac": "A0A0G2K5L3", "gene_name": "Riok1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A0G2K5L3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K5L3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A0G2K5L3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K5L3" } ] } ] }, { "uniprot_ac": "A0A0G2KB60", "gene_name": "Rps6kc1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A0G2KB60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2KB60" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A0G2KB60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2KB60" } ] } ] }, { "uniprot_ac": "A0A126GUV7", "gene_name": "fray", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A126GUV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A126GUV7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A126GUV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A126GUV7" } ] } ] }, { "uniprot_ac": "A0A1W2Q671", "gene_name": "Wnk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A1W2Q671", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2Q671" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A1W2Q671", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2Q671" } ] } ] }, { "uniprot_ac": "A0A4D6K823", "gene_name": "nmo", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A4D6K823", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A4D6K823" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "A0A4D6K823", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A4D6K823" } ] } ] }, { "uniprot_ac": "A0A8I5ZNK2", "gene_name": "Oxsr1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I5ZNK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZNK2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8I5ZNK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZNK2" } ] } ] }, { "uniprot_ac": "A0A8I5ZP97", "gene_name": "Dyrk1b", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I5ZP97", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZP97" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "A0A8I5ZP97", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZP97" } ] } ] }, { "uniprot_ac": "A0A8I5ZZZ6", "gene_name": "Riok3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I5ZZZ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZZZ6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8I5ZZZ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZZZ6" } ] } ] }, { "uniprot_ac": "A0A8I6A0F8", "gene_name": "Stk4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6A0F8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A0F8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8I6A0F8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A0F8" } ] } ] }, { "uniprot_ac": "A0A8I6A165", "gene_name": "LOC120093114", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6A165", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A165" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8I6A165", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A165" } ] } ] }, { "uniprot_ac": "A0A8I6A7D1", "gene_name": "Rps6ka5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6A7D1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A7D1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8I6A7D1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A7D1" } ] } ] }, { "uniprot_ac": "A0A8I6A9E8", "gene_name": "Prkg1", "activity": [ { "ec_number": "2.7.11.12", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6A9E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A9E8" } ] }, { "ec_number": "2.7.11.12", "activity": "", "evidence": [ { "id": "A0A8I6A9E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A9E8" } ] } ] }, { "uniprot_ac": "A0A8I6AC38", "gene_name": "Wnk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6AC38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AC38" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8I6AC38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AC38" } ] } ] }, { "uniprot_ac": "A0A8I6AD01", "gene_name": "Rps6kl1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6AD01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AD01" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8I6AD01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AD01" } ] } ] }, { "uniprot_ac": "A0A8I6AEL0", "gene_name": "Map3k5", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6AEL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AEL0" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "A0A8I6AEL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AEL0" } ] } ] }, { "uniprot_ac": "A0A8I6AJX5", "gene_name": "RGD1561440", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6AJX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AJX5" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "A0A8I6AJX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AJX5" } ] } ] }, { "uniprot_ac": "A0A8I6ANX6", "gene_name": "Dmpk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6ANX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ANX6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8I6ANX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ANX6" } ] } ] }, { "uniprot_ac": "A0A8I6AQN6", "gene_name": "Rps6ka6", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6AQN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AQN6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8I6AQN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AQN6" } ] } ] }, { "uniprot_ac": "A0A8I6ATY6", "gene_name": "Mast2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6ATY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ATY6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8I6ATY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ATY6" } ] } ] }, { "uniprot_ac": "A0A8I6AUJ4", "gene_name": "Mast4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6AUJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AUJ4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8I6AUJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AUJ4" } ] } ] }, { "uniprot_ac": "A0A8I6AWX7", "gene_name": "Dyrk4", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6AWX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AWX7" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "A0A8I6AWX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AWX7" } ] } ] }, { "uniprot_ac": "A0A8I6G1H3", "gene_name": "Irak4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6G1H3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G1H3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8I6G1H3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G1H3" } ] } ] }, { "uniprot_ac": "A0A8I6GK52", "gene_name": "Smg1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8I6GK52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6GK52" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8I6GK52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6GK52" } ] } ] }, { "uniprot_ac": "A0A8J8XEH6", "gene_name": "ENSRNOG00000067334", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A8J8XEH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8J8XEH6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0A8J8XEH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8J8XEH6" } ] } ] }, { "uniprot_ac": "A0AUV4", "gene_name": "Gm7168", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0AUV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0AUV4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0AUV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0AUV4" } ] } ] }, { "uniprot_ac": "A1A5Q6", "gene_name": "Smok", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A1A5Q6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1A5Q6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A1A5Q6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1A5Q6" } ] } ] }, { "uniprot_ac": "A1Z7T0", "gene_name": "Pkn", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A1Z7T0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z7T0" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "A1Z7T0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z7T0" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "A1Z7T0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z7T0" } ] } ] }, { "uniprot_ac": "A1Z9X0", "gene_name": "aPKC", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A1Z9X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z9X0" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "A1Z9X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z9X0" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "A1Z9X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z9X0" } ] } ] }, { "uniprot_ac": "A1ZBC4", "gene_name": "Sik3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A1ZBC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBC4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A1ZBC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBC4" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "A1ZBC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBC4" } ] } ] }, { "uniprot_ac": "A1ZBH7", "gene_name": "hppy", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A1ZBH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBH7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A1ZBH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBH7" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "A1ZBH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBH7" } ] } ] }, { "uniprot_ac": "A1ZBL9", "gene_name": "par-1", "activity": [ { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "A1ZBL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBL9" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "A1ZBL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBL9" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A1ZBL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBL9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A1ZBL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBL9" } ] } ] }, { "uniprot_ac": "A2AAJ9", "gene_name": "Obscn", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A2AAJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AAJ9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A2AAJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AAJ9" } ] } ] }, { "uniprot_ac": "A2AQW0", "gene_name": "Map3k15", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A2AQW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AQW0" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "A2AQW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AQW0" } ] } ] }, { "uniprot_ac": "A2ASS6", "gene_name": "Ttn", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A2ASS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2ASS6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A2ASS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2ASS6" } ] } ] }, { "uniprot_ac": "A2CG49", "gene_name": "Kalrn", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A2CG49", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2CG49" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A2CG49", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2CG49" } ] } ] }, { "uniprot_ac": "A2KF29", "gene_name": "Smoktcr", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A2KF29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2KF29" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A2KF29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2KF29" } ] } ] }, { "uniprot_ac": "A4L9P5", "gene_name": "Hipk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A4L9P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A4L9P5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A4L9P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A4L9P5" } ] } ] }, { "uniprot_ac": "A4VCL2", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A4VCL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A4VCL2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A4VCL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A4VCL2" } ] } ] }, { "uniprot_ac": "A6KB61", "gene_name": "Riok2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A6KB61", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6KB61" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A6KB61", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6KB61" } ] } ] }, { "uniprot_ac": "B0G126", "gene_name": "pip5k3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "B0G126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0G126" } ] }, { "ec_number": "2.7.1.150", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,5-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "B0G126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0G126" } ] }, { "ec_number": "2.7.1.150", "activity": "", "evidence": [ { "id": "B0G126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0G126" } ] } ] }, { "uniprot_ac": "B0LT89", "gene_name": "Stk24", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "B0LT89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0LT89" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "B0LT89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0LT89" } ] } ] }, { "uniprot_ac": "B1WBU5", "gene_name": "Sbk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "B1WBU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1WBU5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "B1WBU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1WBU5" } ] } ] }, { "uniprot_ac": "B2DD29", "gene_name": "Brsk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "B2DD29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2DD29" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "B2DD29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2DD29" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "B2DD29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2DD29" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "B2DD29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2DD29" } ] } ] }, { "uniprot_ac": "B2GUY1", "gene_name": "Plk4", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "B2GUY1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GUY1" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "B2GUY1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GUY1" } ] } ] }, { "uniprot_ac": "B5DFG1", "gene_name": "Pink1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "B5DFG1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B5DFG1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "B5DFG1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B5DFG1" } ] } ] }, { "uniprot_ac": "C0HKC8", "gene_name": "Smok3a", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "C0HKC8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C0HKC8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "C0HKC8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C0HKC8" } ] } ] }, { "uniprot_ac": "C0HKC9", "gene_name": "Smok3b", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "C0HKC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C0HKC9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "C0HKC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C0HKC9" } ] } ] }, { "uniprot_ac": "D3Z822", "gene_name": "Atr", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3Z822", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z822" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3Z822", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z822" } ] } ] }, { "uniprot_ac": "D3Z837", "gene_name": "Cdc42bpg", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3Z837", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z837" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3Z837", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z837" } ] } ] }, { "uniprot_ac": "D3Z8E0", "gene_name": "Rps6ka3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3Z8E0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8E0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3Z8E0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8E0" } ] } ] }, { "uniprot_ac": "D3Z8I4", "gene_name": "Map4k1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3Z8I4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8I4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3Z8I4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8I4" } ] } ] }, { "uniprot_ac": "D3ZBE5", "gene_name": "Nek7", "activity": [ { "ec_number": "2.7.11.34", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZBE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBE5" } ] }, { "ec_number": "2.7.11.34", "activity": "", "evidence": [ { "id": "D3ZBE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBE5" } ] } ] }, { "uniprot_ac": "D3ZCD7", "gene_name": "Tp53rkb", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZCD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZCD7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3ZCD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZCD7" } ] } ] }, { "uniprot_ac": "D3ZFL3", "gene_name": "Map3k6", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZFL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZFL3" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "D3ZFL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZFL3" } ] } ] }, { "uniprot_ac": "D3ZG83", "gene_name": "Map3k10", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZG83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZG83" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "D3ZG83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZG83" } ] } ] }, { "uniprot_ac": "D3ZGQ5", "gene_name": "Nek8", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZGQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZGQ5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3ZGQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZGQ5" } ] } ] }, { "uniprot_ac": "D3ZHL6", "gene_name": "Map4k5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZHL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZHL6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3ZHL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZHL6" } ] } ] }, { "uniprot_ac": "D3ZHP7", "gene_name": "Ulk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZHP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZHP7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3ZHP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZHP7" } ] } ] }, { "uniprot_ac": "D3ZL21", "gene_name": "Tp53rka", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZL21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZL21" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3ZL21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZL21" } ] } ] }, { "uniprot_ac": "D3ZMG0", "gene_name": "Ulk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZMG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZMG0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3ZMG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZMG0" } ] } ] }, { "uniprot_ac": "D3ZML2", "gene_name": "Brsk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZML2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZML2" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "D3ZML2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZML2" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "D3ZML2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZML2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3ZML2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZML2" } ] } ] }, { "uniprot_ac": "D3ZRJ7", "gene_name": "Lrrk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZRJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZRJ7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3ZRJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZRJ7" } ] } ] }, { "uniprot_ac": "D3ZSB7", "gene_name": "Rps6ka4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZSB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZSB7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3ZSB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZSB7" } ] } ] }, { "uniprot_ac": "D3ZSZ3", "gene_name": "Nlk", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZSZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZSZ3" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "D3ZSZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZSZ3" } ] } ] }, { "uniprot_ac": "D3ZTD1", "gene_name": "Map3k14", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZTD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZTD1" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "D3ZTD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZTD1" } ] } ] }, { "uniprot_ac": "D3ZXB1", "gene_name": "Map4k2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZXB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXB1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D3ZXB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXB1" } ] } ] }, { "uniprot_ac": "D3ZY07", "gene_name": "Plk5", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D3ZY07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZY07" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "D3ZY07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZY07" } ] } ] }, { "uniprot_ac": "D4A229", "gene_name": "Prkd3", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D4A229", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A229" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "D4A229", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A229" } ] } ] }, { "uniprot_ac": "D4A280", "gene_name": "Pak5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D4A280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A280" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D4A280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A280" } ] } ] }, { "uniprot_ac": "D4A454", "gene_name": "Map3k21", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D4A454", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A454" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "D4A454", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A454" } ] } ] }, { "uniprot_ac": "D4A6T6", "gene_name": "Melk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D4A6T6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A6T6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D4A6T6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A6T6" } ] } ] }, { "uniprot_ac": "D4A6T9", "gene_name": "Mark4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D4A6T9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A6T9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D4A6T9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A6T9" } ] } ] }, { "uniprot_ac": "D4A7V9", "gene_name": "Eif2ak4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D4A7V9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A7V9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D4A7V9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A7V9" } ] } ] }, { "uniprot_ac": "D4ACL8", "gene_name": "Atm", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D4ACL8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACL8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D4ACL8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACL8" } ] } ] }, { "uniprot_ac": "D4AD76", "gene_name": "Aurkc", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D4AD76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AD76" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D4AD76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AD76" } ] } ] }, { "uniprot_ac": "D4AE24", "gene_name": "Rps6kb2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D4AE24", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AE24" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D4AE24", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AE24" } ] } ] }, { "uniprot_ac": "D4AE59", "gene_name": "Stk11", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "D4AE59", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AE59" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "D4AE59", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AE59" } ] } ] }, { "uniprot_ac": "E9PSK5", "gene_name": "Sik2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "E9PSK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PSK5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "E9PSK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PSK5" } ] } ] }, { "uniprot_ac": "E9PSL7", "gene_name": "Cit", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "E9PSL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PSL7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "E9PSL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PSL7" } ] } ] }, { "uniprot_ac": "E9PTG8", "gene_name": "Stk10", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "E9PTG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PTG8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "E9PTG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PTG8" } ] } ] }, { "uniprot_ac": "E9Q3S4", "gene_name": "Map3k19", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "E9Q3S4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q3S4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "E9Q3S4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q3S4" } ] } ] }, { "uniprot_ac": "F1LN87", "gene_name": "Mapkapk5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F1LN87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LN87" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "F1LN87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LN87" } ] } ] }, { "uniprot_ac": "F1LNJ1", "gene_name": "Lrrk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F1LNJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LNJ1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "F1LNJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LNJ1" } ] } ] }, { "uniprot_ac": "F1LNN8", "gene_name": "Dapk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F1LNN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LNN8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "F1LNN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LNN8" } ] } ] }, { "uniprot_ac": "F1LP90", "gene_name": "Mink1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F1LP90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LP90" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "F1LP90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LP90" } ] } ] }, { "uniprot_ac": "F1LRA7", "gene_name": "Map3k9", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F1LRA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LRA7" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "F1LRA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LRA7" } ] } ] }, { "uniprot_ac": "F1LUY7", "gene_name": "Map3k15", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F1LUY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LUY7" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "F1LUY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LUY7" } ] } ] }, { "uniprot_ac": "F1LXF1", "gene_name": "Bcr", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F1LXF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LXF1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "F1LXF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LXF1" } ] } ] }, { "uniprot_ac": "F1LYY7", "gene_name": "Dyrk2", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F1LYY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LYY7" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "F1LYY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LYY7" } ] } ] }, { "uniprot_ac": "F1M0Z1", "gene_name": "Trio", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F1M0Z1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M0Z1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "F1M0Z1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M0Z1" } ] } ] }, { "uniprot_ac": "F1M419", "gene_name": "Pim2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F1M419", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M419" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "F1M419", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M419" } ] } ] }, { "uniprot_ac": "F1M7G0", "gene_name": "Trpm6", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F1M7G0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M7G0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "F1M7G0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M7G0" } ] } ] }, { "uniprot_ac": "F1M7N7", "gene_name": "Rps6ka2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F1M7N7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M7N7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "F1M7N7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M7N7" } ] } ] }, { "uniprot_ac": "F1M7Y5", "gene_name": "Prkci", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F1M7Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M7Y5" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "F1M7Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M7Y5" } ] } ] }, { "uniprot_ac": "F7FMK8", "gene_name": "Map3k13", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "F7FMK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7FMK8" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "F7FMK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7FMK8" } ] } ] }, { "uniprot_ac": "F8VPZ5", "gene_name": "Ercc6", "activity": [ { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "F8VPZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F8VPZ5" } ] } ] }, { "uniprot_ac": "G3V783", "gene_name": "Ripk2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "G3V783", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V783" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "G3V783", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V783" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "G3V783", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V783" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "G3V783", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V783" } ] } ] }, { "uniprot_ac": "M0RBT0", "gene_name": "Haspin", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "M0RBT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RBT0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "M0RBT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RBT0" } ] } ] }, { "uniprot_ac": "M0RD40", "gene_name": "Sik3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "M0RD40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RD40" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "M0RD40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RD40" } ] } ] }, { "uniprot_ac": "M9PGC5", "gene_name": "Wnk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "M9PGC5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M9PGC5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "M9PGC5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M9PGC5" } ] } ] }, { "uniprot_ac": "O00141", "gene_name": "SGK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O00141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00141" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O00141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00141" } ] } ] }, { "uniprot_ac": "O00311", "gene_name": "CDC7", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O00311", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00311" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O00311", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00311" } ] } ] }, { "uniprot_ac": "O00444", "gene_name": "PLK4", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O00444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00444" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "O00444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00444" } ] } ] }, { "uniprot_ac": "O00506", "gene_name": "STK25", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O00506", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00506" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O00506", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00506" } ] } ] }, { "uniprot_ac": "O08605", "gene_name": "Mknk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O08605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08605" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O08605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08605" } ] } ] }, { "uniprot_ac": "O08648", "gene_name": "Map3k4", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O08648", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08648" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "O08648", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08648" } ] } ] }, { "uniprot_ac": "O08678", "gene_name": "Mark1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O08678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08678" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O08678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08678" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "O08678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08678" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "O08678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08678" } ] } ] }, { "uniprot_ac": "O08679", "gene_name": "Mark2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O08679", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08679" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O08679", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08679" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "O08679", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08679" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "O08679", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08679" } ] } ] }, { "uniprot_ac": "O08815", "gene_name": "Slk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O08815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08815" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O08815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08815" } ] } ] }, { "uniprot_ac": "O08874", "gene_name": "Pkn2", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O08874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08874" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "O08874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08874" } ] } ] }, { "uniprot_ac": "O08875", "gene_name": "Dclk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O08875", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08875" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O08875", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08875" } ] } ] }, { "uniprot_ac": "O08901", "gene_name": "Bub1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O08901", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08901" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O08901", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08901" } ] } ] }, { "uniprot_ac": "O08911", "gene_name": "Mapk12", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O08911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08911" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "O08911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08911" } ] } ] }, { "uniprot_ac": "O09110", "gene_name": "Map2k3", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O09110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09110" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "O09110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09110" } ] } ] }, { "uniprot_ac": "O14578", "gene_name": "CIT", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O14578", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14578" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O14578", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14578" } ] } ] }, { "uniprot_ac": "O14730", "gene_name": "RIOK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O14730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14730" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O14730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14730" } ] } ] }, { "uniprot_ac": "O14733", "gene_name": "MAP2K7", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O14733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14733" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "O14733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14733" } ] } ] }, { "uniprot_ac": "O14757", "gene_name": "CHEK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O14757", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14757" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O14757", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14757" } ] } ] }, { "uniprot_ac": "O14920", "gene_name": "IKBKB", "activity": [ { "ec_number": "2.7.11.10", "activity": "ATP + L-seryl-[I-kappa-B protein] = ADP + H(+) + O-phospho-L-seryl-[I-kappa-B protein].", "evidence": [ { "id": "O14920", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14920" } ] }, { "ec_number": "2.7.11.10", "activity": "", "evidence": [ { "id": "O14920", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14920" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O14920", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14920" } ] } ] }, { "uniprot_ac": "O14936", "gene_name": "CASK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O14936", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14936" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O14936", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14936" } ] } ] }, { "uniprot_ac": "O14965", "gene_name": "AURKA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O14965", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14965" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O14965", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14965" } ] } ] }, { "uniprot_ac": "O14976", "gene_name": "GAK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O14976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14976" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O14976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14976" } ] } ] }, { "uniprot_ac": "O15021", "gene_name": "MAST4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O15021", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15021" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O15021", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15021" } ] } ] }, { "uniprot_ac": "O15075", "gene_name": "DCLK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O15075", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15075" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O15075", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15075" } ] } ] }, { "uniprot_ac": "O15264", "gene_name": "MAPK13", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O15264", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15264" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "O15264", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15264" } ] } ] }, { "uniprot_ac": "O15530", "gene_name": "PDPK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O15530", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15530" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O15530", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15530" } ] } ] }, { "uniprot_ac": "O35099", "gene_name": "Map3k5", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O35099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35099" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "O35099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35099" } ] } ] }, { "uniprot_ac": "O35134", "gene_name": "Polr1a", "activity": [ { "ec_number": "2.7.7.6", "activity": "a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1).", "evidence": [ { "id": "O35134", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35134" } ] }, { "ec_number": "2.7.7.6", "activity": "", "evidence": [ { "id": "O35134", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35134" } ] } ] }, { "uniprot_ac": "O35280", "gene_name": "Chek1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O35280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35280" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O35280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35280" } ] } ] }, { "uniprot_ac": "O35491", "gene_name": "Clk2", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O35491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35491" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "O35491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35491" } ] } ] }, { "uniprot_ac": "O35492", "gene_name": "Clk3", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O35492", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35492" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "O35492", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35492" } ] } ] }, { "uniprot_ac": "O35493", "gene_name": "Clk4", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O35493", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35493" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "O35493", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35493" } ] } ] }, { "uniprot_ac": "O35495", "gene_name": "Cdk14", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O35495", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35495" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "O35495", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35495" } ] } ] }, { "uniprot_ac": "O35593", "gene_name": "Psmd14", "activity": [ { "ec_number": "3.4.19.-", "activity": "", "evidence": [ { "id": "O35593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35593" } ] } ] }, { "uniprot_ac": "O35831", "gene_name": "Cdk17", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O35831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35831" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "O35831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35831" } ] } ] }, { "uniprot_ac": "O35832", "gene_name": "Cdk18", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O35832", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35832" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "O35832", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35832" } ] } ] }, { "uniprot_ac": "O35942", "gene_name": "Nek2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O35942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35942" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O35942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35942" } ] } ] }, { "uniprot_ac": "O35955", "gene_name": "Psmb10", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "O35955", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35955" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "O35955", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35955" } ] } ] }, { "uniprot_ac": "O43283", "gene_name": "MAP3K13", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O43283", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43283" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "O43283", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43283" } ] } ] }, { "uniprot_ac": "O43293", "gene_name": "DAPK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O43293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43293" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O43293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43293" } ] } ] }, { "uniprot_ac": "O43318", "gene_name": "MAP3K7", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O43318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43318" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "O43318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43318" } ] } ] }, { "uniprot_ac": "O43353", "gene_name": "RIPK2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "O43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43353" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43353" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43353" } ] } ] }, { "uniprot_ac": "O43683", "gene_name": "BUB1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O43683", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43683" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O43683", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43683" } ] } ] }, { "uniprot_ac": "O43781", "gene_name": "DYRK3", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O43781", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43781" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "O43781", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43781" } ] } ] }, { "uniprot_ac": "O43930", "gene_name": "PRKY", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O43930", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43930" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O43930", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43930" } ] } ] }, { "uniprot_ac": "O54748", "gene_name": "Stk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O54748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54748" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O54748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54748" } ] } ] }, { "uniprot_ac": "O54781", "gene_name": "Srpk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O54781", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54781" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O54781", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54781" } ] } ] }, { "uniprot_ac": "O54784", "gene_name": "Dapk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O54784", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54784" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O54784", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54784" } ] } ] }, { "uniprot_ac": "O54785", "gene_name": "Limk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O54785", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54785" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O54785", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54785" } ] } ] }, { "uniprot_ac": "O54833", "gene_name": "Csnk2a2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O54833", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54833" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O54833", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54833" } ] } ] }, { "uniprot_ac": "O54863", "gene_name": "Tssk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O54863", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54863" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O54863", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54863" } ] } ] }, { "uniprot_ac": "O54874", "gene_name": "Cdc42bpa", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O54874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54874" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O54874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54874" } ] } ] }, { "uniprot_ac": "O54949", "gene_name": "Nlk", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O54949", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54949" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "O54949", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54949" } ] } ] }, { "uniprot_ac": "O54967", "gene_name": "Tnk2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "O54967", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54967" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "O54967", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54967" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O54967", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54967" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O54967", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54967" } ] } ] }, { "uniprot_ac": "O54988", "gene_name": "Slk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O54988", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54988" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O54988", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54988" } ] } ] }, { "uniprot_ac": "O54992", "gene_name": "Mapkapk5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O54992", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54992" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O54992", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54992" } ] } ] }, { "uniprot_ac": "O55047", "gene_name": "Tlk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O55047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55047" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O55047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55047" } ] } ] }, { "uniprot_ac": "O55098", "gene_name": "Stk10", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O55098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55098" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O55098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55098" } ] } ] }, { "uniprot_ac": "O55099", "gene_name": "Aurkb", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O55099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55099" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O55099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55099" } ] } ] }, { "uniprot_ac": "O55173", "gene_name": "Pdpk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O55173", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55173" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O55173", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55173" } ] } ] }, { "uniprot_ac": "O55222", "gene_name": "Ilk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O55222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55222" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O55222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55222" } ] } ] }, { "uniprot_ac": "O55234", "gene_name": "Psmb5", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "O55234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55234" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "O55234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55234" } ] } ] }, { "uniprot_ac": "O60229", "gene_name": "KALRN", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O60229", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60229" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O60229", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60229" } ] } ] }, { "uniprot_ac": "O60285", "gene_name": "NUAK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O60285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60285" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O60285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60285" } ] } ] }, { "uniprot_ac": "O60307", "gene_name": "MAST3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O60307", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60307" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O60307", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60307" } ] } ] }, { "uniprot_ac": "O60566", "gene_name": "BUB1B", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O60566", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60566" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O60566", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60566" } ] } ] }, { "uniprot_ac": "O61122", "gene_name": "svkA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O61122", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O61122" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O61122", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O61122" } ] } ] }, { "uniprot_ac": "O61125", "gene_name": "krsA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O61125", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O61125" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O61125", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O61125" } ] } ] }, { "uniprot_ac": "O61267", "gene_name": "lok", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O61267", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O61267" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O61267", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O61267" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "O61267", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O61267" } ] } ] }, { "uniprot_ac": "O61443", "gene_name": "p38b", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O61443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O61443" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "O61443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O61443" } ] } ] }, { "uniprot_ac": "O61661", "gene_name": "grp", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O61661", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O61661" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O61661", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O61661" } ] } ] }, { "uniprot_ac": "O62618", "gene_name": "p38a", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O62618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O62618" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "O62618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O62618" } ] } ] }, { "uniprot_ac": "O70126", "gene_name": "Aurkb", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O70126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70126" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O70126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70126" } ] } ] }, { "uniprot_ac": "O70146", "gene_name": "Tesk1", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O70146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70146" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "O70146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70146" } ] } ] }, { "uniprot_ac": "O70150", "gene_name": "Pnck", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O70150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70150" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "O70150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70150" } ] } ] }, { "uniprot_ac": "O70405", "gene_name": "Ulk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O70405", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70405" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O70405", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70405" } ] } ] }, { "uniprot_ac": "O70444", "gene_name": "Pim3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O70444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70444" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O70444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70444" } ] } ] }, { "uniprot_ac": "O70551", "gene_name": "Srpk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O70551", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70551" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O70551", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70551" } ] } ] }, { "uniprot_ac": "O70589", "gene_name": "Cask", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O70589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70589" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O70589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70589" } ] } ] }, { "uniprot_ac": "O75116", "gene_name": "ROCK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O75116", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75116" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O75116", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75116" } ] } ] }, { "uniprot_ac": "O75385", "gene_name": "ULK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O75385", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75385" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O75385", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75385" } ] } ] }, { "uniprot_ac": "O75460", "gene_name": "ERN1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O75460", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75460" } ] }, { "ec_number": "3.1.26.-", "activity": "", "evidence": [ { "id": "O75460", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75460" } ] } ] }, { "uniprot_ac": "O75582", "gene_name": "RPS6KA5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O75582", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75582" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O75582", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75582" } ] } ] }, { "uniprot_ac": "O75676", "gene_name": "RPS6KA4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O75676", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75676" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O75676", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75676" } ] } ] }, { "uniprot_ac": "O75716", "gene_name": "STK16", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "O75716", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75716" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O75716", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75716" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O75716", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75716" } ] } ] }, { "uniprot_ac": "O75914", "gene_name": "PAK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O75914", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75914" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O75914", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75914" } ] } ] }, { "uniprot_ac": "O75962", "gene_name": "TRIO", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O75962", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75962" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O75962", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75962" } ] } ] }, { "uniprot_ac": "O76039", "gene_name": "CDKL5", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O76039", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76039" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "O76039", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76039" } ] } ] }, { "uniprot_ac": "O76324", "gene_name": "dco", "activity": [ { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "O76324", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76324" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O76324", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76324" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O76324", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76324" } ] } ] }, { "uniprot_ac": "O88351", "gene_name": "Ikbkb", "activity": [ { "ec_number": "2.7.11.10", "activity": "ATP + L-seryl-[I-kappa-B protein] = ADP + H(+) + O-phospho-L-seryl-[I-kappa-B protein].", "evidence": [ { "id": "O88351", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88351" } ] }, { "ec_number": "2.7.11.10", "activity": "", "evidence": [ { "id": "O88351", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88351" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O88351", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88351" } ] } ] }, { "uniprot_ac": "O88445", "gene_name": "Aurkc", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O88445", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88445" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O88445", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88445" } ] } ] }, { "uniprot_ac": "O88506", "gene_name": "Stk39", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O88506", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88506" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O88506", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88506" } ] } ] }, { "uniprot_ac": "O88643", "gene_name": "Pak1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O88643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88643" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O88643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88643" } ] } ] }, { "uniprot_ac": "O88664", "gene_name": "Taok1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O88664", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88664" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O88664", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88664" } ] } ] }, { "uniprot_ac": "O88697", "gene_name": "Stk16", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "O88697", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88697" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O88697", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88697" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O88697", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88697" } ] } ] }, { "uniprot_ac": "O88764", "gene_name": "Dapk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O88764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88764" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O88764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88764" } ] } ] }, { "uniprot_ac": "O88831", "gene_name": "Camkk2", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O88831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88831" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "O88831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88831" } ] } ] }, { "uniprot_ac": "O88850", "gene_name": "Hipk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O88850", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88850" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O88850", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88850" } ] } ] }, { "uniprot_ac": "O88866", "gene_name": "Hunk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O88866", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88866" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O88866", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88866" } ] } ] }, { "uniprot_ac": "O88904", "gene_name": "Hipk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O88904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88904" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O88904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88904" } ] } ] }, { "uniprot_ac": "O94768", "gene_name": "STK17B", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O94768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94768" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O94768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94768" } ] } ] }, { "uniprot_ac": "O94804", "gene_name": "STK10", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O94804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94804" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O94804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94804" } ] } ] }, { "uniprot_ac": "O94806", "gene_name": "PRKD3", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O94806", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94806" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "O94806", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94806" } ] } ] }, { "uniprot_ac": "O94921", "gene_name": "CDK14", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O94921", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94921" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "O94921", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94921" } ] } ] }, { "uniprot_ac": "O95382", "gene_name": "MAP3K6", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O95382", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95382" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "O95382", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95382" } ] } ] }, { "uniprot_ac": "O95747", "gene_name": "OXSR1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O95747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95747" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O95747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95747" } ] } ] }, { "uniprot_ac": "O95819", "gene_name": "MAP4K4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O95819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95819" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O95819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95819" } ] } ] }, { "uniprot_ac": "O95835", "gene_name": "LATS1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O95835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95835" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O95835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95835" } ] } ] }, { "uniprot_ac": "O96013", "gene_name": "PAK4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O96013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O96013" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O96013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O96013" } ] } ] }, { "uniprot_ac": "O96017", "gene_name": "CHEK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O96017", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O96017" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O96017", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O96017" } ] } ] }, { "uniprot_ac": "O97143", "gene_name": "SAK", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O97143", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O97143" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "O97143", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O97143" } ] } ] }, { "uniprot_ac": "P00536", "gene_name": "Mos", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P00536", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00536" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P00536", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00536" } ] } ] }, { "uniprot_ac": "P00539", "gene_name": "Mos", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P00539", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00539" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P00539", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00539" } ] } ] }, { "uniprot_ac": "P00540", "gene_name": "MOS", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P00540", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00540" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P00540", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00540" } ] } ] }, { "uniprot_ac": "P00546", "gene_name": "CDC28", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P00546", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00546" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P00546", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00546" } ] } ] }, { "uniprot_ac": "P04049", "gene_name": "RAF1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P04049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04049" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P04049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04049" } ] } ] }, { "uniprot_ac": "P04627", "gene_name": "Araf", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P04627", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04627" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P04627", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04627" } ] } ] }, { "uniprot_ac": "P05129", "gene_name": "PRKCG", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P05129", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05129" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P05129", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05129" } ] } ] }, { "uniprot_ac": "P05130", "gene_name": "Pkc53E", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P05130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05130" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P05130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05130" } ] } ] }, { "uniprot_ac": "P05132", "gene_name": "Prkaca", "activity": [ { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P05132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05132" } ] }, { "ec_number": "2.7.11.11", "activity": "", "evidence": [ { "id": "P05132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05132" } ] } ] }, { "uniprot_ac": "P05696", "gene_name": "Prkca", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P05696", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05696" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P05696", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05696" } ] } ] }, { "uniprot_ac": "P05771", "gene_name": "PRKCB", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P05771", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05771" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P05771", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05771" } ] } ] }, { "uniprot_ac": "P05986", "gene_name": "TPK3", "activity": [ { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P05986", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05986" } ] }, { "ec_number": "2.7.11.11", "activity": "", "evidence": [ { "id": "P05986", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05986" } ] } ] }, { "uniprot_ac": "P06243", "gene_name": "CDC7", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P06243", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06243" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P06243", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06243" } ] } ] }, { "uniprot_ac": "P06244", "gene_name": "TPK1", "activity": [ { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P06244", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06244" } ] }, { "ec_number": "2.7.11.11", "activity": "", "evidence": [ { "id": "P06244", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06244" } ] } ] }, { "uniprot_ac": "P06245", "gene_name": "TPK2", "activity": [ { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P06245", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06245" } ] }, { "ec_number": "2.7.11.11", "activity": "", "evidence": [ { "id": "P06245", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06245" } ] } ] }, { "uniprot_ac": "P06493", "gene_name": "CDK1", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P06493", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06493" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P06493", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06493" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P06493", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06493" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P06493", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06493" } ] } ] }, { "uniprot_ac": "P06782", "gene_name": "SNF1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P06782", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06782" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P06782", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06782" } ] } ] }, { "uniprot_ac": "P06784", "gene_name": "STE7", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P06784", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06784" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "P06784", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06784" } ] } ] }, { "uniprot_ac": "P06803", "gene_name": "Pim1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P06803", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06803" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P06803", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06803" } ] } ] }, { "uniprot_ac": "P07934", "gene_name": "Phkg1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P07934", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07934" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "P07934", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07934" } ] }, { "ec_number": "2.7.11.19", "activity": "2 ATP + phosphorylase b = 2 ADP + phosphorylase a.", "evidence": [ { "id": "P07934", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07934" } ] }, { "ec_number": "2.7.11.19", "activity": "", "evidence": [ { "id": "P07934", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07934" } ] } ] }, { "uniprot_ac": "P08018", "gene_name": "PBS2", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P08018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08018" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "P08018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08018" } ] } ] }, { "uniprot_ac": "P08181", "gene_name": "CkIIalpha", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P08181", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08181" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P08181", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08181" } ] } ] }, { "uniprot_ac": "P08413", "gene_name": "Camk2b", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P08413", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08413" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "P08413", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08413" } ] } ] }, { "uniprot_ac": "P08414", "gene_name": "Camk4", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P08414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08414" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "P08414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08414" } ] } ] }, { "uniprot_ac": "P08458", "gene_name": "SPS1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P08458", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08458" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P08458", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08458" } ] } ] }, { "uniprot_ac": "P09215", "gene_name": "Prkcd", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P09215", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09215" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P09215", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09215" } ] } ] }, { "uniprot_ac": "P09216", "gene_name": "Prkce", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P09216", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09216" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P09216", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09216" } ] } ] }, { "uniprot_ac": "P09217", "gene_name": "Prkcz", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P09217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09217" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P09217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09217" } ] } ] }, { "uniprot_ac": "P0C0A1", "gene_name": "Vps25", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P0C0A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C0A1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P0C0A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C0A1" } ] } ] }, { "uniprot_ac": "P0C0R5", "gene_name": "Pik3r4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P0C0R5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C0R5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P0C0R5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C0R5" } ] } ] }, { "uniprot_ac": "P0C1X8", "gene_name": "Aak1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P0C1X8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C1X8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P0C1X8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C1X8" } ] } ] }, { "uniprot_ac": "P0C263", "gene_name": "SBK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P0C263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C263" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P0C263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C263" } ] } ] }, { "uniprot_ac": "P0C264", "gene_name": "SBK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P0C264", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C264" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P0C264", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C264" } ] } ] }, { "uniprot_ac": "P0C5K0", "gene_name": "Sbk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P0C5K0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C5K0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P0C5K0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C5K0" } ] } ] }, { "uniprot_ac": "P0C5K1", "gene_name": "Sbk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P0C5K1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C5K1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P0C5K1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C5K1" } ] } ] }, { "uniprot_ac": "P0C605", "gene_name": "Prkg1", "activity": [ { "ec_number": "2.7.11.12", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P0C605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C605" } ] }, { "ec_number": "2.7.11.12", "activity": "", "evidence": [ { "id": "P0C605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C605" } ] } ] }, { "uniprot_ac": "P0C865", "gene_name": "Mapk7", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P0C865", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C865" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P0C865", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C865" } ] } ] }, { "uniprot_ac": "P0C8E4", "gene_name": "Map3k7", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P0C8E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C8E4" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "P0C8E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C8E4" } ] } ] }, { "uniprot_ac": "P0CD62", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P0CD62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CD62" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P0CD62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CD62" } ] } ] }, { "uniprot_ac": "P10398", "gene_name": "ARAF", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P10398", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10398" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P10398", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10398" } ] } ] }, { "uniprot_ac": "P10676", "gene_name": "ninaC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P10676", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10676" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P10676", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10676" } ] }, { "ec_number": "5.6.1.8", "activity": "ATP + H2O + myosin bound to actin filament at position(n) = ADP + phosphate + myosin bound to actin filament at position(n+1).", "evidence": [ { "id": "P10676", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10676" } ] } ] }, { "uniprot_ac": "P11274", "gene_name": "BCR", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P11274", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11274" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P11274", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11274" } ] } ] }, { "uniprot_ac": "P11275", "gene_name": "Camk2a", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P11275", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11275" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "P11275", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11275" } ] } ] }, { "uniprot_ac": "P11309", "gene_name": "PIM1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P11309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11309" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P11309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11309" } ] } ] }, { "uniprot_ac": "P11345", "gene_name": "Raf1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P11345", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11345" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P11345", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11345" } ] } ] }, { "uniprot_ac": "P11346", "gene_name": "Raf", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P11346", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11346" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P11346", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11346" } ] } ] }, { "uniprot_ac": "P11440", "gene_name": "Cdk1", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P11440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11440" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P11440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11440" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P11440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11440" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P11440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11440" } ] } ] }, { "uniprot_ac": "P11730", "gene_name": "Camk2g", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P11730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11730" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "P11730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11730" } ] } ] }, { "uniprot_ac": "P11792", "gene_name": "SCH9", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P11792", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11792" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P11792", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11792" } ] } ] }, { "uniprot_ac": "P11798", "gene_name": "Camk2a", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P11798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11798" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "P11798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11798" } ] } ] }, { "uniprot_ac": "P11801", "gene_name": "PSKH1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P11801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11801" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P11801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11801" } ] } ] }, { "uniprot_ac": "P11802", "gene_name": "CDK4", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P11802", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11802" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P11802", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11802" } ] } ] }, { "uniprot_ac": "P11980", "gene_name": "Pkm", "activity": [ { "ec_number": "2.7.1.40", "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.", "evidence": [ { "id": "P11980", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11980" } ] }, { "ec_number": "2.7.1.40", "activity": "", "evidence": [ { "id": "P11980", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11980" } ] }, { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P11980", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11980" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P11980", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11980" } ] } ] }, { "uniprot_ac": "P12370", "gene_name": "Pka-C1", "activity": [ { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P12370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12370" } ] }, { "ec_number": "2.7.11.11", "activity": "", "evidence": [ { "id": "P12370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12370" } ] } ] }, { "uniprot_ac": "P12688", "gene_name": "YPK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P12688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12688" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P12688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12688" } ] } ] }, { "uniprot_ac": "P13185", "gene_name": "KIN1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P13185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13185" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P13185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13185" } ] } ] }, { "uniprot_ac": "P13186", "gene_name": "KIN2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P13186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13186" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P13186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13186" } ] } ] }, { "uniprot_ac": "P13234", "gene_name": "Camk4", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P13234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13234" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "P13234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13234" } ] } ] }, { "uniprot_ac": "P13286", "gene_name": "Phkg1", "activity": [ { "ec_number": "2.7.11.19", "activity": "2 ATP + phosphorylase b = 2 ADP + phosphorylase a.", "evidence": [ { "id": "P13286", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13286" } ] }, { "ec_number": "2.7.11.19", "activity": "", "evidence": [ { "id": "P13286", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13286" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P13286", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13286" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "P13286", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13286" } ] } ] }, { "uniprot_ac": "P13677", "gene_name": "inaC", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P13677", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13677" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P13677", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13677" } ] } ] }, { "uniprot_ac": "P13678", "gene_name": "Pkc98E", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P13678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13678" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P13678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13678" } ] } ] }, { "uniprot_ac": "P14056", "gene_name": "Araf", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P14056", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14056" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P14056", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14056" } ] } ] }, { "uniprot_ac": "P14618", "gene_name": "PKM", "activity": [ { "ec_number": "2.7.1.40", "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.", "evidence": [ { "id": "P14618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14618" } ] }, { "ec_number": "2.7.1.40", "activity": "", "evidence": [ { "id": "P14618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14618" } ] }, { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P14618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14618" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P14618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14618" } ] } ] }, { "uniprot_ac": "P14680", "gene_name": "YAK1", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P14680", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14680" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "P14680", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14680" } ] } ] }, { "uniprot_ac": "P14681", "gene_name": "KSS1", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P14681", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14681" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P14681", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14681" } ] } ] }, { "uniprot_ac": "P15056", "gene_name": "BRAF", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P15056", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15056" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P15056", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15056" } ] } ] }, { "uniprot_ac": "P15442", "gene_name": "GCN2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P15442", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15442" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P15442", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15442" } ] } ] }, { "uniprot_ac": "P15790", "gene_name": "CKA1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P15790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15790" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P15790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15790" } ] } ] }, { "uniprot_ac": "P15791", "gene_name": "Camk2d", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P15791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15791" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "P15791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15791" } ] } ] }, { "uniprot_ac": "P16054", "gene_name": "Prkce", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P16054", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16054" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P16054", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16054" } ] } ] }, { "uniprot_ac": "P16892", "gene_name": "FUS3", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P16892", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16892" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P16892", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16892" } ] } ] }, { "uniprot_ac": "P16911", "gene_name": "Pka-C2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P16911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16911" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P16911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16911" } ] }, { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P16911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16911" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "P16911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16911" } ] } ] }, { "uniprot_ac": "P16912", "gene_name": "Pka-C3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P16912", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16912" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P16912", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16912" } ] } ] }, { "uniprot_ac": "P17157", "gene_name": "PHO85", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P17157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17157" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P17157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17157" } ] } ] }, { "uniprot_ac": "P17252", "gene_name": "PRKCA", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P17252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17252" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P17252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17252" } ] } ] }, { "uniprot_ac": "P17612", "gene_name": "PRKACA", "activity": [ { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P17612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17612" } ] }, { "ec_number": "2.7.11.11", "activity": "", "evidence": [ { "id": "P17612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17612" } ] } ] }, { "uniprot_ac": "P18265", "gene_name": "Gsk3a", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P18265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18265" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "P18265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18265" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "P18265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18265" } ] } ] }, { "uniprot_ac": "P18266", "gene_name": "Gsk3b", "activity": [ { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "P18266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18266" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "P18266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18266" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P18266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18266" } ] } ] }, { "uniprot_ac": "P18431", "gene_name": "sgg", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P18431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18431" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P18431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18431" } ] } ] }, { "uniprot_ac": "P18653", "gene_name": "Rps6ka1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P18653", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18653" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P18653", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18653" } ] } ] }, { "uniprot_ac": "P18654", "gene_name": "Rps6ka3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P18654", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18654" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P18654", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18654" } ] } ] }, { "uniprot_ac": "P18961", "gene_name": "YPK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P18961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18961" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P18961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18961" } ] } ] }, { "uniprot_ac": "P19139", "gene_name": "Csnk2a1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P19139", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19139" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P19139", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19139" } ] } ] }, { "uniprot_ac": "P19454", "gene_name": "CKA2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P19454", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19454" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P19454", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19454" } ] } ] }, { "uniprot_ac": "P19525", "gene_name": "EIF2AK2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P19525", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19525" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P19525", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19525" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P19525", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19525" } ] } ] }, { "uniprot_ac": "P19784", "gene_name": "CSNK2A2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P19784", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19784" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P19784", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19784" } ] } ] }, { "uniprot_ac": "P20444", "gene_name": "Prkca", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P20444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20444" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P20444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20444" } ] } ] }, { "uniprot_ac": "P20793", "gene_name": "Mak", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P20793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20793" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P20793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20793" } ] } ] }, { "uniprot_ac": "P20794", "gene_name": "MAK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P20794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20794" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P20794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20794" } ] } ] }, { "uniprot_ac": "P21127", "gene_name": "CDK11B", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P21127", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21127" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P21127", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21127" } ] } ] }, { "uniprot_ac": "P21675", "gene_name": "TAF1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P21675", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21675" } ] }, { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "P21675", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21675" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P21675", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21675" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "P21675", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21675" } ] } ] }, { "uniprot_ac": "P21708", "gene_name": "Mapk3", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P21708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21708" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P21708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21708" } ] } ] }, { "uniprot_ac": "P21965", "gene_name": "MCK1", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P21965", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21965" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "P21965", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21965" } ] } ] }, { "uniprot_ac": "P22204", "gene_name": "DBF2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P22204", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22204" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P22204", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22204" } ] } ] }, { "uniprot_ac": "P22209", "gene_name": "KIN3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P22209", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22209" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P22209", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22209" } ] } ] }, { "uniprot_ac": "P22211", "gene_name": "NPR1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P22211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22211" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P22211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22211" } ] } ] }, { "uniprot_ac": "P22216", "gene_name": "RAD53", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P22216", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22216" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "P22216", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22216" } ] } ] }, { "uniprot_ac": "P22219", "gene_name": "VPS15", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P22219", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22219" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P22219", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22219" } ] } ] }, { "uniprot_ac": "P22517", "gene_name": "CMK2", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P22517", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22517" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "P22517", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22517" } ] } ] }, { "uniprot_ac": "P22518", "gene_name": "Clk1", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P22518", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22518" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "P22518", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22518" } ] } ] }, { "uniprot_ac": "P22612", "gene_name": "PRKACG", "activity": [ { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P22612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22612" } ] }, { "ec_number": "2.7.11.11", "activity": "", "evidence": [ { "id": "P22612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22612" } ] } ] }, { "uniprot_ac": "P22694", "gene_name": "PRKACB", "activity": [ { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P22694", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22694" } ] }, { "ec_number": "2.7.11.11", "activity": "", "evidence": [ { "id": "P22694", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22694" } ] } ] }, { "uniprot_ac": "P23291", "gene_name": "YCK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P23291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23291" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P23291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23291" } ] } ] }, { "uniprot_ac": "P23292", "gene_name": "YCK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P23292", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23292" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P23292", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23292" } ] } ] }, { "uniprot_ac": "P23293", "gene_name": "SGV1", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P23293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23293" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P23293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23293" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P23293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23293" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P23293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23293" } ] } ] }, { "uniprot_ac": "P23298", "gene_name": "Prkch", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P23298", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23298" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P23298", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23298" } ] } ] }, { "uniprot_ac": "P23443", "gene_name": "RPS6KB1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P23443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23443" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P23443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23443" } ] } ] }, { "uniprot_ac": "P23561", "gene_name": "STE11", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P23561", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23561" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "P23561", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23561" } ] } ] }, { "uniprot_ac": "P23572", "gene_name": "Cdk1", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P23572", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23572" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P23572", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23572" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P23572", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23572" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P23572", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23572" } ] } ] }, { "uniprot_ac": "P23573", "gene_name": "Cdk2", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P23573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23573" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P23573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23573" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P23573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23573" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P23573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23573" } ] } ] }, { "uniprot_ac": "P23647", "gene_name": "fu", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P23647", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23647" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P23647", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23647" } ] } ] }, { "uniprot_ac": "P24583", "gene_name": "PKC1", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P24583", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24583" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P24583", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24583" } ] } ] }, { "uniprot_ac": "P24719", "gene_name": "MEK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P24719", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24719" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P24719", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24719" } ] } ] }, { "uniprot_ac": "P24723", "gene_name": "PRKCH", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P24723", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24723" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P24723", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24723" } ] } ] }, { "uniprot_ac": "P24788", "gene_name": "Cdk11b", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P24788", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24788" } ] } ] }, { "uniprot_ac": "P24941", "gene_name": "CDK2", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P24941", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24941" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P24941", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24941" } ] } ] }, { "uniprot_ac": "P25333", "gene_name": "SAT4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P25333", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25333" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P25333", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25333" } ] } ] }, { "uniprot_ac": "P25341", "gene_name": "KIN82", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P25341", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25341" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P25341", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25341" } ] } ] }, { "uniprot_ac": "P25389", "gene_name": "KCC4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P25389", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25389" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P25389", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25389" } ] } ] }, { "uniprot_ac": "P25390", "gene_name": "SSK22", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P25390", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25390" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P25390", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25390" } ] } ] }, { "uniprot_ac": "P26794", "gene_name": "Pim1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P26794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26794" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P26794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26794" } ] } ] }, { "uniprot_ac": "P27361", "gene_name": "MAPK3", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P27361", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27361" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P27361", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27361" } ] } ] }, { "uniprot_ac": "P27448", "gene_name": "MARK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P27448", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27448" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P27448", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27448" } ] } ] }, { "uniprot_ac": "P27466", "gene_name": "CMK1", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P27466", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27466" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "P27466", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27466" } ] } ] }, { "uniprot_ac": "P27636", "gene_name": "CDC15", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P27636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27636" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P27636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27636" } ] } ] }, { "uniprot_ac": "P27704", "gene_name": "Mapk6", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P27704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27704" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P27704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27704" } ] } ] }, { "uniprot_ac": "P27791", "gene_name": "Prkaca", "activity": [ { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P27791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27791" } ] }, { "ec_number": "2.7.11.11", "activity": "", "evidence": [ { "id": "P27791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27791" } ] } ] }, { "uniprot_ac": "P28028", "gene_name": "Braf", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P28028", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28028" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P28028", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28028" } ] } ] }, { "uniprot_ac": "P28063", "gene_name": "Psmb8", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "P28063", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28063" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "P28063", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28063" } ] } ] }, { "uniprot_ac": "P28076", "gene_name": "Psmb9", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "P28076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28076" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "P28076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28076" } ] } ] }, { "uniprot_ac": "P28178", "gene_name": "pkgB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P28178", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28178" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P28178", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28178" } ] } ] }, { "uniprot_ac": "P28482", "gene_name": "MAPK1", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P28482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28482" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P28482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28482" } ] } ] }, { "uniprot_ac": "P28652", "gene_name": "Camk2b", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P28652", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28652" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "P28652", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28652" } ] } ] }, { "uniprot_ac": "P28708", "gene_name": "PRR1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P28708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28708" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P28708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28708" } ] } ] }, { "uniprot_ac": "P28867", "gene_name": "Prkcd", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P28867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28867" } ] }, { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P28867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28867" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P28867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28867" } ] } ] }, { "uniprot_ac": "P29295", "gene_name": "HRR25", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P29295", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29295" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P29295", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29295" } ] } ] }, { "uniprot_ac": "P30285", "gene_name": "Cdk4", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P30285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30285" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P30285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30285" } ] } ] }, { "uniprot_ac": "P31152", "gene_name": "MAPK4", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P31152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31152" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P31152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31152" } ] } ] }, { "uniprot_ac": "P31374", "gene_name": "PSK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P31374", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31374" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P31374", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31374" } ] } ] }, { "uniprot_ac": "P31749", "gene_name": "AKT1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P31749", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31749" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P31749", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31749" } ] } ] }, { "uniprot_ac": "P31750", "gene_name": "Akt1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P31750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31750" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P31750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31750" } ] } ] }, { "uniprot_ac": "P31751", "gene_name": "AKT2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P31751", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31751" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P31751", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31751" } ] } ] }, { "uniprot_ac": "P31938", "gene_name": "Map2k1", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P31938", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31938" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "P31938", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31938" } ] } ] }, { "uniprot_ac": "P32328", "gene_name": "DBF20", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P32328", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32328" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P32328", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32328" } ] } ] }, { "uniprot_ac": "P32350", "gene_name": "KNS1", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P32350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32350" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "P32350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32350" } ] } ] }, { "uniprot_ac": "P32361", "gene_name": "IRE1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P32361", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32361" } ] }, { "ec_number": "3.1.26.-", "activity": "", "evidence": [ { "id": "P32361", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32361" } ] } ] }, { "uniprot_ac": "P32485", "gene_name": "HOG1", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P32485", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32485" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P32485", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32485" } ] } ] }, { "uniprot_ac": "P32490", "gene_name": "MKK1", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P32490", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32490" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "P32490", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32490" } ] } ] }, { "uniprot_ac": "P32491", "gene_name": "MKK2", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P32491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32491" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "P32491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32491" } ] } ] }, { "uniprot_ac": "P32562", "gene_name": "CDC5", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P32562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32562" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "P32562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32562" } ] } ] }, { "uniprot_ac": "P32581", "gene_name": "IME2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P32581", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32581" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P32581", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32581" } ] } ] }, { "uniprot_ac": "P32600", "gene_name": "TOR2", "activity": [ { "ec_number": "2.7.1.67", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ADP + H(+).", "evidence": [ { "id": "P32600", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32600" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P32600", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32600" } ] }, { "ec_number": "2.7.1.67", "activity": "", "evidence": [ { "id": "P32600", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32600" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P32600", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32600" } ] } ] }, { "uniprot_ac": "P32789", "gene_name": "ALK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P32789", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32789" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P32789", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32789" } ] } ] }, { "uniprot_ac": "P32801", "gene_name": "ELM1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P32801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32801" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P32801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32801" } ] } ] }, { "uniprot_ac": "P32944", "gene_name": "SWE1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P32944", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32944" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P32944", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32944" } ] } ] }, { "uniprot_ac": "P33076", "gene_name": "CIITA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P33076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33076" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "P33076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33076" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P33076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33076" } ] } ] }, { "uniprot_ac": "P33981", "gene_name": "TTK", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P33981", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33981" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "P33981", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33981" } ] } ] }, { "uniprot_ac": "P34099", "gene_name": "pkaC", "activity": [ { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P34099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34099" } ] }, { "ec_number": "2.7.11.11", "activity": "", "evidence": [ { "id": "P34099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34099" } ] } ] }, { "uniprot_ac": "P34100", "gene_name": "pkaD", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P34100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34100" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P34100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34100" } ] } ] }, { "uniprot_ac": "P34101", "gene_name": "fhkC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P34101", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34101" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P34101", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34101" } ] } ] }, { "uniprot_ac": "P34102", "gene_name": "pkgC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P34102", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34102" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P34102", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34102" } ] } ] }, { "uniprot_ac": "P34103", "gene_name": "pkgD", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P34103", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34103" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P34103", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34103" } ] } ] }, { "uniprot_ac": "P34112", "gene_name": "cdk1", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P34112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34112" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P34112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34112" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P34112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34112" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P34112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34112" } ] } ] }, { "uniprot_ac": "P34117", "gene_name": "cdk5", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P34117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34117" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P34117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34117" } ] } ] }, { "uniprot_ac": "P34244", "gene_name": "HSL1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P34244", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34244" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P34244", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34244" } ] } ] }, { "uniprot_ac": "P35169", "gene_name": "TOR1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P35169", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35169" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P35169", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35169" } ] } ] }, { "uniprot_ac": "P35426", "gene_name": "Cdk4", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P35426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35426" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P35426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35426" } ] } ] }, { "uniprot_ac": "P35465", "gene_name": "Pak1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P35465", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35465" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P35465", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35465" } ] } ] }, { "uniprot_ac": "P35761", "gene_name": "Ttk", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P35761", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35761" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "P35761", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35761" } ] } ] }, { "uniprot_ac": "P36002", "gene_name": "PTK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P36002", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36002" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P36002", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36002" } ] } ] }, { "uniprot_ac": "P36003", "gene_name": "NNK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P36003", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36003" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P36003", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36003" } ] } ] }, { "uniprot_ac": "P36004", "gene_name": "KKQ8", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P36004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36004" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P36004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36004" } ] } ] }, { "uniprot_ac": "P36005", "gene_name": "KDX1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P36005", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36005" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P36005", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36005" } ] } ] }, { "uniprot_ac": "P36506", "gene_name": "Map2k2", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P36506", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36506" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "P36506", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36506" } ] } ] }, { "uniprot_ac": "P36507", "gene_name": "MAP2K2", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P36507", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36507" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "P36507", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36507" } ] } ] }, { "uniprot_ac": "P38070", "gene_name": "YPK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P38070", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38070" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P38070", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38070" } ] } ] }, { "uniprot_ac": "P38080", "gene_name": "AKL1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P38080", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38080" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P38080", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38080" } ] } ] }, { "uniprot_ac": "P38110", "gene_name": "TEL1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P38110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38110" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P38110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38110" } ] } ] }, { "uniprot_ac": "P38111", "gene_name": "MEC1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P38111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38111" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P38111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38111" } ] } ] }, { "uniprot_ac": "P38147", "gene_name": "CHK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P38147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38147" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P38147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38147" } ] } ] }, { "uniprot_ac": "P38615", "gene_name": "RIM11", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P38615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38615" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P38615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38615" } ] } ] }, { "uniprot_ac": "P38622", "gene_name": "RCK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P38622", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38622" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P38622", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38622" } ] } ] }, { "uniprot_ac": "P38623", "gene_name": "RCK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P38623", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38623" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P38623", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38623" } ] } ] }, { "uniprot_ac": "P38691", "gene_name": "KSP1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P38691", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38691" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P38691", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38691" } ] } ] }, { "uniprot_ac": "P38692", "gene_name": "KIC1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P38692", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38692" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P38692", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38692" } ] } ] }, { "uniprot_ac": "P38970", "gene_name": "HAL5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P38970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38970" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P38970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38970" } ] } ] }, { "uniprot_ac": "P38990", "gene_name": "SAK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P38990", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38990" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P38990", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38990" } ] } ] }, { "uniprot_ac": "P38991", "gene_name": "IPL1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P38991", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38991" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P38991", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38991" } ] } ] }, { "uniprot_ac": "P39009", "gene_name": "DUN1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P39009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39009" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P39009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39009" } ] } ] }, { "uniprot_ac": "P39073", "gene_name": "SSN3", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P39073", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39073" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P39073", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39073" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P39073", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39073" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P39073", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39073" } ] } ] }, { "uniprot_ac": "P39688", "gene_name": "Fyn", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P39688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39688" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "P39688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39688" } ] } ] }, { "uniprot_ac": "P39951", "gene_name": "Cdk1", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P39951", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39951" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P39951", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39951" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P39951", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39951" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P39951", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39951" } ] } ] }, { "uniprot_ac": "P39962", "gene_name": "YCK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P39962", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39962" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P39962", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39962" } ] } ] }, { "uniprot_ac": "P40160", "gene_name": "RIO2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P40160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40160" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P40160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40160" } ] } ] }, { "uniprot_ac": "P40417", "gene_name": "rl", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P40417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40417" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P40417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40417" } ] } ] }, { "uniprot_ac": "P40494", "gene_name": "PRK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P40494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40494" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P40494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40494" } ] } ] }, { "uniprot_ac": "P41279", "gene_name": "MAP3K8", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P41279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41279" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "P41279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41279" } ] } ] }, { "uniprot_ac": "P41695", "gene_name": "BUB1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P41695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41695" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P41695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41695" } ] } ] }, { "uniprot_ac": "P41743", "gene_name": "PRKCI", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P41743", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41743" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P41743", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41743" } ] } ] }, { "uniprot_ac": "P41808", "gene_name": "SMK1", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P41808", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41808" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P41808", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41808" } ] } ] }, { "uniprot_ac": "P42336", "gene_name": "PIK3CA", "activity": [ { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "P42336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42336" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "P42336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42336" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P42336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42336" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P42336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42336" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P42336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42336" } ] } ] }, { "uniprot_ac": "P42337", "gene_name": "Pik3ca", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] } ] }, { "uniprot_ac": "P42338", "gene_name": "PIK3CB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P42338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42338" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "P42338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42338" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "P42338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42338" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P42338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42338" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P42338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42338" } ] } ] }, { "uniprot_ac": "P42345", "gene_name": "MTOR", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P42345", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42345" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P42345", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42345" } ] } ] }, { "uniprot_ac": "P42346", "gene_name": "Mtor", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P42346", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42346" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P42346", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42346" } ] } ] }, { "uniprot_ac": "P42525", "gene_name": "erkA", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P42525", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42525" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P42525", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42525" } ] } ] }, { "uniprot_ac": "P43565", "gene_name": "RIM15", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P43565", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43565" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P43565", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43565" } ] } ] }, { "uniprot_ac": "P43568", "gene_name": "CAK1", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P43568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43568" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P43568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43568" } ] } ] }, { "uniprot_ac": "P43633", "gene_name": "ALK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P43633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43633" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P43633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43633" } ] } ] }, { "uniprot_ac": "P43637", "gene_name": "TOS3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P43637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43637" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P43637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43637" } ] } ] }, { "uniprot_ac": "P45983", "gene_name": "MAPK8", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P45983", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45983" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P45983", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45983" } ] } ] }, { "uniprot_ac": "P45984", "gene_name": "MAPK9", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P45984", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45984" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P45984", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45984" } ] } ] }, { "uniprot_ac": "P45985", "gene_name": "MAP2K4", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P45985", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45985" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "P45985", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45985" } ] } ] }, { "uniprot_ac": "P46734", "gene_name": "MAP2K3", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P46734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46734" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "P46734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46734" } ] } ] }, { "uniprot_ac": "P46892", "gene_name": "Cdk11b", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P46892", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46892" } ] } ] }, { "uniprot_ac": "P47042", "gene_name": "IKS1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P47042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47042" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P47042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47042" } ] } ] }, { "uniprot_ac": "P47116", "gene_name": "PTK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P47116", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47116" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P47116", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47116" } ] } ] }, { "uniprot_ac": "P47196", "gene_name": "Akt1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P47196", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47196" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P47196", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47196" } ] } ] }, { "uniprot_ac": "P47197", "gene_name": "Akt2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P47197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47197" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P47197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47197" } ] } ] }, { "uniprot_ac": "P47809", "gene_name": "Map2k4", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P47809", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47809" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "P47809", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47809" } ] } ] }, { "uniprot_ac": "P47811", "gene_name": "Mapk14", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P47811", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47811" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P47811", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47811" } ] } ] }, { "uniprot_ac": "P48562", "gene_name": "CLA4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P48562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48562" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P48562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48562" } ] } ] }, { "uniprot_ac": "P48609", "gene_name": "Cdk5", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P48609", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48609" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P48609", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48609" } ] } ] }, { "uniprot_ac": "P48729", "gene_name": "CSNK1A1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P48729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48729" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P48729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48729" } ] } ] }, { "uniprot_ac": "P48730", "gene_name": "CSNK1D", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P48730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48730" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "P48730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48730" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P48730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48730" } ] } ] }, { "uniprot_ac": "P48736", "gene_name": "PIK3CG", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] }, { "ec_number": "2.7.1.154", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] }, { "ec_number": "2.7.1.154", "activity": "", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] } ] }, { "uniprot_ac": "P49025", "gene_name": "Cit", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49025", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49025" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P49025", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49025" } ] } ] }, { "uniprot_ac": "P49071", "gene_name": "MAPk-Ak2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49071" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P49071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49071" } ] } ] }, { "uniprot_ac": "P49137", "gene_name": "MAPKAPK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49137" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P49137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49137" } ] } ] }, { "uniprot_ac": "P49138", "gene_name": "Mapkapk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49138", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49138" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P49138", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49138" } ] } ] }, { "uniprot_ac": "P49185", "gene_name": "Mapk8", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49185" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P49185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49185" } ] } ] }, { "uniprot_ac": "P49186", "gene_name": "Mapk9", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49186" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P49186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49186" } ] } ] }, { "uniprot_ac": "P49187", "gene_name": "Mapk10", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49187", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49187" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P49187", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49187" } ] } ] }, { "uniprot_ac": "P49336", "gene_name": "CDK8", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49336" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P49336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49336" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P49336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49336" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P49336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49336" } ] } ] }, { "uniprot_ac": "P49615", "gene_name": "Cdk5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49615" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P49615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49615" } ] } ] }, { "uniprot_ac": "P49657", "gene_name": "mnb", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49657", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49657" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "P49657", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49657" } ] } ] }, { "uniprot_ac": "P49674", "gene_name": "CSNK1E", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49674", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49674" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P49674", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49674" } ] } ] }, { "uniprot_ac": "P49759", "gene_name": "CLK1", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49759", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49759" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "P49759", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49759" } ] } ] }, { "uniprot_ac": "P49760", "gene_name": "CLK2", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49760" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "P49760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49760" } ] } ] }, { "uniprot_ac": "P49761", "gene_name": "CLK3", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49761", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49761" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "P49761", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49761" } ] } ] }, { "uniprot_ac": "P49762", "gene_name": "Doa", "activity": [ { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "P49762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49762" } ] }, { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49762" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "P49762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49762" } ] } ] }, { "uniprot_ac": "P49840", "gene_name": "GSK3A", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49840", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49840" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "P49840", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49840" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "P49840", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49840" } ] } ] }, { "uniprot_ac": "P49841", "gene_name": "GSK3B", "activity": [ { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "P49841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49841" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "P49841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49841" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P49841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49841" } ] } ] }, { "uniprot_ac": "P50613", "gene_name": "CDK7", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P50613", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50613" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P50613", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50613" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P50613", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50613" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P50613", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50613" } ] } ] }, { "uniprot_ac": "P50750", "gene_name": "CDK9", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P50750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50750" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P50750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50750" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P50750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50750" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P50750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50750" } ] } ] }, { "uniprot_ac": "P50873", "gene_name": "MRK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P50873", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50873" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P50873", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50873" } ] } ] }, { "uniprot_ac": "P51123", "gene_name": "Taf1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P51123", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51123" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P51123", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51123" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "P51123", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51123" } ] }, { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "P51123", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51123" } ] }, { "ec_number": "6.2.1.45", "activity": "ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.", "evidence": [ { "id": "P51123", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51123" } ] } ] }, { "uniprot_ac": "P51136", "gene_name": "gskA", "activity": [ { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "P51136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51136" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "P51136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51136" } ] } ] }, { "uniprot_ac": "P51617", "gene_name": "IRAK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P51617", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51617" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P51617", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51617" } ] } ] }, { "uniprot_ac": "P51812", "gene_name": "RPS6KA3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P51812", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51812" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P51812", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51812" } ] } ] }, { "uniprot_ac": "P51817", "gene_name": "PRKX", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P51817", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51817" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P51817", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51817" } ] } ] }, { "uniprot_ac": "P51952", "gene_name": "Cdk7", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P51952", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51952" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P51952", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51952" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P51952", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51952" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P51952", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51952" } ] } ] }, { "uniprot_ac": "P51954", "gene_name": "Nek1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P51954", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51954" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P51954", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51954" } ] } ] }, { "uniprot_ac": "P51955", "gene_name": "NEK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P51955", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51955" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P51955", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51955" } ] } ] }, { "uniprot_ac": "P51956", "gene_name": "NEK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P51956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51956" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P51956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51956" } ] } ] }, { "uniprot_ac": "P51957", "gene_name": "NEK4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P51957", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51957" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P51957", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51957" } ] } ] }, { "uniprot_ac": "P52304", "gene_name": "polo", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P52304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52304" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "P52304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52304" } ] } ] }, { "uniprot_ac": "P52480", "gene_name": "Pkm", "activity": [ { "ec_number": "2.7.1.40", "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.", "evidence": [ { "id": "P52480", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52480" } ] }, { "ec_number": "2.7.1.40", "activity": "", "evidence": [ { "id": "P52480", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52480" } ] }, { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P52480", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52480" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P52480", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52480" } ] } ] }, { "uniprot_ac": "P52564", "gene_name": "MAP2K6", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P52564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52564" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "P52564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52564" } ] } ] }, { "uniprot_ac": "P53104", "gene_name": "ATG1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53104" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P53104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53104" } ] } ] }, { "uniprot_ac": "P53233", "gene_name": "FMP48", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53233" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P53233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53233" } ] } ] }, { "uniprot_ac": "P53323", "gene_name": "BUD32", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53323", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53323" } ] }, { "ec_number": "3.6.-.-", "activity": "", "evidence": [ { "id": "P53323", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53323" } ] } ] }, { "uniprot_ac": "P53349", "gene_name": "Map3k1", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53349" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "P53349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53349" } ] } ] }, { "uniprot_ac": "P53350", "gene_name": "PLK1", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53350" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "P53350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53350" } ] } ] }, { "uniprot_ac": "P53351", "gene_name": "Plk2", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53351", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53351" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "P53351", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53351" } ] } ] }, { "uniprot_ac": "P53355", "gene_name": "DAPK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53355", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53355" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P53355", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53355" } ] } ] }, { "uniprot_ac": "P53599", "gene_name": "SSK2", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53599", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53599" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "P53599", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53599" } ] } ] }, { "uniprot_ac": "P53667", "gene_name": "LIMK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53667", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53667" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P53667", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53667" } ] } ] }, { "uniprot_ac": "P53668", "gene_name": "Limk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53668", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53668" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P53668", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53668" } ] } ] }, { "uniprot_ac": "P53669", "gene_name": "Limk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53669" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P53669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53669" } ] } ] }, { "uniprot_ac": "P53670", "gene_name": "Limk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53670" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P53670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53670" } ] } ] }, { "uniprot_ac": "P53671", "gene_name": "LIMK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53671", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53671" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P53671", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53671" } ] } ] }, { "uniprot_ac": "P53739", "gene_name": "FPK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53739", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53739" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P53739", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53739" } ] } ] }, { "uniprot_ac": "P53778", "gene_name": "MAPK12", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53778", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53778" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P53778", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53778" } ] } ] }, { "uniprot_ac": "P53779", "gene_name": "MAPK10", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53779", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53779" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P53779", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53779" } ] } ] }, { "uniprot_ac": "P53894", "gene_name": "CBK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53894", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53894" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P53894", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53894" } ] } ] }, { "uniprot_ac": "P53974", "gene_name": "ARK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P53974", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53974" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P53974", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53974" } ] } ] }, { "uniprot_ac": "P54199", "gene_name": "MPS1", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P54199", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54199" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "P54199", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54199" } ] } ] }, { "uniprot_ac": "P54265", "gene_name": "Dmpk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P54265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54265" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P54265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54265" } ] } ] }, { "uniprot_ac": "P54360", "gene_name": "fj", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P54360", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54360" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P54360", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54360" } ] } ] }, { "uniprot_ac": "P54367", "gene_name": "CkIalpha", "activity": [ { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "P54367", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54367" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P54367", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54367" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P54367", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54367" } ] } ] }, { "uniprot_ac": "P54644", "gene_name": "pkbA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P54644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54644" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P54644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54644" } ] } ] }, { "uniprot_ac": "P54645", "gene_name": "Prkaa1", "activity": [ { "ec_number": "2.7.11.27", "activity": "ATP + L-seryl-[acetyl-CoA carboxylase] = ADP + H(+) + O-phospho-L-seryl-[acetyl-CoA carboxylase].", "evidence": [ { "id": "P54645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54645" } ] }, { "ec_number": "2.7.11.31", "activity": "ATP + L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase] = ADP + H(+) + O-phospho-L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase].", "evidence": [ { "id": "P54645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54645" } ] }, { "ec_number": "2.7.11.31", "activity": "", "evidence": [ { "id": "P54645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54645" } ] }, { "ec_number": "2.7.11.27", "activity": "", "evidence": [ { "id": "P54645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54645" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P54645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54645" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "P54645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54645" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P54645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54645" } ] } ] }, { "uniprot_ac": "P54646", "gene_name": "PRKAA2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P54646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54646" } ] }, { "ec_number": "2.7.11.27", "activity": "ATP + L-seryl-[acetyl-CoA carboxylase] = ADP + H(+) + O-phospho-L-seryl-[acetyl-CoA carboxylase].", "evidence": [ { "id": "P54646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54646" } ] }, { "ec_number": "2.7.11.31", "activity": "ATP + L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase] = ADP + H(+) + O-phospho-L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase].", "evidence": [ { "id": "P54646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54646" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P54646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54646" } ] } ] }, { "uniprot_ac": "P54685", "gene_name": "cdk7", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P54685", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54685" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "P54685", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54685" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "P54685", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54685" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P54685", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54685" } ] } ] }, { "uniprot_ac": "P57058", "gene_name": "HUNK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P57058", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57058" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P57058", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57058" } ] } ] }, { "uniprot_ac": "P57059", "gene_name": "SIK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P57059", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57059" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P57059", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57059" } ] } ] }, { "uniprot_ac": "P57078", "gene_name": "RIPK4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P57078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57078" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P57078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57078" } ] } ] }, { "uniprot_ac": "P57760", "gene_name": "Stk16", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P57760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57760" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P57760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57760" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P57760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57760" } ] } ] }, { "uniprot_ac": "P58750", "gene_name": "Pim3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P58750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58750" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P58750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58750" } ] } ] }, { "uniprot_ac": "P58801", "gene_name": "Ripk2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P58801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58801" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P58801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58801" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P58801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58801" } ] } ] }, { "uniprot_ac": "P59241", "gene_name": "Aurka", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P59241", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59241" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P59241", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59241" } ] } ] }, { "uniprot_ac": "P59895", "gene_name": "Nek6", "activity": [ { "ec_number": "2.7.11.34", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P59895", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59895" } ] }, { "ec_number": "2.7.11.34", "activity": "", "evidence": [ { "id": "P59895", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59895" } ] } ] }, { "uniprot_ac": "P62715", "gene_name": "Ppp2cb", "activity": [ { "ec_number": "3.1.3.16", "activity": "H2O + O-phospho-L-threonyl-[protein] = L-threonyl-[protein] + phosphate.", "evidence": [ { "id": "P62715", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62715" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "P62715", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62715" } ] } ] }, { "uniprot_ac": "P62878", "gene_name": "Rbx1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62878" } ] }, { "ec_number": "2.3.2.32", "activity": "S-[NEDD8-protein]-yl-[E2 NEDD8-conjugating enzyme]-L-cysteine + [cullin]-L-lysine = [E2 NEDD8-conjugating enzyme]-L-cysteine + N(6)-[NEDD8-protein]-yl-[cullin]-L-lysine.", "evidence": [ { "id": "P62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62878" } ] }, { "ec_number": "2.3.2.32", "activity": "", "evidence": [ { "id": "P62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62878" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62878" } ] } ] }, { "uniprot_ac": "P63085", "gene_name": "Mapk1", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P63085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63085" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P63085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63085" } ] } ] }, { "uniprot_ac": "P63086", "gene_name": "Mapk1", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P63086", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63086" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P63086", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63086" } ] } ] }, { "uniprot_ac": "P63260", "gene_name": "Actg1", "activity": [ { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P63260", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63260" } ] } ] }, { "uniprot_ac": "P63318", "gene_name": "Prkcg", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P63318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63318" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P63318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63318" } ] } ] }, { "uniprot_ac": "P63319", "gene_name": "Prkcg", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P63319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63319" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P63319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63319" } ] } ] }, { "uniprot_ac": "P63330", "gene_name": "Ppp2ca", "activity": [ { "ec_number": "3.1.3.16", "activity": "H2O + O-phospho-L-threonyl-[protein] = L-threonyl-[protein] + phosphate.", "evidence": [ { "id": "P63330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63330" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "P63330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63330" } ] } ] }, { "uniprot_ac": "P67999", "gene_name": "Rps6kb1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P67999", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P67999" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P67999", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P67999" } ] } ] }, { "uniprot_ac": "P68181", "gene_name": "Prkacb", "activity": [ { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P68181", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68181" } ] }, { "ec_number": "2.7.11.11", "activity": "", "evidence": [ { "id": "P68181", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68181" } ] } ] }, { "uniprot_ac": "P68182", "gene_name": "Prkacb", "activity": [ { "ec_number": "2.7.11.11", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P68182", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68182" } ] }, { "ec_number": "2.7.11.11", "activity": "", "evidence": [ { "id": "P68182", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68182" } ] } ] }, { "uniprot_ac": "P68400", "gene_name": "CSNK2A1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P68400", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68400" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P68400", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68400" } ] } ] }, { "uniprot_ac": "P68403", "gene_name": "Prkcb", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P68403", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68403" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P68403", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68403" } ] } ] }, { "uniprot_ac": "P68404", "gene_name": "Prkcb", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P68404", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68404" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P68404", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68404" } ] } ] }, { "uniprot_ac": "P70195", "gene_name": "Psmb7", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "P70195", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70195" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "P70195", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70195" } ] } ] }, { "uniprot_ac": "P70218", "gene_name": "Map4k1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70218" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P70218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70218" } ] } ] }, { "uniprot_ac": "P70236", "gene_name": "Map2k6", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70236" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "P70236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70236" } ] } ] }, { "uniprot_ac": "P70268", "gene_name": "Pkn1", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70268" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P70268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70268" } ] } ] }, { "uniprot_ac": "P70335", "gene_name": "Rock1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70335", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70335" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P70335", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70335" } ] } ] }, { "uniprot_ac": "P70336", "gene_name": "Rock2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70336" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P70336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70336" } ] } ] }, { "uniprot_ac": "P70618", "gene_name": "Mapk14", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70618" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P70618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70618" } ] } ] }, { "uniprot_ac": "P70700", "gene_name": "Polr1b", "activity": [ { "ec_number": "2.7.7.6", "activity": "a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1).", "evidence": [ { "id": "P70700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70700" } ] }, { "ec_number": "2.7.7.6", "activity": "", "evidence": [ { "id": "P70700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70700" } ] } ] }, { "uniprot_ac": "P78362", "gene_name": "SRPK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P78362", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78362" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P78362", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78362" } ] } ] }, { "uniprot_ac": "P78368", "gene_name": "CSNK1G2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P78368", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78368" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P78368", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78368" } ] } ] }, { "uniprot_ac": "P78527", "gene_name": "PRKDC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P78527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78527" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P78527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78527" } ] } ] }, { "uniprot_ac": "P79621", "gene_name": "Ciita", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P79621", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P79621" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "P79621", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P79621" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P79621", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P79621" } ] } ] }, { "uniprot_ac": "P80192", "gene_name": "MAP3K9", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P80192", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80192" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "P80192", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80192" } ] } ] }, { "uniprot_ac": "P83098", "gene_name": "Stlk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P83098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83098" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P83098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83098" } ] } ] }, { "uniprot_ac": "P83099", "gene_name": "Pkcdelta", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P83099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83099" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P83099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83099" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "P83099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83099" } ] } ] }, { "uniprot_ac": "P83100", "gene_name": "p38c", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P83100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83100" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P83100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83100" } ] } ] }, { "uniprot_ac": "P83101", "gene_name": "gskt", "activity": [ { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "P83101", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83101" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "P83101", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83101" } ] } ] }, { "uniprot_ac": "P83102", "gene_name": "Dyrk3", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P83102", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83102" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "P83102", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83102" } ] } ] }, { "uniprot_ac": "P83103", "gene_name": "Haspin", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P83103", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83103" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P83103", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83103" } ] } ] }, { "uniprot_ac": "P83104", "gene_name": "Takl1", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P83104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83104" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "P83104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83104" } ] } ] }, { "uniprot_ac": "P83510", "gene_name": "Tnik", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P83510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83510" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P83510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83510" } ] } ] }, { "uniprot_ac": "P83741", "gene_name": "Wnk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P83741", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83741" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P83741", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83741" } ] } ] }, { "uniprot_ac": "P92208", "gene_name": "bsk", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P92208", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P92208" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P92208", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P92208" } ] } ] }, { "uniprot_ac": "P97313", "gene_name": "Prkdc", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P97313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97313" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P97313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97313" } ] } ] }, { "uniprot_ac": "P97343", "gene_name": "Uhmk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P97343", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97343" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P97343", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97343" } ] } ] }, { "uniprot_ac": "P97377", "gene_name": "Cdk2", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P97377", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97377" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "P97377", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97377" } ] } ] }, { "uniprot_ac": "P97477", "gene_name": "Aurka", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P97477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97477" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P97477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97477" } ] } ] }, { "uniprot_ac": "P97633", "gene_name": "Csnk1a1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P97633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97633" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P97633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97633" } ] } ] }, { "uniprot_ac": "P97756", "gene_name": "Camkk1", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P97756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97756" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "P97756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97756" } ] } ] }, { "uniprot_ac": "P97820", "gene_name": "Map4k4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P97820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97820" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P97820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97820" } ] } ] }, { "uniprot_ac": "P97874", "gene_name": "Gak", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P97874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97874" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P97874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97874" } ] } ] }, { "uniprot_ac": "P97924", "gene_name": "Kalrn", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P97924", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97924" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P97924", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97924" } ] } ] }, { "uniprot_ac": "Q00168", "gene_name": "CaMKII", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q00168", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00168" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q00168", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00168" } ] } ] }, { "uniprot_ac": "Q00526", "gene_name": "CDK3", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q00526", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00526" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q00526", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00526" } ] } ] }, { "uniprot_ac": "Q00532", "gene_name": "CDKL1", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q00532", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00532" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q00532", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00532" } ] } ] }, { "uniprot_ac": "Q00534", "gene_name": "CDK6", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q00534", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00534" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q00534", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00534" } ] } ] }, { "uniprot_ac": "Q00535", "gene_name": "CDK5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q00535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00535" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q00535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00535" } ] } ] }, { "uniprot_ac": "Q00536", "gene_name": "CDK16", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q00536", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00536" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q00536", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00536" } ] } ] }, { "uniprot_ac": "Q00537", "gene_name": "CDK17", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q00537", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00537" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q00537", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00537" } ] } ] }, { "uniprot_ac": "Q00772", "gene_name": "SLT2", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q00772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00772" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q00772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00772" } ] } ] }, { "uniprot_ac": "Q01389", "gene_name": "BCK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q01389", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01389" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q01389", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01389" } ] } ] }, { "uniprot_ac": "Q01919", "gene_name": "KIN4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q01919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01919" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q01919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01919" } ] } ] }, { "uniprot_ac": "Q01986", "gene_name": "Map2k1", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q01986", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01986" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "Q01986", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01986" } ] } ] }, { "uniprot_ac": "Q02111", "gene_name": "Prkcq", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q02111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02111" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q02111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02111" } ] } ] }, { "uniprot_ac": "Q02156", "gene_name": "PRKCE", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q02156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02156" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q02156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02156" } ] } ] }, { "uniprot_ac": "Q02720", "gene_name": "casK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q02720", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02720" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q02720", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02720" } ] } ] }, { "uniprot_ac": "Q02750", "gene_name": "MAP2K1", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q02750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02750" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "Q02750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02750" } ] } ] }, { "uniprot_ac": "Q02779", "gene_name": "MAP3K10", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q02779", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02779" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q02779", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02779" } ] } ] }, { "uniprot_ac": "Q02956", "gene_name": "Prkcz", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q02956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02956" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q02956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02956" } ] } ] }, { "uniprot_ac": "Q03002", "gene_name": "FRK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03002", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03002" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q03002", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03002" } ] } ] }, { "uniprot_ac": "Q03042", "gene_name": "Pkg21D", "activity": [ { "ec_number": "2.7.11.12", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03042" } ] }, { "ec_number": "2.7.11.12", "activity": "", "evidence": [ { "id": "Q03042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03042" } ] } ] }, { "uniprot_ac": "Q03043", "gene_name": "for", "activity": [ { "ec_number": "2.7.11.12", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03043" } ] }, { "ec_number": "2.7.11.12", "activity": "", "evidence": [ { "id": "Q03043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03043" } ] } ] }, { "uniprot_ac": "Q03114", "gene_name": "Cdk5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03114" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q03114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03114" } ] } ] }, { "uniprot_ac": "Q03141", "gene_name": "Mark3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03141" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q03141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03141" } ] } ] }, { "uniprot_ac": "Q03147", "gene_name": "Cdk7", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03147" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q03147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03147" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q03147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03147" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q03147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03147" } ] } ] }, { "uniprot_ac": "Q03306", "gene_name": "PKH3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03306", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03306" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q03306", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03306" } ] } ] }, { "uniprot_ac": "Q03407", "gene_name": "PKH1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03407", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03407" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q03407", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03407" } ] } ] }, { "uniprot_ac": "Q03497", "gene_name": "STE20", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03497" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q03497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03497" } ] } ] }, { "uniprot_ac": "Q03533", "gene_name": "TDA1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03533", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03533" } ] } ] }, { "uniprot_ac": "Q03656", "gene_name": "SKY1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03656" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q03656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03656" } ] } ] }, { "uniprot_ac": "Q03785", "gene_name": "VHS1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03785", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03785" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q03785", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03785" } ] } ] }, { "uniprot_ac": "Q03963", "gene_name": "Eif2ak2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q03963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03963" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03963" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q03963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03963" } ] } ] }, { "uniprot_ac": "Q04735", "gene_name": "Cdk16", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q04735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04735" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q04735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04735" } ] } ] }, { "uniprot_ac": "Q04759", "gene_name": "PRKCQ", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q04759", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04759" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q04759", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04759" } ] } ] }, { "uniprot_ac": "Q04859", "gene_name": "Mak", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q04859", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04859" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q04859", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04859" } ] } ] }, { "uniprot_ac": "Q04899", "gene_name": "Cdk18", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q04899", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04899" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q04899", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04899" } ] } ] }, { "uniprot_ac": "Q05512", "gene_name": "Mark2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q05512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05512" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q05512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05512" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q05512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05512" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "Q05512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05512" } ] } ] }, { "uniprot_ac": "Q05513", "gene_name": "PRKCZ", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q05513", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05513" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q05513", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05513" } ] } ] }, { "uniprot_ac": "Q05652", "gene_name": "pll", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q05652", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05652" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q05652", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05652" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "Q05652", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05652" } ] } ] }, { "uniprot_ac": "Q05655", "gene_name": "PRKCD", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q05655", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05655" } ] }, { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q05655", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05655" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q05655", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05655" } ] } ] }, { "uniprot_ac": "Q06098", "gene_name": "ISR1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q06098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06098" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q06098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06098" } ] } ] }, { "uniprot_ac": "Q06226", "gene_name": "Sgk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q06226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06226" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q06226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06226" } ] } ] }, { "uniprot_ac": "Q06486", "gene_name": "Csnk1d", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q06486", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06486" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q06486", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06486" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q06486", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06486" } ] } ] }, { "uniprot_ac": "Q07002", "gene_name": "CDK18", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q07002", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07002" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q07002", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07002" } ] } ] }, { "uniprot_ac": "Q07174", "gene_name": "Map3k8", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q07174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07174" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q07174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07174" } ] } ] }, { "uniprot_ac": "Q07832", "gene_name": "Plk1", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q07832", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07832" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "Q07832", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07832" } ] } ] }, { "uniprot_ac": "Q07912", "gene_name": "TNK2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q07912", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07912" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "Q07912", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07912" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q07912", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07912" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q07912", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07912" } ] } ] }, { "uniprot_ac": "Q08217", "gene_name": "PSK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q08217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08217" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q08217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08217" } ] } ] }, { "uniprot_ac": "Q08732", "gene_name": "HRK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q08732", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08732" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q08732", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08732" } ] } ] }, { "uniprot_ac": "Q09013", "gene_name": "DMPK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q09013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09013" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q09013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09013" } ] } ] }, { "uniprot_ac": "Q09137", "gene_name": "Prkaa2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q09137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09137" } ] }, { "ec_number": "2.7.11.27", "activity": "ATP + L-seryl-[acetyl-CoA carboxylase] = ADP + H(+) + O-phospho-L-seryl-[acetyl-CoA carboxylase].", "evidence": [ { "id": "Q09137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09137" } ] }, { "ec_number": "2.7.11.31", "activity": "ATP + L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase] = ADP + H(+) + O-phospho-L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase].", "evidence": [ { "id": "Q09137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09137" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q09137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09137" } ] }, { "ec_number": "2.7.11.27", "activity": "", "evidence": [ { "id": "Q09137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09137" } ] }, { "ec_number": "2.7.11.31", "activity": "", "evidence": [ { "id": "Q09137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09137" } ] } ] }, { "uniprot_ac": "Q0KHQ5", "gene_name": "Tao", "activity": [ { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "Q0KHQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0KHQ5" } ] }, { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q0KHQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0KHQ5" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q0KHQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0KHQ5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q0KHQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0KHQ5" } ] } ] }, { "uniprot_ac": "Q0KHT7", "gene_name": "Drak", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q0KHT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0KHT7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q0KHT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0KHT7" } ] } ] }, { "uniprot_ac": "Q0KHV6", "gene_name": "Pink1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q0KHV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0KHV6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q0KHV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0KHV6" } ] } ] }, { "uniprot_ac": "Q0KL02", "gene_name": "Trio", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q0KL02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0KL02" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q0KL02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0KL02" } ] } ] }, { "uniprot_ac": "Q12003", "gene_name": "ENV7", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q12003", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12003" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q12003", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12003" } ] } ] }, { "uniprot_ac": "Q12100", "gene_name": "RTK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q12100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12100" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q12100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12100" } ] } ] }, { "uniprot_ac": "Q12152", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q12152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12152" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q12152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12152" } ] } ] }, { "uniprot_ac": "Q12196", "gene_name": "RIO1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q12196", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12196" } ] }, { "ec_number": "3.6.3.-", "activity": "", "evidence": [ { "id": "Q12196", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12196" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q12196", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12196" } ] } ] }, { "uniprot_ac": "Q12222", "gene_name": "YGK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q12222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12222" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q12222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12222" } ] } ] }, { "uniprot_ac": "Q12236", "gene_name": "PKH2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q12236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12236" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q12236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12236" } ] } ] }, { "uniprot_ac": "Q12263", "gene_name": "GIN4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q12263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12263" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q12263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12263" } ] } ] }, { "uniprot_ac": "Q12310", "gene_name": "PRR2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q12310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12310" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q12310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12310" } ] } ] }, { "uniprot_ac": "Q12469", "gene_name": "SKM1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q12469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12469" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q12469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12469" } ] } ] }, { "uniprot_ac": "Q12505", "gene_name": "SKS1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q12505", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12505" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q12505", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12505" } ] } ] }, { "uniprot_ac": "Q12851", "gene_name": "MAP4K2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q12851", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12851" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q12851", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12851" } ] } ] }, { "uniprot_ac": "Q12852", "gene_name": "MAP3K12", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q12852", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12852" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q12852", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12852" } ] } ] }, { "uniprot_ac": "Q13043", "gene_name": "STK4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13043" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13043" } ] } ] }, { "uniprot_ac": "Q13131", "gene_name": "PRKAA1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13131" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q13131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13131" } ] }, { "ec_number": "2.7.11.27", "activity": "ATP + L-seryl-[acetyl-CoA carboxylase] = ADP + H(+) + O-phospho-L-seryl-[acetyl-CoA carboxylase].", "evidence": [ { "id": "Q13131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13131" } ] }, { "ec_number": "2.7.11.31", "activity": "ATP + L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase] = ADP + H(+) + O-phospho-L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase].", "evidence": [ { "id": "Q13131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13131" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13131" } ] } ] }, { "uniprot_ac": "Q13153", "gene_name": "PAK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13153", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13153" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13153", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13153" } ] } ] }, { "uniprot_ac": "Q13163", "gene_name": "MAP2K5", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13163", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13163" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "Q13163", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13163" } ] } ] }, { "uniprot_ac": "Q13164", "gene_name": "MAPK7", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13164", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13164" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q13164", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13164" } ] } ] }, { "uniprot_ac": "Q13177", "gene_name": "PAK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13177", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13177" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13177", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13177" } ] } ] }, { "uniprot_ac": "Q13188", "gene_name": "STK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13188", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13188" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13188", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13188" } ] } ] }, { "uniprot_ac": "Q13233", "gene_name": "MAP3K1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q13233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13233" } ] }, { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13233" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q13233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13233" } ] } ] }, { "uniprot_ac": "Q13237", "gene_name": "PRKG2", "activity": [ { "ec_number": "2.7.11.12", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13237", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13237" } ] }, { "ec_number": "2.7.11.12", "activity": "", "evidence": [ { "id": "Q13237", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13237" } ] } ] }, { "uniprot_ac": "Q13315", "gene_name": "ATM", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13315" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13315" } ] } ] }, { "uniprot_ac": "Q13418", "gene_name": "ILK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13418", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13418" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13418", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13418" } ] } ] }, { "uniprot_ac": "Q13464", "gene_name": "ROCK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13464", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13464" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13464", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13464" } ] } ] }, { "uniprot_ac": "Q13523", "gene_name": "PRPF4B", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13523", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13523" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13523", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13523" } ] } ] }, { "uniprot_ac": "Q13535", "gene_name": "ATR", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13535" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13535" } ] } ] }, { "uniprot_ac": "Q13546", "gene_name": "RIPK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13546", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13546" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13546", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13546" } ] } ] }, { "uniprot_ac": "Q13554", "gene_name": "CAMK2B", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13554", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13554" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q13554", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13554" } ] } ] }, { "uniprot_ac": "Q13555", "gene_name": "CAMK2G", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13555" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q13555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13555" } ] } ] }, { "uniprot_ac": "Q13557", "gene_name": "CAMK2D", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13557", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13557" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q13557", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13557" } ] } ] }, { "uniprot_ac": "Q13627", "gene_name": "DYRK1A", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13627", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13627" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q13627", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13627" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q13627", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13627" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q13627", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13627" } ] } ] }, { "uniprot_ac": "Q13976", "gene_name": "PRKG1", "activity": [ { "ec_number": "2.7.11.12", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13976" } ] }, { "ec_number": "2.7.11.12", "activity": "", "evidence": [ { "id": "Q13976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13976" } ] } ] }, { "uniprot_ac": "Q14004", "gene_name": "CDK13", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q14004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14004" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q14004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14004" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q14004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14004" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q14004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14004" } ] } ] }, { "uniprot_ac": "Q14012", "gene_name": "CAMK1", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q14012", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14012" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q14012", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14012" } ] } ] }, { "uniprot_ac": "Q14296", "gene_name": "FASTK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q14296", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14296" } ] }, { "ec_number": "2.7.11.8", "activity": "ATP + L-threonyl-[Fas-activated protein] = ADP + H(+) + O-phospho-L-threonyl-[Fas-activated protein].", "evidence": [ { "id": "Q14296", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14296" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q14296", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14296" } ] }, { "ec_number": "2.7.11.8", "activity": "", "evidence": [ { "id": "Q14296", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14296" } ] } ] }, { "uniprot_ac": "Q14680", "gene_name": "MELK", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q14680", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14680" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q14680", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14680" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q14680", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14680" } ] } ] }, { "uniprot_ac": "Q14AX6", "gene_name": "Cdk12", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q14AX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14AX6" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q14AX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14AX6" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q14AX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14AX6" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q14AX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14AX6" } ] } ] }, { "uniprot_ac": "Q15131", "gene_name": "CDK10", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q15131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15131" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q15131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15131" } ] } ] }, { "uniprot_ac": "Q15139", "gene_name": "PRKD1", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q15139", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15139" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q15139", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15139" } ] } ] }, { "uniprot_ac": "Q15208", "gene_name": "STK38", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q15208", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15208" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q15208", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15208" } ] } ] }, { "uniprot_ac": "Q15349", "gene_name": "RPS6KA2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q15349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15349" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q15349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15349" } ] } ] }, { "uniprot_ac": "Q15418", "gene_name": "RPS6KA1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q15418", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15418" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q15418", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15418" } ] } ] }, { "uniprot_ac": "Q15569", "gene_name": "TESK1", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q15569", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15569" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q15569", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15569" } ] } ] }, { "uniprot_ac": "Q15759", "gene_name": "MAPK11", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q15759", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15759" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q15759", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15759" } ] } ] }, { "uniprot_ac": "Q15772", "gene_name": "SPEG", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q15772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15772" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q15772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15772" } ] } ] }, { "uniprot_ac": "Q15831", "gene_name": "STK11", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q15831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15831" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q15831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15831" } ] } ] }, { "uniprot_ac": "Q16512", "gene_name": "PKN1", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q16512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16512" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q16512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16512" } ] } ] }, { "uniprot_ac": "Q16513", "gene_name": "PKN2", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q16513", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16513" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q16513", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16513" } ] } ] }, { "uniprot_ac": "Q16539", "gene_name": "MAPK14", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q16539", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16539" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q16539", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16539" } ] } ] }, { "uniprot_ac": "Q16566", "gene_name": "CAMK4", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q16566", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16566" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q16566", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16566" } ] } ] }, { "uniprot_ac": "Q16584", "gene_name": "MAP3K11", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q16584", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16584" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q16584", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16584" } ] } ] }, { "uniprot_ac": "Q16644", "gene_name": "MAPKAPK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q16644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16644" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q16644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16644" } ] } ] }, { "uniprot_ac": "Q16659", "gene_name": "MAPK6", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q16659", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16659" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q16659", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16659" } ] } ] }, { "uniprot_ac": "Q16816", "gene_name": "PHKG1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q16816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16816" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q16816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16816" } ] }, { "ec_number": "2.7.11.19", "activity": "2 ATP + phosphorylase b = 2 ADP + phosphorylase a.", "evidence": [ { "id": "Q16816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16816" } ] }, { "ec_number": "2.7.11.19", "activity": "", "evidence": [ { "id": "Q16816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16816" } ] } ] }, { "uniprot_ac": "Q1EG27", "gene_name": "Myo3b", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q1EG27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1EG27" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q1EG27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1EG27" } ] } ] }, { "uniprot_ac": "Q1HKZ5", "gene_name": "Map3k13", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q1HKZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1HKZ5" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q1HKZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1HKZ5" } ] } ] }, { "uniprot_ac": "Q1ZXC8", "gene_name": "pXi", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q1ZXC8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXC8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q1ZXC8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXC8" } ] } ] }, { "uniprot_ac": "Q1ZXD6", "gene_name": "roco5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q1ZXD6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXD6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q1ZXD6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXD6" } ] } ] }, { "uniprot_ac": "Q1ZXH2", "gene_name": "fhkB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q1ZXH2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXH2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q1ZXH2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXH2" } ] } ] }, { "uniprot_ac": "Q1ZXI5", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q1ZXI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXI5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q1ZXI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXI5" } ] } ] }, { "uniprot_ac": "Q1ZXR2", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q1ZXR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXR2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q1ZXR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXR2" } ] } ] }, { "uniprot_ac": "Q23915", "gene_name": "kinX", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q23915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q23915" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q23915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q23915" } ] } ] }, { "uniprot_ac": "Q23977", "gene_name": "hep", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q23977", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q23977" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "Q23977", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q23977" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "Q23977", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q23977" } ] } ] }, { "uniprot_ac": "Q24210", "gene_name": "CASK", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q24210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24210" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q24210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24210" } ] } ] }, { "uniprot_ac": "Q24216", "gene_name": "Cdk7", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q24216", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24216" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q24216", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24216" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q24216", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24216" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q24216", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24216" } ] } ] }, { "uniprot_ac": "Q24324", "gene_name": "Dsor1", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q24324", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24324" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "Q24324", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24324" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "Q24324", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24324" } ] } ] }, { "uniprot_ac": "Q2M2I8", "gene_name": "AAK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q2M2I8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2M2I8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q2M2I8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2M2I8" } ] } ] }, { "uniprot_ac": "Q2NL51", "gene_name": "Gsk3a", "activity": [ { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q2NL51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2NL51" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "Q2NL51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2NL51" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q2NL51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2NL51" } ] } ] }, { "uniprot_ac": "Q38SD2", "gene_name": "LRRK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q38SD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q38SD2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q38SD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q38SD2" } ] } ] }, { "uniprot_ac": "Q3MJK5", "gene_name": "Cdk12", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3MJK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MJK5" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q3MJK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MJK5" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q3MJK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MJK5" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q3MJK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MJK5" } ] } ] }, { "uniprot_ac": "Q3TYD6", "gene_name": "Lmtk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3TYD6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TYD6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3TYD6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TYD6" } ] } ] }, { "uniprot_ac": "Q3TZA2", "gene_name": "Cdkl4", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3TZA2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TZA2" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q3TZA2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TZA2" } ] } ] }, { "uniprot_ac": "Q3U1V8", "gene_name": "Map3k9", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3U1V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U1V8" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q3U1V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U1V8" } ] } ] }, { "uniprot_ac": "Q3U214", "gene_name": "Mast3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3U214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U214" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3U214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U214" } ] } ] }, { "uniprot_ac": "Q3U3Q1", "gene_name": "Ulk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3U3Q1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U3Q1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3U3Q1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U3Q1" } ] } ] }, { "uniprot_ac": "Q3UGM2", "gene_name": "Nek10", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3UGM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UGM2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3UGM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UGM2" } ] } ] }, { "uniprot_ac": "Q3UH66", "gene_name": "Wnk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3UH66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UH66" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3UH66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UH66" } ] } ] }, { "uniprot_ac": "Q3UHC2", "gene_name": "Lrrk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3UHC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UHC2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3UHC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UHC2" } ] } ] }, { "uniprot_ac": "Q3UHJ0", "gene_name": "Aak1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3UHJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UHJ0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3UHJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UHJ0" } ] } ] }, { "uniprot_ac": "Q3ULB5", "gene_name": "Pak6", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3ULB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3ULB5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3ULB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3ULB5" } ] } ] }, { "uniprot_ac": "Q3UMM4", "gene_name": "Cdk10", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3UMM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UMM4" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q3UMM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UMM4" } ] } ] }, { "uniprot_ac": "Q3UMW7", "gene_name": "Mapkapk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3UMW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UMW7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3UMW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UMW7" } ] } ] }, { "uniprot_ac": "Q3UTQ8", "gene_name": "Cdkl5", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3UTQ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UTQ8" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q3UTQ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UTQ8" } ] } ] }, { "uniprot_ac": "Q3UU96", "gene_name": "Cdc42bpa", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3UU96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UU96" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3UU96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UU96" } ] } ] }, { "uniprot_ac": "Q3UVC0", "gene_name": "Ksr2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3UVC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UVC0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3UVC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UVC0" } ] } ] }, { "uniprot_ac": "Q3UVR3", "gene_name": "Ttbk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3UVR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UVR3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3UVR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UVR3" } ] } ] }, { "uniprot_ac": "Q3V016", "gene_name": "Hipk4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3V016", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3V016" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3V016", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3V016" } ] } ] }, { "uniprot_ac": "Q3V129", "gene_name": "Ulk4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3V129", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3V129" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q3V129", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3V129" } ] } ] }, { "uniprot_ac": "Q3V3A1", "gene_name": "Cdk15", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q3V3A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3V3A1" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q3V3A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3V3A1" } ] } ] }, { "uniprot_ac": "Q4FZD7", "gene_name": "Plk5", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q4FZD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4FZD7" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "Q4FZD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4FZD7" } ] } ] }, { "uniprot_ac": "Q4G050", "gene_name": "Mknk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q4G050", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4G050" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q4G050", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4G050" } ] } ] }, { "uniprot_ac": "Q4KM34", "gene_name": "Cdk20", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q4KM34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM34" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q4KM34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM34" } ] } ] }, { "uniprot_ac": "Q4KM47", "gene_name": "Cdk10", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q4KM47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM47" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q4KM47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM47" } ] } ] }, { "uniprot_ac": "Q4KSH7", "gene_name": "Map2k7", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q4KSH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KSH7" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "Q4KSH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KSH7" } ] } ] }, { "uniprot_ac": "Q4V793", "gene_name": "Hipk4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q4V793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V793" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q4V793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V793" } ] } ] }, { "uniprot_ac": "Q4V8A3", "gene_name": "Dyrk3", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q4V8A3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8A3" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q4V8A3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8A3" } ] } ] }, { "uniprot_ac": "Q52WX2", "gene_name": "SBK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q52WX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q52WX2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q52WX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q52WX2" } ] } ] }, { "uniprot_ac": "Q53UA7", "gene_name": "Taok3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q53UA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q53UA7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q53UA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q53UA7" } ] } ] }, { "uniprot_ac": "Q54B33", "gene_name": "pakE", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54B33", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54B33" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54B33", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54B33" } ] } ] }, { "uniprot_ac": "Q54B48", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54B48", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54B48" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54B48", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54B48" } ] } ] }, { "uniprot_ac": "Q54BC9", "gene_name": "dyrk2", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54BC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54BC9" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q54BC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54BC9" } ] } ] }, { "uniprot_ac": "Q54BF0", "gene_name": "fhkA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54BF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54BF0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54BF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54BF0" } ] } ] }, { "uniprot_ac": "Q54C18", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54C18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54C18" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54C18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54C18" } ] } ] }, { "uniprot_ac": "Q54C38", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54C38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54C38" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54C38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54C38" } ] } ] }, { "uniprot_ac": "Q54C71", "gene_name": "kxcB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54C71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54C71" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54C71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54C71" } ] } ] }, { "uniprot_ac": "Q54D75", "gene_name": "", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54D75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54D75" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q54D75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54D75" } ] } ] }, { "uniprot_ac": "Q54DC8", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54DC8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DC8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54DC8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DC8" } ] } ] }, { "uniprot_ac": "Q54DF2", "gene_name": "mrkA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54DF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DF2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54DF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DF2" } ] } ] }, { "uniprot_ac": "Q54DK3", "gene_name": "cdc7", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54DK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DK3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54DK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DK3" } ] } ] }, { "uniprot_ac": "Q54DY0", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54DY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DY0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54DY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DY0" } ] } ] }, { "uniprot_ac": "Q54E34", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54E34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54E34" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54E34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54E34" } ] } ] }, { "uniprot_ac": "Q54EG9", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54EG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54EG9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54EG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54EG9" } ] } ] }, { "uniprot_ac": "Q54EM1", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54EM1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54EM1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54EM1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54EM1" } ] } ] }, { "uniprot_ac": "Q54ER4", "gene_name": "atr1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54ER4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54ER4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54ER4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54ER4" } ] } ] }, { "uniprot_ac": "Q54ET3", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54ET3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54ET3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54ET3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54ET3" } ] } ] }, { "uniprot_ac": "Q54EY4", "gene_name": "dst3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54EY4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54EY4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54EY4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54EY4" } ] } ] }, { "uniprot_ac": "Q54F40", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54F40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54F40" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54F40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54F40" } ] } ] }, { "uniprot_ac": "Q54FH3", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54FH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54FH3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54FH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54FH3" } ] } ] }, { "uniprot_ac": "Q54FR9", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54FR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54FR9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54FR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54FR9" } ] } ] }, { "uniprot_ac": "Q54G43", "gene_name": "shkE", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54G43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54G43" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54G43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54G43" } ] } ] }, { "uniprot_ac": "Q54GY6", "gene_name": "kxcA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54GY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GY6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54GY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GY6" } ] } ] }, { "uniprot_ac": "Q54H05", "gene_name": "kinY", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54H05", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54H05" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54H05", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54H05" } ] } ] }, { "uniprot_ac": "Q54H45", "gene_name": "drkB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54H45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54H45" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54H45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54H45" } ] } ] }, { "uniprot_ac": "Q54H46", "gene_name": "drkA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54H46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54H46" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54H46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54H46" } ] } ] }, { "uniprot_ac": "Q54HC6", "gene_name": "arkA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54HC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54HC6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54HC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54HC6" } ] } ] }, { "uniprot_ac": "Q54HD2", "gene_name": "ndrD", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54HD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54HD2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54HD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54HD2" } ] } ] }, { "uniprot_ac": "Q54I36", "gene_name": "pyk3", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54I36", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54I36" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q54I36", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54I36" } ] } ] }, { "uniprot_ac": "Q54IE8", "gene_name": "irlE", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54IE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54IE8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54IE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54IE8" } ] } ] }, { "uniprot_ac": "Q54IF2", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54IF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54IF2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54IF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54IF2" } ] } ] }, { "uniprot_ac": "Q54IH8", "gene_name": "ndrB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54IH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54IH8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54IH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54IH8" } ] } ] }, { "uniprot_ac": "Q54IP4", "gene_name": "shkB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54IP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54IP4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54IP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54IP4" } ] } ] }, { "uniprot_ac": "Q54JC7", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54JC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54JC7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54JC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54JC7" } ] } ] }, { "uniprot_ac": "Q54JG7", "gene_name": "dst4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54JG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54JG7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54JG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54JG7" } ] } ] }, { "uniprot_ac": "Q54JQ1", "gene_name": "mkcC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54JQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54JQ1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54JQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54JQ1" } ] } ] }, { "uniprot_ac": "Q54L00", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54L00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54L00" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54L00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54L00" } ] } ] }, { "uniprot_ac": "Q54L81", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54L81", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54L81" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54L81", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54L81" } ] } ] }, { "uniprot_ac": "Q54LH8", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54LH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54LH8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54LH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54LH8" } ] } ] }, { "uniprot_ac": "Q54LR6", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54LR6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54LR6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54LR6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54LR6" } ] } ] }, { "uniprot_ac": "Q54LU8", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54LU8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54LU8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54LU8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54LU8" } ] } ] }, { "uniprot_ac": "Q54M77", "gene_name": "roco8", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54M77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54M77" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54M77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54M77" } ] } ] }, { "uniprot_ac": "Q54MH0", "gene_name": "fhkD", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54MH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MH0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54MH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MH0" } ] } ] }, { "uniprot_ac": "Q54MV2", "gene_name": "mrkB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54MV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MV2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54MV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MV2" } ] } ] }, { "uniprot_ac": "Q54MY9", "gene_name": "mkcA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54MY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MY9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54MY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MY9" } ] } ] }, { "uniprot_ac": "Q54P26", "gene_name": "samkB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54P26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P26" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54P26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P26" } ] } ] }, { "uniprot_ac": "Q54P47", "gene_name": "ndrC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54P47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P47" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54P47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P47" } ] } ] }, { "uniprot_ac": "Q54PK8", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54PK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54PK8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54PK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54PK8" } ] } ] }, { "uniprot_ac": "Q54PK9", "gene_name": "pdkB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54PK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54PK9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54PK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54PK9" } ] } ] }, { "uniprot_ac": "Q54PX0", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54PX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54PX0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54PX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54PX0" } ] } ] }, { "uniprot_ac": "Q54Q69", "gene_name": "dhkG", "activity": [ { "ec_number": "2.7.13.3", "activity": "ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.", "evidence": [ { "id": "Q54Q69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Q69" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54Q69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Q69" } ] } ] }, { "uniprot_ac": "Q54QB1", "gene_name": "erkB", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54QB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QB1" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q54QB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QB1" } ] } ] }, { "uniprot_ac": "Q54QD5", "gene_name": "nek1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54QD5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QD5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54QD5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QD5" } ] } ] }, { "uniprot_ac": "Q54QI2", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54QI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QI2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54QI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QI2" } ] } ] }, { "uniprot_ac": "Q54QQ1", "gene_name": "phg2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54QQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QQ1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54QQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QQ1" } ] } ] }, { "uniprot_ac": "Q54QV3", "gene_name": "yakA", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54QV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QV3" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q54QV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QV3" } ] } ] }, { "uniprot_ac": "Q54R82", "gene_name": "mkkA", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54R82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54R82" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q54R82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54R82" } ] } ] }, { "uniprot_ac": "Q54R95", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54R95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54R95" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54R95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54R95" } ] } ] }, { "uniprot_ac": "Q54R98", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54R98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54R98" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54R98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54R98" } ] } ] }, { "uniprot_ac": "Q54RB2", "gene_name": "cdk11", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54RB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RB2" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q54RB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RB2" } ] } ] }, { "uniprot_ac": "Q54RB7", "gene_name": "shkA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54RB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RB7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54RB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RB7" } ] } ] }, { "uniprot_ac": "Q54RJ4", "gene_name": "iksA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54RJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RJ4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54RJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RJ4" } ] } ] }, { "uniprot_ac": "Q54RP7", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54RP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RP7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54RP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RP7" } ] } ] }, { "uniprot_ac": "Q54RR9", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54RR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RR9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54RR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RR9" } ] } ] }, { "uniprot_ac": "Q54RV3", "gene_name": "pakG", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54RV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RV3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54RV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RV3" } ] } ] }, { "uniprot_ac": "Q54RZ7", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54RZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RZ7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54RZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RZ7" } ] } ] }, { "uniprot_ac": "Q54S77", "gene_name": "vps15", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54S77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54S77" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54S77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54S77" } ] } ] }, { "uniprot_ac": "Q54SC4", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54SC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SC4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54SC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SC4" } ] } ] }, { "uniprot_ac": "Q54SK3", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54SK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SK3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54SK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SK3" } ] } ] }, { "uniprot_ac": "Q54T05", "gene_name": "rio2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54T05", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54T05" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54T05", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54T05" } ] } ] }, { "uniprot_ac": "Q54TA1", "gene_name": "drkC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54TA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TA1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54TA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TA1" } ] } ] }, { "uniprot_ac": "Q54TA3", "gene_name": "mrkC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54TA3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TA3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54TA3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TA3" } ] } ] }, { "uniprot_ac": "Q54TH6", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54TH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TH6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54TH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TH6" } ] } ] }, { "uniprot_ac": "Q54TM7", "gene_name": "drkD", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54TM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TM7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54TM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TM7" } ] } ] }, { "uniprot_ac": "Q54TN4", "gene_name": "mkcE", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54TN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TN4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54TN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TN4" } ] } ] }, { "uniprot_ac": "Q54TW2", "gene_name": "pdkA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54TW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TW2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54TW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TW2" } ] } ] }, { "uniprot_ac": "Q54U31", "gene_name": "shkD", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54U31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54U31" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54U31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54U31" } ] } ] }, { "uniprot_ac": "Q54U65", "gene_name": "7tmk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54U65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54U65" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54U65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54U65" } ] } ] }, { "uniprot_ac": "Q54UA9", "gene_name": "clkA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54UA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UA9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54UA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UA9" } ] } ] }, { "uniprot_ac": "Q54UC0", "gene_name": "dnapkcs", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54UC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UC0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54UC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UC0" } ] } ] }, { "uniprot_ac": "Q54UL8", "gene_name": "mps1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54UL8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UL8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54UL8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UL8" } ] } ] }, { "uniprot_ac": "Q54UZ1", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54UZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UZ1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54UZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UZ1" } ] } ] }, { "uniprot_ac": "Q54V35", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54V35", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54V35" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54V35", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54V35" } ] } ] }, { "uniprot_ac": "Q54V83", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54V83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54V83" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54V83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54V83" } ] } ] }, { "uniprot_ac": "Q54VC0", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54VC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VC0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54VC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VC0" } ] } ] }, { "uniprot_ac": "Q54VD8", "gene_name": "rio1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54VD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VD8" } ] }, { "ec_number": "3.6.3.-", "activity": "", "evidence": [ { "id": "Q54VD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VD8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54VD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VD8" } ] } ] }, { "uniprot_ac": "Q54VI1", "gene_name": "fhkE", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54VI1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VI1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54VI1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VI1" } ] } ] }, { "uniprot_ac": "Q54VU4", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54VU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VU4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54VU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VU4" } ] } ] }, { "uniprot_ac": "Q54VV7", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54VV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VV7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54VV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VV7" } ] } ] }, { "uniprot_ac": "Q54W07", "gene_name": "bud32", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54W07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54W07" } ] }, { "ec_number": "3.6.-.-", "activity": "", "evidence": [ { "id": "Q54W07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54W07" } ] } ] }, { "uniprot_ac": "Q54WC0", "gene_name": "STK19", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54WC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WC0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54WC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WC0" } ] } ] }, { "uniprot_ac": "Q54WD7", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54WD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WD7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54WD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WD7" } ] } ] }, { "uniprot_ac": "Q54WE5", "gene_name": "prpf4B", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54WE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WE5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54WE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WE5" } ] } ] }, { "uniprot_ac": "Q54WJ0", "gene_name": "lkb1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54WJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WJ0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54WJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WJ0" } ] } ] }, { "uniprot_ac": "Q54WS5", "gene_name": "roco6", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54WS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WS5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54WS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WS5" } ] } ] }, { "uniprot_ac": "Q54WW7", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54WW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WW7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54WW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WW7" } ] } ] }, { "uniprot_ac": "Q54WX4", "gene_name": "aurK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54WX4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WX4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54WX4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WX4" } ] } ] }, { "uniprot_ac": "Q54XJ4", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54XJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XJ4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54XJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XJ4" } ] } ] }, { "uniprot_ac": "Q54XL6", "gene_name": "fray1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54XL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XL6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54XL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XL6" } ] } ] }, { "uniprot_ac": "Q54XQ2", "gene_name": "rckA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54XQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XQ2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54XQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XQ2" } ] } ] }, { "uniprot_ac": "Q54XX5", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54XX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XX5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54XX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XX5" } ] } ] }, { "uniprot_ac": "Q54XY6", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54XY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XY6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54XY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XY6" } ] } ] }, { "uniprot_ac": "Q54XZ5", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54XZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XZ5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54XZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XZ5" } ] } ] }, { "uniprot_ac": "Q54Y06", "gene_name": "", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54Y06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y06" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q54Y06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y06" } ] } ] }, { "uniprot_ac": "Q54Y26", "gene_name": "ndrA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54Y26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y26" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54Y26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y26" } ] } ] }, { "uniprot_ac": "Q54Y55", "gene_name": "shkC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54Y55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y55" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54Y55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y55" } ] } ] }, { "uniprot_ac": "Q54Y90", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54Y90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y90" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54Y90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y90" } ] } ] }, { "uniprot_ac": "Q54YF2", "gene_name": "snfA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54YF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54YF2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54YF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54YF2" } ] } ] }, { "uniprot_ac": "Q54YZ5", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54YZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54YZ5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54YZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54YZ5" } ] } ] }, { "uniprot_ac": "Q54ZN3", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q54ZN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54ZN3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q54ZN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54ZN3" } ] } ] }, { "uniprot_ac": "Q550K8", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q550K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q550K8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q550K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q550K8" } ] } ] }, { "uniprot_ac": "Q550L8", "gene_name": "ifkB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q550L8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q550L8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q550L8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q550L8" } ] } ] }, { "uniprot_ac": "Q551H4", "gene_name": "fray2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q551H4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q551H4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q551H4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q551H4" } ] } ] }, { "uniprot_ac": "Q552C1", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q552C1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q552C1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q552C1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q552C1" } ] } ] }, { "uniprot_ac": "Q552C6", "gene_name": "zak2", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q552C6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q552C6" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q552C6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q552C6" } ] } ] }, { "uniprot_ac": "Q552E9", "gene_name": "pkgA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q552E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q552E9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q552E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q552E9" } ] } ] }, { "uniprot_ac": "Q552Z2", "gene_name": "fnkE", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q552Z2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q552Z2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q552Z2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q552Z2" } ] } ] }, { "uniprot_ac": "Q553E9", "gene_name": "smg1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q553E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q553E9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q553E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q553E9" } ] } ] }, { "uniprot_ac": "Q556J6", "gene_name": "", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q556J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556J6" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q556J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556J6" } ] } ] }, { "uniprot_ac": "Q556Q3", "gene_name": "irlF-2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q556Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556Q3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q556Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556Q3" } ] } ] }, { "uniprot_ac": "Q556S2", "gene_name": "pakH-2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q556S2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556S2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q556S2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556S2" } ] } ] }, { "uniprot_ac": "Q556Y4", "gene_name": "cak1-1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q556Y4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556Y4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q556Y4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556Y4" } ] } ] }, { "uniprot_ac": "Q557G1", "gene_name": "irlB-1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q557G1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q557G1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q557G1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q557G1" } ] } ] }, { "uniprot_ac": "Q558U1", "gene_name": "ifkA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q558U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q558U1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q558U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q558U1" } ] } ] }, { "uniprot_ac": "Q559A2", "gene_name": "irlA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q559A2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q559A2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q559A2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q559A2" } ] } ] }, { "uniprot_ac": "Q559T8", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q559T8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q559T8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q559T8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q559T8" } ] } ] }, { "uniprot_ac": "Q55A09", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55A09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55A09" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55A09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55A09" } ] } ] }, { "uniprot_ac": "Q55A55", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55A55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55A55" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55A55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55A55" } ] } ] }, { "uniprot_ac": "Q55BA0", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55BA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BA0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55BA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BA0" } ] } ] }, { "uniprot_ac": "Q55BN8", "gene_name": "nek2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55BN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BN8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55BN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BN8" } ] } ] }, { "uniprot_ac": "Q55C57", "gene_name": "glkA", "activity": [ { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q55C57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55C57" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "Q55C57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55C57" } ] } ] }, { "uniprot_ac": "Q55CA6", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55CA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CA6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55CA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CA6" } ] } ] }, { "uniprot_ac": "Q55CE0", "gene_name": "mkcF", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55CE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CE0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55CE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CE0" } ] } ] }, { "uniprot_ac": "Q55CL6", "gene_name": "mekA", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55CL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CL6" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "Q55CL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CL6" } ] } ] }, { "uniprot_ac": "Q55CW2", "gene_name": "samkC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55CW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CW2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55CW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CW2" } ] } ] }, { "uniprot_ac": "Q55CW3", "gene_name": "samkA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55CW3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CW3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55CW3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CW3" } ] } ] }, { "uniprot_ac": "Q55CY9", "gene_name": "gdt8", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55CY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CY9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55CY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CY9" } ] } ] }, { "uniprot_ac": "Q55CZ1", "gene_name": "gdt2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55CZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CZ1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55CZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CZ1" } ] } ] }, { "uniprot_ac": "Q55D99", "gene_name": "pakA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55D99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55D99" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55D99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55D99" } ] } ] }, { "uniprot_ac": "Q55DD4", "gene_name": "pakD", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55DD4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DD4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55DD4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DD4" } ] } ] }, { "uniprot_ac": "Q55DJ8", "gene_name": "irlC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55DJ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DJ8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55DJ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DJ8" } ] } ] }, { "uniprot_ac": "Q55DJ9", "gene_name": "irlD", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55DJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DJ9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55DJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DJ9" } ] } ] }, { "uniprot_ac": "Q55DK2", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55DK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DK2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55DK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DK2" } ] } ] }, { "uniprot_ac": "Q55DU7", "gene_name": "gdt4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55DU7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DU7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55DU7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DU7" } ] } ] }, { "uniprot_ac": "Q55E58", "gene_name": "pats1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55E58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55E58" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55E58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55E58" } ] } ] }, { "uniprot_ac": "Q55EC7", "gene_name": "gefX", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55EC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55EC7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55EC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55EC7" } ] } ] }, { "uniprot_ac": "Q55EI8", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55EI8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55EI8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55EI8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55EI8" } ] } ] }, { "uniprot_ac": "Q55F45", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55F45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F45" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55F45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F45" } ] } ] }, { "uniprot_ac": "Q55FJ6", "gene_name": "", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55FJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FJ6" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q55FJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FJ6" } ] } ] }, { "uniprot_ac": "Q55FS2", "gene_name": "krsB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55FS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FS2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55FS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FS2" } ] } ] }, { "uniprot_ac": "Q55FT4", "gene_name": "tsuA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55FT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FT4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55FT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FT4" } ] } ] }, { "uniprot_ac": "Q55FV4", "gene_name": "fnkB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55FV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FV4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55FV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FV4" } ] } ] }, { "uniprot_ac": "Q55FV5", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55FV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FV5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55FV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FV5" } ] } ] }, { "uniprot_ac": "Q55GC2", "gene_name": "dst2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55GC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GC2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55GC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GC2" } ] } ] }, { "uniprot_ac": "Q55GE6", "gene_name": "roco7", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55GE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GE6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55GE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GE6" } ] } ] }, { "uniprot_ac": "Q55GG4", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55GG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GG4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55GG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GG4" } ] } ] }, { "uniprot_ac": "Q55GJ2", "gene_name": "ireA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55GJ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GJ2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55GJ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GJ2" } ] } ] }, { "uniprot_ac": "Q55GS4", "gene_name": "cdk10", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55GS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GS4" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q55GS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GS4" } ] } ] }, { "uniprot_ac": "Q55GU0", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55GU0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GU0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55GU0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GU0" } ] } ] }, { "uniprot_ac": "Q55GV3", "gene_name": "pakC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q55GV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GV3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q55GV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GV3" } ] } ] }, { "uniprot_ac": "Q56UN5", "gene_name": "MAP3K19", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q56UN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q56UN5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q56UN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q56UN5" } ] } ] }, { "uniprot_ac": "Q59H18", "gene_name": "TNNI3K", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q59H18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q59H18" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q59H18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q59H18" } ] } ] }, { "uniprot_ac": "Q5EAK6", "gene_name": "tefu", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5EAK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EAK6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5EAK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EAK6" } ] } ] }, { "uniprot_ac": "Q5EG47", "gene_name": "Prkaa1", "activity": [ { "ec_number": "2.7.11.27", "activity": "ATP + L-seryl-[acetyl-CoA carboxylase] = ADP + H(+) + O-phospho-L-seryl-[acetyl-CoA carboxylase].", "evidence": [ { "id": "Q5EG47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EG47" } ] }, { "ec_number": "2.7.11.31", "activity": "ATP + L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase] = ADP + H(+) + O-phospho-L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase].", "evidence": [ { "id": "Q5EG47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EG47" } ] }, { "ec_number": "2.7.11.31", "activity": "", "evidence": [ { "id": "Q5EG47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EG47" } ] }, { "ec_number": "2.7.11.27", "activity": "", "evidence": [ { "id": "Q5EG47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EG47" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5EG47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EG47" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q5EG47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EG47" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5EG47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EG47" } ] } ] }, { "uniprot_ac": "Q5F2E8", "gene_name": "Taok1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5F2E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5F2E8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5F2E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5F2E8" } ] } ] }, { "uniprot_ac": "Q5GIG6", "gene_name": "Tnni3k", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5GIG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5GIG6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5GIG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5GIG6" } ] } ] }, { "uniprot_ac": "Q5MAI5", "gene_name": "CDKL4", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5MAI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MAI5" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q5MAI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MAI5" } ] } ] }, { "uniprot_ac": "Q5MJS3", "gene_name": "Fam20c", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5MJS3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MJS3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5MJS3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MJS3" } ] } ] }, { "uniprot_ac": "Q5MPA9", "gene_name": "Dclk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5MPA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MPA9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5MPA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MPA9" } ] } ] }, { "uniprot_ac": "Q5RJI5", "gene_name": "Brsk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5RJI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RJI5" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q5RJI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RJI5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5RJI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RJI5" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "Q5RJI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RJI5" } ] } ] }, { "uniprot_ac": "Q5RKH1", "gene_name": "Prpf4b", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5RKH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RKH1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5RKH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RKH1" } ] } ] }, { "uniprot_ac": "Q5S006", "gene_name": "Lrrk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] } ] }, { "uniprot_ac": "Q5S007", "gene_name": "LRRK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5S007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S007" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5S007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S007" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5S007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S007" } ] } ] }, { "uniprot_ac": "Q5SUV5", "gene_name": "Mylk4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5SUV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SUV5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5SUV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SUV5" } ] } ] }, { "uniprot_ac": "Q5SYL1", "gene_name": "Rskr", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5SYL1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SYL1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5SYL1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SYL1" } ] } ] }, { "uniprot_ac": "Q5TCX8", "gene_name": "MAP3K21", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5TCX8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TCX8" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q5TCX8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TCX8" } ] } ] }, { "uniprot_ac": "Q5TCY1", "gene_name": "TTBK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5TCY1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TCY1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5TCY1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TCY1" } ] } ] }, { "uniprot_ac": "Q5U2N4", "gene_name": "Mknk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5U2N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U2N4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5U2N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U2N4" } ] } ] }, { "uniprot_ac": "Q5U2X5", "gene_name": "Tnk2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q5U2X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U2X5" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "Q5U2X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U2X5" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5U2X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U2X5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5U2X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U2X5" } ] } ] }, { "uniprot_ac": "Q5U452", "gene_name": "Trp53rka", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5U452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U452" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5U452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U452" } ] } ] }, { "uniprot_ac": "Q5U4C9", "gene_name": "Dyrk2", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5U4C9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U4C9" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q5U4C9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U4C9" } ] } ] }, { "uniprot_ac": "Q5VJL3", "gene_name": "gdt9", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5VJL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VJL3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5VJL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VJL3" } ] } ] }, { "uniprot_ac": "Q5VST9", "gene_name": "OBSCN", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5VST9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VST9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5VST9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VST9" } ] } ] }, { "uniprot_ac": "Q5VT25", "gene_name": "CDC42BPA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5VT25", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VT25" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5VT25", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VT25" } ] } ] }, { "uniprot_ac": "Q5XIS9", "gene_name": "Prkd2", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5XIS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIS9" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q5XIS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIS9" } ] } ] }, { "uniprot_ac": "Q5XIT0", "gene_name": "Cdkl2", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5XIT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIT0" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q5XIT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIT0" } ] } ] }, { "uniprot_ac": "Q5XJV6", "gene_name": "Lmtk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5XJV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XJV6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5XJV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XJV6" } ] } ] }, { "uniprot_ac": "Q60592", "gene_name": "Mast2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q60592", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60592" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q60592", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60592" } ] } ] }, { "uniprot_ac": "Q60670", "gene_name": "Sik1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q60670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60670" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q60670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60670" } ] } ] }, { "uniprot_ac": "Q60692", "gene_name": "Psmb6", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "Q60692", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60692" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "Q60692", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60692" } ] } ] }, { "uniprot_ac": "Q60700", "gene_name": "Map3k12", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q60700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60700" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q60700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60700" } ] } ] }, { "uniprot_ac": "Q60737", "gene_name": "Csnk2a1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q60737", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60737" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q60737", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60737" } ] } ] }, { "uniprot_ac": "Q60806", "gene_name": "Plk3", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q60806", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60806" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "Q60806", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60806" } ] } ] }, { "uniprot_ac": "Q60823", "gene_name": "Akt2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q60823", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60823" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q60823", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60823" } ] } ] }, { "uniprot_ac": "Q60855", "gene_name": "Ripk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q60855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60855" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q60855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60855" } ] } ] }, { "uniprot_ac": "Q61036", "gene_name": "Pak3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q61036", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61036" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q61036", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61036" } ] } ] }, { "uniprot_ac": "Q61083", "gene_name": "Map3k2", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q61083", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61083" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q61083", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61083" } ] } ] }, { "uniprot_ac": "Q61084", "gene_name": "Map3k3", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q61084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61084" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q61084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61084" } ] } ] }, { "uniprot_ac": "Q61097", "gene_name": "Ksr1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q61097", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61097" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q61097", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61097" } ] } ] }, { "uniprot_ac": "Q61136", "gene_name": "Prpf4b", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q61136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61136" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q61136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61136" } ] } ] }, { "uniprot_ac": "Q61161", "gene_name": "Map4k2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q61161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61161" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q61161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61161" } ] } ] }, { "uniprot_ac": "Q61214", "gene_name": "Dyrk1a", "activity": [ { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q61214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61214" } ] }, { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q61214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61214" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q61214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61214" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q61214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61214" } ] } ] }, { "uniprot_ac": "Q61241", "gene_name": "Tssk1b", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q61241", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61241" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q61241", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61241" } ] } ] }, { "uniprot_ac": "Q61410", "gene_name": "Prkg2", "activity": [ { "ec_number": "2.7.11.12", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q61410", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61410" } ] }, { "ec_number": "2.7.11.12", "activity": "", "evidence": [ { "id": "Q61410", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61410" } ] } ] }, { "uniprot_ac": "Q61532", "gene_name": "Mapk6", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q61532", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61532" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q61532", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61532" } ] } ] }, { "uniprot_ac": "Q61831", "gene_name": "Mapk10", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q61831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61831" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q61831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61831" } ] } ] }, { "uniprot_ac": "Q61846", "gene_name": "Melk", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q61846", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61846" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q61846", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61846" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q61846", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61846" } ] } ] }, { "uniprot_ac": "Q62070", "gene_name": "Pim2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62070", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62070" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q62070", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62070" } ] } ] }, { "uniprot_ac": "Q62073", "gene_name": "Map3k7", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62073", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62073" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q62073", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62073" } ] } ] }, { "uniprot_ac": "Q62074", "gene_name": "Prkci", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62074" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q62074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62074" } ] } ] }, { "uniprot_ac": "Q62101", "gene_name": "Prkd1", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62101", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62101" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q62101", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62101" } ] } ] }, { "uniprot_ac": "Q62388", "gene_name": "Atm", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62388", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62388" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q62388", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62388" } ] } ] }, { "uniprot_ac": "Q62406", "gene_name": "Irak1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62406", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62406" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q62406", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62406" } ] } ] }, { "uniprot_ac": "Q62407", "gene_name": "Speg", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62407", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62407" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q62407", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62407" } ] } ] }, { "uniprot_ac": "Q62673", "gene_name": "Plk1", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62673", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62673" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "Q62673", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62673" } ] } ] }, { "uniprot_ac": "Q62726", "gene_name": "Cilk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62726", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62726" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q62726", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62726" } ] } ] }, { "uniprot_ac": "Q62761", "gene_name": "Csnk1g1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62761", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62761" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q62761", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62761" } ] } ] }, { "uniprot_ac": "Q62762", "gene_name": "Csnk1g2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62762" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q62762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62762" } ] } ] }, { "uniprot_ac": "Q62763", "gene_name": "Csnk1g3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62763" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q62763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62763" } ] } ] }, { "uniprot_ac": "Q62829", "gene_name": "Pak3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62829", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62829" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q62829", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62829" } ] } ] }, { "uniprot_ac": "Q62862", "gene_name": "Map2k5", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62862", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62862" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "Q62862", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62862" } ] } ] }, { "uniprot_ac": "Q62868", "gene_name": "Rock2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62868", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62868" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q62868", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62868" } ] } ] }, { "uniprot_ac": "Q62915", "gene_name": "Cask", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62915" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q62915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62915" } ] } ] }, { "uniprot_ac": "Q62925", "gene_name": "Map3k1", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q62925", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62925" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q62925", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62925" } ] } ] }, { "uniprot_ac": "Q63117", "gene_name": "Clk3", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63117" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q63117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63117" } ] } ] }, { "uniprot_ac": "Q63184", "gene_name": "Eif2ak2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q63184", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63184" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63184", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63184" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q63184", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63184" } ] } ] }, { "uniprot_ac": "Q63185", "gene_name": "Eif2ak1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63185" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q63185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63185" } ] } ] }, { "uniprot_ac": "Q63285", "gene_name": "Uhmk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63285" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q63285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63285" } ] } ] }, { "uniprot_ac": "Q63433", "gene_name": "Pkn1", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63433", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63433" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q63433", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63433" } ] } ] }, { "uniprot_ac": "Q63450", "gene_name": "Camk1", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63450", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63450" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q63450", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63450" } ] } ] }, { "uniprot_ac": "Q63454", "gene_name": "Mapk4", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63454", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63454" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q63454", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63454" } ] } ] }, { "uniprot_ac": "Q63470", "gene_name": "Dyrk1a", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63470", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63470" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q63470", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63470" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q63470", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63470" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q63470", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63470" } ] } ] }, { "uniprot_ac": "Q63484", "gene_name": "Akt3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63484", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63484" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q63484", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63484" } ] } ] }, { "uniprot_ac": "Q63531", "gene_name": "Rps6ka1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63531", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63531" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q63531", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63531" } ] } ] }, { "uniprot_ac": "Q63538", "gene_name": "Mapk12", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63538", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63538" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q63538", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63538" } ] } ] }, { "uniprot_ac": "Q63553", "gene_name": "Snrk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63553", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63553" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q63553", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63553" } ] } ] }, { "uniprot_ac": "Q63562", "gene_name": "Map3k8", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63562" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q63562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63562" } ] } ] }, { "uniprot_ac": "Q63572", "gene_name": "Tesk1", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63572", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63572" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q63572", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63572" } ] } ] }, { "uniprot_ac": "Q63638", "gene_name": "Speg", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63638" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q63638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63638" } ] } ] }, { "uniprot_ac": "Q63644", "gene_name": "Rock1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63644" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q63644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63644" } ] } ] }, { "uniprot_ac": "Q63686", "gene_name": "Cdk16", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63686" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q63686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63686" } ] } ] }, { "uniprot_ac": "Q63699", "gene_name": "Cdk2", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63699", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63699" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q63699", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63699" } ] } ] }, { "uniprot_ac": "Q63796", "gene_name": "Map3k12", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63796", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63796" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q63796", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63796" } ] } ] }, { "uniprot_ac": "Q63844", "gene_name": "Mapk3", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63844" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q63844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63844" } ] } ] }, { "uniprot_ac": "Q63932", "gene_name": "Map2k2", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63932", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63932" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "Q63932", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63932" } ] } ] }, { "uniprot_ac": "Q63945", "gene_name": "Set", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63945", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63945" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q63945", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63945" } ] } ] }, { "uniprot_ac": "Q641K5", "gene_name": "Nuak1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q641K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q641K5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q641K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q641K5" } ] } ] }, { "uniprot_ac": "Q641Z4", "gene_name": "Cdk9", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q641Z4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q641Z4" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q641Z4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q641Z4" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q641Z4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q641Z4" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q641Z4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q641Z4" } ] } ] }, { "uniprot_ac": "Q64261", "gene_name": "Cdk6", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q64261", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64261" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q64261", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64261" } ] } ] }, { "uniprot_ac": "Q64303", "gene_name": "Pak2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q64303", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64303" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q64303", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64303" } ] } ] }, { "uniprot_ac": "Q64595", "gene_name": "Prkg2", "activity": [ { "ec_number": "2.7.11.12", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q64595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64595" } ] }, { "ec_number": "2.7.11.12", "activity": "", "evidence": [ { "id": "Q64595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64595" } ] } ] }, { "uniprot_ac": "Q64617", "gene_name": "Prkch", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q64617", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64617" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q64617", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64617" } ] } ] }, { "uniprot_ac": "Q64702", "gene_name": "Plk4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q64702", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64702" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q64702", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64702" } ] }, { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q64702", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64702" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "Q64702", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64702" } ] } ] }, { "uniprot_ac": "Q66H84", "gene_name": "Mapkapk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q66H84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H84" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q66H84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H84" } ] } ] }, { "uniprot_ac": "Q66HA1", "gene_name": "Map3k11", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q66HA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HA1" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q66HA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HA1" } ] } ] }, { "uniprot_ac": "Q66HE5", "gene_name": "Nuak2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q66HE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HE5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q66HE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HE5" } ] } ] }, { "uniprot_ac": "Q66HE7", "gene_name": "Cdkl1", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q66HE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HE7" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q66HE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HE7" } ] } ] }, { "uniprot_ac": "Q66L42", "gene_name": "Map3k10", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q66L42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66L42" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q66L42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66L42" } ] } ] }, { "uniprot_ac": "Q69Z98", "gene_name": "Brsk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q69Z98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69Z98" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q69Z98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69Z98" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q69Z98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69Z98" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "Q69Z98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69Z98" } ] } ] }, { "uniprot_ac": "Q69ZA1", "gene_name": "Cdk13", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q69ZA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZA1" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q69ZA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZA1" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q69ZA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZA1" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q69ZA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZA1" } ] } ] }, { "uniprot_ac": "Q69ZM6", "gene_name": "Stk36", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q69ZM6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZM6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q69ZM6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZM6" } ] } ] }, { "uniprot_ac": "Q6A1A2", "gene_name": "PDPK2P", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6A1A2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6A1A2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6A1A2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6A1A2" } ] } ] }, { "uniprot_ac": "Q6B9X6", "gene_name": "vwkA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6B9X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6B9X6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6B9X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6B9X6" } ] } ] }, { "uniprot_ac": "Q6DT37", "gene_name": "CDC42BPG", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6DT37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6DT37" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6DT37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6DT37" } ] } ] }, { "uniprot_ac": "Q6IQ55", "gene_name": "TTBK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6IQ55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IQ55" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6IQ55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IQ55" } ] } ] }, { "uniprot_ac": "Q6P0Q8", "gene_name": "MAST2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6P0Q8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P0Q8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6P0Q8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P0Q8" } ] } ] }, { "uniprot_ac": "Q6P2M8", "gene_name": "PNCK", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6P2M8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P2M8" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q6P2M8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P2M8" } ] } ] }, { "uniprot_ac": "Q6P3R8", "gene_name": "NEK5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6P3R8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P3R8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6P3R8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P3R8" } ] } ] }, { "uniprot_ac": "Q6P4S6", "gene_name": "Sik3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6P4S6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P4S6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6P4S6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P4S6" } ] } ] }, { "uniprot_ac": "Q6P5G0", "gene_name": "Mapk4", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6P5G0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P5G0" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q6P5G0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P5G0" } ] } ] }, { "uniprot_ac": "Q6P5Z2", "gene_name": "PKN3", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6P5Z2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P5Z2" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q6P5Z2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P5Z2" } ] } ] }, { "uniprot_ac": "Q6P9R2", "gene_name": "Oxsr1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6P9R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P9R2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6P9R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P9R2" } ] } ] }, { "uniprot_ac": "Q6PAJ1", "gene_name": "Bcr", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6PAJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PAJ1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6PAJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PAJ1" } ] } ] }, { "uniprot_ac": "Q6PCN3", "gene_name": "Ttbk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6PCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PCN3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6PCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PCN3" } ] } ] }, { "uniprot_ac": "Q6PGN3", "gene_name": "Dclk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6PGN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PGN3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6PGN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PGN3" } ] } ] }, { "uniprot_ac": "Q6PHR2", "gene_name": "ULK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6PHR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PHR2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6PHR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PHR2" } ] } ] }, { "uniprot_ac": "Q6PHZ2", "gene_name": "Camk2d", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6PHZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PHZ2" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q6PHZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PHZ2" } ] } ] }, { "uniprot_ac": "Q6SA08", "gene_name": "TSSK4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6SA08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6SA08" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6SA08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6SA08" } ] } ] }, { "uniprot_ac": "Q6VAB6", "gene_name": "KSR2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6VAB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6VAB6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6VAB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6VAB6" } ] } ] }, { "uniprot_ac": "Q6XHA5", "gene_name": "roco11", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6XHA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XHA5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6XHA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XHA5" } ] } ] }, { "uniprot_ac": "Q6XHA7", "gene_name": "roco9", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6XHA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XHA7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6XHA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XHA7" } ] } ] }, { "uniprot_ac": "Q6XHB2", "gene_name": "roco4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6XHB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XHB2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6XHB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XHB2" } ] } ] }, { "uniprot_ac": "Q6XUX1", "gene_name": "Dstyk", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6XUX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XUX1" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q6XUX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XUX1" } ] } ] }, { "uniprot_ac": "Q6XUX2", "gene_name": "Dstyk", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6XUX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XUX2" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q6XUX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XUX2" } ] } ] }, { "uniprot_ac": "Q6XUX3", "gene_name": "DSTYK", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6XUX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XUX3" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q6XUX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XUX3" } ] } ] }, { "uniprot_ac": "Q6ZMQ8", "gene_name": "AATK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6ZMQ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZMQ8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6ZMQ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZMQ8" } ] } ] }, { "uniprot_ac": "Q6ZN16", "gene_name": "MAP3K15", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6ZN16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZN16" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q6ZN16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZN16" } ] } ] }, { "uniprot_ac": "Q6ZQ29", "gene_name": "Taok2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6ZQ29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZQ29" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6ZQ29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZQ29" } ] } ] }, { "uniprot_ac": "Q6ZWH5", "gene_name": "NEK10", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q6ZWH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZWH5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q6ZWH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZWH5" } ] } ] }, { "uniprot_ac": "Q70PP2", "gene_name": "nonC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q70PP2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q70PP2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q70PP2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q70PP2" } ] } ] }, { "uniprot_ac": "Q75JK0", "gene_name": "zakA", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q75JK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q75JK0" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q75JK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q75JK0" } ] } ] }, { "uniprot_ac": "Q75JN1", "gene_name": "ifkC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q75JN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q75JN1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q75JN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q75JN1" } ] } ] }, { "uniprot_ac": "Q76MJ5", "gene_name": "ERN2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q76MJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76MJ5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q76MJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76MJ5" } ] }, { "ec_number": "3.1.26.-", "activity": "", "evidence": [ { "id": "Q76MJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76MJ5" } ] } ] }, { "uniprot_ac": "Q76NV1", "gene_name": "dyrk1", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q76NV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76NV1" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q76NV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76NV1" } ] } ] }, { "uniprot_ac": "Q76P07", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q76P07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76P07" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q76P07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76P07" } ] } ] }, { "uniprot_ac": "Q7KRY6", "gene_name": "ball", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7KRY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KRY6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7KRY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KRY6" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "Q7KRY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KRY6" } ] } ] }, { "uniprot_ac": "Q7KZI7", "gene_name": "MARK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7KZI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KZI7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7KZI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KZI7" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q7KZI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KZI7" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "Q7KZI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KZI7" } ] } ] }, { "uniprot_ac": "Q7L7X3", "gene_name": "TAOK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7L7X3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7L7X3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7L7X3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7L7X3" } ] } ] }, { "uniprot_ac": "Q7PLI7", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7PLI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7PLI7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7PLI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7PLI7" } ] } ] }, { "uniprot_ac": "Q7TNJ7", "gene_name": "Camk1g", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7TNJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TNJ7" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q7TNJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TNJ7" } ] } ] }, { "uniprot_ac": "Q7TNL3", "gene_name": "Stk40", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7TNL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TNL3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7TNL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TNL3" } ] } ] }, { "uniprot_ac": "Q7TNL4", "gene_name": "Stk40", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7TNL4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TNL4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7TNL4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TNL4" } ] } ] }, { "uniprot_ac": "Q7TPK6", "gene_name": "Wnk4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7TPK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TPK6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7TPK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TPK6" } ] } ] }, { "uniprot_ac": "Q7TPS0", "gene_name": "Rps6ka6", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7TPS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TPS0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7TPS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TPS0" } ] } ] }, { "uniprot_ac": "Q7TQP6", "gene_name": "Tnni3k", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7TQP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQP6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7TQP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQP6" } ] } ] }, { "uniprot_ac": "Q7TSC3", "gene_name": "Nek5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7TSC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TSC3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7TSC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TSC3" } ] } ] }, { "uniprot_ac": "Q7TSE6", "gene_name": "Stk38l", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7TSE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TSE6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7TSE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TSE6" } ] } ] }, { "uniprot_ac": "Q7TSJ6", "gene_name": "Lats2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7TSJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TSJ6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7TSJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TSJ6" } ] } ] }, { "uniprot_ac": "Q7TT49", "gene_name": "Cdc42bpb", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7TT49", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT49" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7TT49", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT49" } ] } ] }, { "uniprot_ac": "Q7TT50", "gene_name": "Cdc42bpb", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7TT50", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT50" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7TT50", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT50" } ] } ] }, { "uniprot_ac": "Q7Z2Y5", "gene_name": "NRK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q7Z2Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z2Y5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q7Z2Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z2Y5" } ] } ] }, { "uniprot_ac": "Q80TR8", "gene_name": "Dcaf1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80TR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80TR8" } ] } ] }, { "uniprot_ac": "Q80UE6", "gene_name": "Wnk4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80UE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UE6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q80UE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UE6" } ] } ] }, { "uniprot_ac": "Q80UV9", "gene_name": "Taf1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80UV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UV9" } ] }, { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q80UV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UV9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q80UV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UV9" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q80UV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UV9" } ] } ] }, { "uniprot_ac": "Q80UW5", "gene_name": "Cdc42bpg", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80UW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UW5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q80UW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UW5" } ] } ] }, { "uniprot_ac": "Q80X41", "gene_name": "Vrk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80X41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X41" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q80X41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X41" } ] } ] }, { "uniprot_ac": "Q80XI6", "gene_name": "Map3k11", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80XI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80XI6" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q80XI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80XI6" } ] } ] }, { "uniprot_ac": "Q80XP9", "gene_name": "Wnk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80XP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80XP9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q80XP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80XP9" } ] } ] }, { "uniprot_ac": "Q80Y86", "gene_name": "Mapk15", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80Y86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80Y86" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q80Y86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80Y86" } ] } ] }, { "uniprot_ac": "Q80YE4", "gene_name": "Aatk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80YE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80YE4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q80YE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80YE4" } ] } ] }, { "uniprot_ac": "Q80YE7", "gene_name": "Dapk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80YE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80YE7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q80YE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80YE7" } ] } ] }, { "uniprot_ac": "Q80YP0", "gene_name": "Cdk3", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80YP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80YP0" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q80YP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80YP0" } ] } ] }, { "uniprot_ac": "Q80ZF4", "gene_name": "Mapkapk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80ZF4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZF4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q80ZF4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZF4" } ] } ] }, { "uniprot_ac": "Q80ZW0", "gene_name": "Stk35", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80ZW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZW0" } ] } ] }, { "uniprot_ac": "Q810W7", "gene_name": "Mast1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q810W7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810W7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q810W7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810W7" } ] } ] }, { "uniprot_ac": "Q811L6", "gene_name": "Mast4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q811L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q811L6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q811L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q811L6" } ] } ] }, { "uniprot_ac": "Q869L4", "gene_name": "fnkA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q869L4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869L4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q869L4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869L4" } ] } ] }, { "uniprot_ac": "Q869N2", "gene_name": "pakB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q869N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869N2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q869N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869N2" } ] } ] }, { "uniprot_ac": "Q869T7", "gene_name": "pakF", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q869T7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869T7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q869T7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869T7" } ] } ] }, { "uniprot_ac": "Q869X3", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q869X3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869X3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q869X3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869X3" } ] } ] }, { "uniprot_ac": "Q86A12", "gene_name": "sky1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86A12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86A12" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86A12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86A12" } ] } ] }, { "uniprot_ac": "Q86AE1", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86AE1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AE1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86AE1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AE1" } ] } ] }, { "uniprot_ac": "Q86AT8", "gene_name": "spkA-1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86AT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AT8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86AT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AT8" } ] } ] }, { "uniprot_ac": "Q86C65", "gene_name": "tor", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86C65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86C65" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86C65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86C65" } ] } ] }, { "uniprot_ac": "Q86CS2", "gene_name": "atg1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86CS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86CS2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86CS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86CS2" } ] } ] }, { "uniprot_ac": "Q86HG9", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86HG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86HG9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86HG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86HG9" } ] } ] }, { "uniprot_ac": "Q86HN7", "gene_name": "PLK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86HN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86HN7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86HN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86HN7" } ] } ] }, { "uniprot_ac": "Q86HW6", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86HW6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86HW6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86HW6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86HW6" } ] } ] }, { "uniprot_ac": "Q86I06", "gene_name": "nek3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86I06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86I06" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86I06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86I06" } ] } ] }, { "uniprot_ac": "Q86IX1", "gene_name": "dst1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86IX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86IX1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86IX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86IX1" } ] } ] }, { "uniprot_ac": "Q86SG6", "gene_name": "NEK8", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86SG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86SG6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86SG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86SG6" } ] } ] }, { "uniprot_ac": "Q86TB3", "gene_name": "ALPK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86TB3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86TB3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86TB3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86TB3" } ] } ] }, { "uniprot_ac": "Q86UE8", "gene_name": "TLK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86UE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86UE8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86UE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86UE8" } ] } ] }, { "uniprot_ac": "Q86UX6", "gene_name": "STK32C", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86UX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86UX6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86UX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86UX6" } ] } ] }, { "uniprot_ac": "Q86V86", "gene_name": "PIM3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86V86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86V86" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86V86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86V86" } ] } ] }, { "uniprot_ac": "Q86Y07", "gene_name": "VRK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86Y07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86Y07" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86Y07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86Y07" } ] } ] }, { "uniprot_ac": "Q86YV6", "gene_name": "MYLK4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86YV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86YV6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86YV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86YV6" } ] } ] }, { "uniprot_ac": "Q86Z02", "gene_name": "HIPK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q86Z02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86Z02" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q86Z02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86Z02" } ] } ] }, { "uniprot_ac": "Q8BG41", "gene_name": "Psmb11", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "Q8BG41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BG41" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "Q8BG41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BG41" } ] } ] }, { "uniprot_ac": "Q8BG48", "gene_name": "Stk17b", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BG48", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BG48" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BG48", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BG48" } ] } ] }, { "uniprot_ac": "Q8BGW6", "gene_name": "Stk32a", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BGW6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGW6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BGW6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGW6" } ] } ] }, { "uniprot_ac": "Q8BHI9", "gene_name": "Nim1k", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BHI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BHI9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BHI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BHI9" } ] } ] }, { "uniprot_ac": "Q8BI55", "gene_name": "Dyrk4", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BI55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BI55" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q8BI55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BI55" } ] } ] }, { "uniprot_ac": "Q8BK63", "gene_name": "Csnk1a1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BK63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BK63" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BK63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BK63" } ] } ] }, { "uniprot_ac": "Q8BKX6", "gene_name": "Smg1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BKX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BKX6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BKX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BKX6" } ] } ] }, { "uniprot_ac": "Q8BLF2", "gene_name": "Cdkl3", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BLF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BLF2" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q8BLF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BLF2" } ] } ] }, { "uniprot_ac": "Q8BLK9", "gene_name": "Rps6kc1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BLK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BLK9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BLK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BLK9" } ] } ] }, { "uniprot_ac": "Q8BN21", "gene_name": "Vrk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BN21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BN21" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BN21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BN21" } ] } ] }, { "uniprot_ac": "Q8BPM2", "gene_name": "Map4k5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BPM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BPM2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BPM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BPM2" } ] } ] }, { "uniprot_ac": "Q8BRK8", "gene_name": "Prkaa2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BRK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BRK8" } ] }, { "ec_number": "2.7.11.27", "activity": "ATP + L-seryl-[acetyl-CoA carboxylase] = ADP + H(+) + O-phospho-L-seryl-[acetyl-CoA carboxylase].", "evidence": [ { "id": "Q8BRK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BRK8" } ] }, { "ec_number": "2.7.11.31", "activity": "ATP + L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase] = ADP + H(+) + O-phospho-L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase].", "evidence": [ { "id": "Q8BRK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BRK8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BRK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BRK8" } ] } ] }, { "uniprot_ac": "Q8BSK8", "gene_name": "Rps6kb1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BSK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BSK8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BSK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BSK8" } ] } ] }, { "uniprot_ac": "Q8BTH8", "gene_name": "Csnk1g1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BTH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTH8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BTH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTH8" } ] } ] }, { "uniprot_ac": "Q8BTI9", "gene_name": "Pik3cb", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BTI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTI9" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q8BTI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTI9" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "Q8BTI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTI9" } ] } ] }, { "uniprot_ac": "Q8BTW9", "gene_name": "Pak4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BTW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTW9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BTW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTW9" } ] } ] }, { "uniprot_ac": "Q8BVP5", "gene_name": "Csnk1g2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BVP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BVP5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BVP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BVP5" } ] } ] }, { "uniprot_ac": "Q8BW96", "gene_name": "Camk1d", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BW96" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q8BW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BW96" } ] } ] }, { "uniprot_ac": "Q8BWD8", "gene_name": "Cdk19", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BWD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWD8" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q8BWD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWD8" } ] } ] }, { "uniprot_ac": "Q8BWQ5", "gene_name": "Dclk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BWQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWQ5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BWQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWQ5" } ] } ] }, { "uniprot_ac": "Q8BWW9", "gene_name": "Pkn2", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BWW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWW9" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q8BWW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWW9" } ] } ] }, { "uniprot_ac": "Q8BYC6", "gene_name": "Taok3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BYC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYC6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BYC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYC6" } ] } ] }, { "uniprot_ac": "Q8BYR2", "gene_name": "Lats1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BYR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYR2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BYR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYR2" } ] } ] }, { "uniprot_ac": "Q8BZ03", "gene_name": "Prkd2", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BZ03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ03" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q8BZ03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ03" } ] } ] }, { "uniprot_ac": "Q8BZ25", "gene_name": "Ankk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BZ25", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ25" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BZ25", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ25" } ] } ] }, { "uniprot_ac": "Q8BZN4", "gene_name": "Nuak2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BZN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZN4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8BZN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZN4" } ] } ] }, { "uniprot_ac": "Q8C015", "gene_name": "Pak5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8C015", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C015" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8C015", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C015" } ] } ] }, { "uniprot_ac": "Q8C050", "gene_name": "Rps6ka5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8C050", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C050" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8C050", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C050" } ] } ] }, { "uniprot_ac": "Q8C078", "gene_name": "Camkk2", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8C078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C078" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q8C078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C078" } ] } ] }, { "uniprot_ac": "Q8C0N0", "gene_name": "Gm4922", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8C0N0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0N0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8C0N0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0N0" } ] } ] }, { "uniprot_ac": "Q8C0P0", "gene_name": "Mastl", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8C0P0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0P0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8C0P0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0P0" } ] } ] }, { "uniprot_ac": "Q8C0Q4", "gene_name": "Nek11", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8C0Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0Q4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8C0Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0Q4" } ] } ] }, { "uniprot_ac": "Q8C0V0", "gene_name": "Tlk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8C0V0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0V0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8C0V0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0V0" } ] } ] }, { "uniprot_ac": "Q8C0V7", "gene_name": "Stk-ps2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8C0V7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0V7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8C0V7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0V7" } ] } ] }, { "uniprot_ac": "Q8C0X8", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8C0X8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0X8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8C0X8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0X8" } ] } ] }, { "uniprot_ac": "Q8C1R0", "gene_name": "Tssk5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8C1R0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C1R0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8C1R0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C1R0" } ] } ] }, { "uniprot_ac": "Q8C4X2", "gene_name": "Csnk1g3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8C4X2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C4X2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8C4X2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C4X2" } ] } ] }, { "uniprot_ac": "Q8CDB0", "gene_name": "Mknk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8CDB0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CDB0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8CDB0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CDB0" } ] } ] }, { "uniprot_ac": "Q8CE90", "gene_name": "Map2k7", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8CE90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE90" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "Q8CE90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE90" } ] } ] }, { "uniprot_ac": "Q8CEE6", "gene_name": "Pask", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8CEE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CEE6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8CEE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CEE6" } ] } ] }, { "uniprot_ac": "Q8CEQ0", "gene_name": "Cdkl1", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8CEQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CEQ0" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q8CEQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CEQ0" } ] } ] }, { "uniprot_ac": "Q8CFH6", "gene_name": "Sik2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8CFH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFH6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8CFH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFH6" } ] } ] }, { "uniprot_ac": "Q8CIN4", "gene_name": "Pak2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8CIN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIN4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8CIN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIN4" } ] } ] }, { "uniprot_ac": "Q8CIP4", "gene_name": "Mark4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8CIP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIP4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8CIP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIP4" } ] } ] }, { "uniprot_ac": "Q8CIR4", "gene_name": "Trpm6", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8CIR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIR4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8CIR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIR4" } ] } ] }, { "uniprot_ac": "Q8IMC6", "gene_name": "Asator", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8IMC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IMC6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8IMC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IMC6" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "Q8IMC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IMC6" } ] } ] }, { "uniprot_ac": "Q8INB9", "gene_name": "Akt", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8INB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8INB9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8INB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8INB9" } ] } ] }, { "uniprot_ac": "Q8IR79", "gene_name": "LIMK1", "activity": [ { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "Q8IR79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IR79" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8IR79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IR79" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8IR79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IR79" } ] } ] }, { "uniprot_ac": "Q8IU85", "gene_name": "CAMK1D", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8IU85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IU85" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q8IU85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IU85" } ] } ] }, { "uniprot_ac": "Q8IVH8", "gene_name": "MAP4K3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8IVH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IVH8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8IVH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IVH8" } ] } ] }, { "uniprot_ac": "Q8IVT5", "gene_name": "KSR1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8IVT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IVT5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8IVT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IVT5" } ] } ] }, { "uniprot_ac": "Q8IVW4", "gene_name": "CDKL3", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8IVW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IVW4" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q8IVW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IVW4" } ] } ] }, { "uniprot_ac": "Q8IW41", "gene_name": "MAPKAPK5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8IW41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IW41" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8IW41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IW41" } ] } ] }, { "uniprot_ac": "Q8IWQ3", "gene_name": "BRSK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8IWQ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWQ3" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q8IWQ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWQ3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8IWQ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWQ3" } ] } ] }, { "uniprot_ac": "Q8IWU2", "gene_name": "LMTK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8IWU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWU2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8IWU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWU2" } ] } ] }, { "uniprot_ac": "Q8IXL6", "gene_name": "FAM20C", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8IXL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IXL6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8IXL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IXL6" } ] } ] }, { "uniprot_ac": "Q8IY84", "gene_name": "NIM1K", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8IY84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IY84" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8IY84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IY84" } ] } ] }, { "uniprot_ac": "Q8IYT8", "gene_name": "ULK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8IYT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IYT8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8IYT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IYT8" } ] } ] }, { "uniprot_ac": "Q8IZL9", "gene_name": "CDK20", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8IZL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IZL9" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q8IZL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IZL9" } ] } ] }, { "uniprot_ac": "Q8K045", "gene_name": "Pkn3", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8K045", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K045" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q8K045", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K045" } ] } ] }, { "uniprot_ac": "Q8K0D0", "gene_name": "Cdk17", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8K0D0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K0D0" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q8K0D0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K0D0" } ] } ] }, { "uniprot_ac": "Q8K1R7", "gene_name": "Nek9", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8K1R7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1R7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8K1R7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1R7" } ] } ] }, { "uniprot_ac": "Q8K1Y2", "gene_name": "Prkd3", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8K1Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1Y2" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q8K1Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1Y2" } ] } ] }, { "uniprot_ac": "Q8K3H5", "gene_name": "Myo3a", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8K3H5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3H5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8K3H5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3H5" } ] } ] }, { "uniprot_ac": "Q8MVR1", "gene_name": "gbpC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8MVR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MVR1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8MVR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MVR1" } ] } ] }, { "uniprot_ac": "Q8MYF1", "gene_name": "", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8MYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MYF1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8MYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MYF1" } ] } ] }, { "uniprot_ac": "Q8N165", "gene_name": "PDIK1L", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8N165", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N165" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8N165", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N165" } ] } ] }, { "uniprot_ac": "Q8N2I9", "gene_name": "STK40", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8N2I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N2I9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8N2I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N2I9" } ] } ] }, { "uniprot_ac": "Q8N4C8", "gene_name": "MINK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8N4C8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N4C8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8N4C8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N4C8" } ] } ] }, { "uniprot_ac": "Q8N568", "gene_name": "DCLK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8N568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N568" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8N568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N568" } ] } ] }, { "uniprot_ac": "Q8N5S9", "gene_name": "CAMKK1", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8N5S9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N5S9" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q8N5S9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N5S9" } ] } ] }, { "uniprot_ac": "Q8N752", "gene_name": "CSNK1A1L", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8N752", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N752" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8N752", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N752" } ] } ] }, { "uniprot_ac": "Q8NE63", "gene_name": "HIPK4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8NE63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NE63" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8NE63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NE63" } ] } ] }, { "uniprot_ac": "Q8NEV1", "gene_name": "CSNK2A3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8NEV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEV1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8NEV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEV1" } ] } ] }, { "uniprot_ac": "Q8NEV4", "gene_name": "MYO3A", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8NEV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEV4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8NEV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEV4" } ] } ] }, { "uniprot_ac": "Q8NFD2", "gene_name": "ANKK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8NFD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NFD2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8NFD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NFD2" } ] } ] }, { "uniprot_ac": "Q8NG66", "gene_name": "NEK11", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8NG66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NG66" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8NG66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NG66" } ] } ] }, { "uniprot_ac": "Q8QZR7", "gene_name": "Pdik1l", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8QZR7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8QZR7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8QZR7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8QZR7" } ] } ] }, { "uniprot_ac": "Q8QZV4", "gene_name": "Stk32c", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8QZV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8QZV4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8QZV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8QZV4" } ] } ] }, { "uniprot_ac": "Q8QZX0", "gene_name": "Sbk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8QZX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8QZX0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8QZX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8QZX0" } ] } ] }, { "uniprot_ac": "Q8R2S1", "gene_name": "Rps6kl1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8R2S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R2S1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8R2S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R2S1" } ] } ] }, { "uniprot_ac": "Q8R3L8", "gene_name": "Cdk8", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8R3L8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3L8" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q8R3L8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3L8" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q8R3L8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3L8" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q8R3L8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3L8" } ] } ] }, { "uniprot_ac": "Q8R4K2", "gene_name": "Irak4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8R4K2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4K2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8R4K2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4K2" } ] } ] }, { "uniprot_ac": "Q8R4U9", "gene_name": "Sgk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8R4U9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4U9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8R4U9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4U9" } ] } ] }, { "uniprot_ac": "Q8R4V0", "gene_name": "Sgk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8R4V0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4V0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8R4V0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4V0" } ] } ] }, { "uniprot_ac": "Q8SSS9", "gene_name": "qkgA-2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8SSS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SSS9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8SSS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SSS9" } ] } ] }, { "uniprot_ac": "Q8SSV3", "gene_name": "mkcD", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8SSV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SSV3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8SSV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SSV3" } ] } ] }, { "uniprot_ac": "Q8SSY6", "gene_name": "", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8SSY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SSY6" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8SSY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SSY6" } ] } ] }, { "uniprot_ac": "Q8T0S6", "gene_name": "hpo", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8T0S6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T0S6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8T0S6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T0S6" } ] } ] }, { "uniprot_ac": "Q8T2I8", "gene_name": "sepA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8T2I8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T2I8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8T2I8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T2I8" } ] } ] }, { "uniprot_ac": "Q8T9L5", "gene_name": "Lkb1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8T9L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T9L5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8T9L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T9L5" } ] } ] }, { "uniprot_ac": "Q8TAS1", "gene_name": "UHMK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8TAS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TAS1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8TAS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TAS1" } ] } ] }, { "uniprot_ac": "Q8TD08", "gene_name": "MAPK15", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8TD08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TD08" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q8TD08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TD08" } ] } ] }, { "uniprot_ac": "Q8TD19", "gene_name": "NEK9", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8TD19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TD19" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8TD19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TD19" } ] } ] }, { "uniprot_ac": "Q8TDC3", "gene_name": "BRSK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8TDC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TDC3" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q8TDC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TDC3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8TDC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TDC3" } ] } ] }, { "uniprot_ac": "Q8TDR2", "gene_name": "STK35", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8TDR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TDR2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8TDR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TDR2" } ] } ] }, { "uniprot_ac": "Q8TDX7", "gene_name": "NEK7", "activity": [ { "ec_number": "2.7.11.34", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8TDX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TDX7" } ] }, { "ec_number": "2.7.11.34", "activity": "", "evidence": [ { "id": "Q8TDX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TDX7" } ] } ] }, { "uniprot_ac": "Q8TF76", "gene_name": "HASPIN", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8TF76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TF76" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8TF76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TF76" } ] } ] }, { "uniprot_ac": "Q8VBY2", "gene_name": "Camkk1", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8VBY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VBY2" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q8VBY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VBY2" } ] } ] }, { "uniprot_ac": "Q8VCT9", "gene_name": "Tesk2", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8VCT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCT9" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q8VCT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCT9" } ] } ] }, { "uniprot_ac": "Q8VD65", "gene_name": "Pik3r4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8VD65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VD65" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8VD65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VD65" } ] } ] }, { "uniprot_ac": "Q8VDF3", "gene_name": "Dapk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8VDF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDF3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8VDF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDF3" } ] } ] }, { "uniprot_ac": "Q8VDG6", "gene_name": "Map3k21", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8VDG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDG6" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q8VDG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDG6" } ] } ] }, { "uniprot_ac": "Q8VDU5", "gene_name": "Snrk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8VDU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDU5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8VDU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDU5" } ] } ] }, { "uniprot_ac": "Q8VHF0", "gene_name": "Mark3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8VHF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHF0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8VHF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHF0" } ] } ] }, { "uniprot_ac": "Q8VHJ5", "gene_name": "Mark1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8VHJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHJ5" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q8VHJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHJ5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8VHJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHJ5" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "Q8VHJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHJ5" } ] } ] }, { "uniprot_ac": "Q8WU08", "gene_name": "STK32A", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8WU08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WU08" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8WU08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WU08" } ] } ] }, { "uniprot_ac": "Q8WXR4", "gene_name": "MYO3B", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8WXR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WXR4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8WXR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WXR4" } ] } ] }, { "uniprot_ac": "Q8WZ42", "gene_name": "TTN", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8WZ42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WZ42" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q8WZ42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WZ42" } ] } ] }, { "uniprot_ac": "Q91VB2", "gene_name": "Camk1g", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q91VB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VB2" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q91VB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VB2" } ] } ] }, { "uniprot_ac": "Q91VJ4", "gene_name": "Stk38", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q91VJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VJ4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q91VJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VJ4" } ] } ] }, { "uniprot_ac": "Q91XS8", "gene_name": "Stk17b", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q91XS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XS8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q91XS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XS8" } ] } ] }, { "uniprot_ac": "Q91Y86", "gene_name": "Mapk8", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q91Y86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Y86" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q91Y86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Y86" } ] } ] }, { "uniprot_ac": "Q91YA2", "gene_name": "Pskh1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q91YA2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YA2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q91YA2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YA2" } ] } ] }, { "uniprot_ac": "Q91YS8", "gene_name": "Camk1", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q91YS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YS8" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q91YS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YS8" } ] } ] }, { "uniprot_ac": "Q91Z96", "gene_name": "Bmp2k", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q91Z96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z96" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q91Z96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z96" } ] } ] }, { "uniprot_ac": "Q91ZB0", "gene_name": "Alpk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q91ZB0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZB0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q91ZB0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZB0" } ] } ] }, { "uniprot_ac": "Q91ZN7", "gene_name": "Chek1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q91ZN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZN7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q91ZN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZN7" } ] }, { "ec_number": "2.4.99.18", "activity": "a dolichyl diphosphooligosaccharide + L-asparaginyl-[protein] = a dolichyl diphosphate + H(+) + N(4)-(oligosaccharide-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl)-L-asparaginy-[protein].", "evidence": [ { "id": "Q91ZN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZN7" } ] }, { "ec_number": "2.4.99.18", "activity": "", "evidence": [ { "id": "Q91ZN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZN7" } ] } ] }, { "uniprot_ac": "Q91ZR4", "gene_name": "Nek8", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q91ZR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZR4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q91ZR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZR4" } ] } ] }, { "uniprot_ac": "Q91ZW3", "gene_name": "Smarca5", "activity": [ { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "Q91ZW3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZW3" } ] } ] }, { "uniprot_ac": "Q922Q2", "gene_name": "Riok1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q922Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922Q2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q922Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922Q2" } ] }, { "ec_number": "3.6.3.-", "activity": "", "evidence": [ { "id": "Q922Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922Q2" } ] } ] }, { "uniprot_ac": "Q922R0", "gene_name": "Prkx", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q922R0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922R0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q922R0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922R0" } ] } ] }, { "uniprot_ac": "Q922Y0", "gene_name": "Dyrk3", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q922Y0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922Y0" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q922Y0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922Y0" } ] } ] }, { "uniprot_ac": "Q923J1", "gene_name": "Trpm7", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q923J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q923J1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q923J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q923J1" } ] } ] }, { "uniprot_ac": "Q923T9", "gene_name": "Camk2g", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q923T9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q923T9" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q923T9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q923T9" } ] } ] }, { "uniprot_ac": "Q924C5", "gene_name": "Alpk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q924C5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924C5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q924C5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924C5" } ] } ] }, { "uniprot_ac": "Q924I2", "gene_name": "Map4k3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q924I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924I2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q924I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924I2" } ] } ] }, { "uniprot_ac": "Q924U5", "gene_name": "Tesk2", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q924U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924U5" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q924U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924U5" } ] } ] }, { "uniprot_ac": "Q924X7", "gene_name": "Stk33", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q924X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924X7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q924X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924X7" } ] } ] }, { "uniprot_ac": "Q925B3", "gene_name": "Trpm7", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q925B3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q925B3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q925B3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q925B3" } ] } ] }, { "uniprot_ac": "Q925K9", "gene_name": "Tssk6", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q925K9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q925K9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q925K9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q925K9" } ] } ] }, { "uniprot_ac": "Q92630", "gene_name": "DYRK2", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q92630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92630" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q92630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92630" } ] } ] }, { "uniprot_ac": "Q92772", "gene_name": "CDKL2", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q92772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92772" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q92772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92772" } ] } ] }, { "uniprot_ac": "Q92918", "gene_name": "MAP4K1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q92918", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92918" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q92918", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92918" } ] } ] }, { "uniprot_ac": "Q94533", "gene_name": "S6k", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q94533", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94533" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q94533", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94533" } ] } ] }, { "uniprot_ac": "Q95UN8", "gene_name": "slpr", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q95UN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95UN8" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q95UN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95UN8" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "Q95UN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95UN8" } ] } ] }, { "uniprot_ac": "Q95YH0", "gene_name": "cdk8", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q95YH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95YH0" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q95YH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95YH0" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q95YH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95YH0" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q95YH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95YH0" } ] } ] }, { "uniprot_ac": "Q96BR1", "gene_name": "SGK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96BR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96BR1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96BR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96BR1" } ] } ] }, { "uniprot_ac": "Q96C45", "gene_name": "ULK4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96C45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96C45" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96C45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96C45" } ] } ] }, { "uniprot_ac": "Q96GD4", "gene_name": "AURKB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96GD4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96GD4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96GD4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96GD4" } ] } ] }, { "uniprot_ac": "Q96GX5", "gene_name": "MASTL", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96GX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96GX5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96GX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96GX5" } ] } ] }, { "uniprot_ac": "Q96J92", "gene_name": "WNK4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96J92", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J92" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96J92", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J92" } ] } ] }, { "uniprot_ac": "Q96KB5", "gene_name": "PBK", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96KB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96KB5" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "Q96KB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96KB5" } ] } ] }, { "uniprot_ac": "Q96L34", "gene_name": "MARK4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96L34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96L34" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96L34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96L34" } ] } ] }, { "uniprot_ac": "Q96L96", "gene_name": "ALPK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96L96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96L96" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96L96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96L96" } ] } ] }, { "uniprot_ac": "Q96LW2", "gene_name": "RSKR", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96LW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96LW2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96LW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96LW2" } ] } ] }, { "uniprot_ac": "Q96NX5", "gene_name": "CAMK1G", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96NX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96NX5" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q96NX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96NX5" } ] } ] }, { "uniprot_ac": "Q96PF2", "gene_name": "TSSK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96PF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PF2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96PF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PF2" } ] } ] }, { "uniprot_ac": "Q96PN8", "gene_name": "TSSK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96PN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PN8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96PN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PN8" } ] } ] }, { "uniprot_ac": "Q96PY6", "gene_name": "NEK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96PY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PY6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96PY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PY6" } ] } ] }, { "uniprot_ac": "Q96Q04", "gene_name": "LMTK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96Q04", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96Q04" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96Q04", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96Q04" } ] } ] }, { "uniprot_ac": "Q96Q15", "gene_name": "SMG1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96Q15", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96Q15" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96Q15", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96Q15" } ] } ] }, { "uniprot_ac": "Q96Q40", "gene_name": "CDK15", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96Q40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96Q40" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q96Q40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96Q40" } ] } ] }, { "uniprot_ac": "Q96QP1", "gene_name": "ALPK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96QP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96QP1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96QP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96QP1" } ] } ] }, { "uniprot_ac": "Q96QS6", "gene_name": "PSKH2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96QS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96QS6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96QS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96QS6" } ] } ] }, { "uniprot_ac": "Q96QT4", "gene_name": "TRPM7", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96QT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96QT4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96QT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96QT4" } ] } ] }, { "uniprot_ac": "Q96RG2", "gene_name": "PASK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96RG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96RG2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96RG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96RG2" } ] } ] }, { "uniprot_ac": "Q96RR4", "gene_name": "CAMKK2", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96RR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96RR4" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q96RR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96RR4" } ] } ] }, { "uniprot_ac": "Q96S38", "gene_name": "RPS6KC1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96S38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96S38" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96S38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96S38" } ] } ] }, { "uniprot_ac": "Q96S44", "gene_name": "TP53RK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96S44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96S44" } ] }, { "ec_number": "3.6.-.-", "activity": "", "evidence": [ { "id": "Q96S44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96S44" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96S44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96S44" } ] } ] }, { "uniprot_ac": "Q96S53", "gene_name": "TESK2", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96S53", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96S53" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q96S53", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96S53" } ] } ] }, { "uniprot_ac": "Q96SB4", "gene_name": "SRPK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q96SB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96SB4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q96SB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96SB4" } ] } ] }, { "uniprot_ac": "Q99558", "gene_name": "MAP3K14", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99558", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99558" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q99558", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99558" } ] } ] }, { "uniprot_ac": "Q99570", "gene_name": "PIK3R4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99570" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q99570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99570" } ] } ] }, { "uniprot_ac": "Q99640", "gene_name": "PKMYT1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99640", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99640" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q99640", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99640" } ] } ] }, { "uniprot_ac": "Q99683", "gene_name": "MAP3K5", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99683", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99683" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q99683", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99683" } ] } ] }, { "uniprot_ac": "Q99759", "gene_name": "MAP3K3", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99759", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99759" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q99759", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99759" } ] } ] }, { "uniprot_ac": "Q99986", "gene_name": "VRK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99986", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99986" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q99986", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99986" } ] } ] }, { "uniprot_ac": "Q99J82", "gene_name": "Ilk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99J82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99J82" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q99J82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99J82" } ] } ] }, { "uniprot_ac": "Q99J95", "gene_name": "Cdk9", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99J95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99J95" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q99J95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99J95" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q99J95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99J95" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q99J95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99J95" } ] } ] }, { "uniprot_ac": "Q99JP0", "gene_name": "Map4k3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99JP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JP0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q99JP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JP0" } ] } ] }, { "uniprot_ac": "Q99JT2", "gene_name": "Stk26", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99JT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JT2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q99JT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JT2" } ] } ] }, { "uniprot_ac": "Q99KH8", "gene_name": "Stk24", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99KH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99KH8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q99KH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99KH8" } ] } ] }, { "uniprot_ac": "Q99KY4", "gene_name": "Gak", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99KY4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99KY4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q99KY4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99KY4" } ] } ] }, { "uniprot_ac": "Q99MQ3", "gene_name": "Pink1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99MQ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MQ3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q99MQ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MQ3" } ] } ] }, { "uniprot_ac": "Q99MW1", "gene_name": "Stk31", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99MW1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MW1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q99MW1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MW1" } ] } ] }, { "uniprot_ac": "Q99N57", "gene_name": "Raf1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99N57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99N57" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q99N57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99N57" } ] } ] }, { "uniprot_ac": "Q99PW4", "gene_name": "Tp53rkb", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99PW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PW4" } ] }, { "ec_number": "3.6.-.-", "activity": "", "evidence": [ { "id": "Q99PW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PW4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q99PW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PW4" } ] } ] }, { "uniprot_ac": "Q9BQI3", "gene_name": "EIF2AK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9BQI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BQI3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9BQI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BQI3" } ] } ] }, { "uniprot_ac": "Q9BRS2", "gene_name": "RIOK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9BRS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BRS2" } ] }, { "ec_number": "3.6.3.-", "activity": "", "evidence": [ { "id": "Q9BRS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BRS2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9BRS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BRS2" } ] } ] }, { "uniprot_ac": "Q9BUB5", "gene_name": "MKNK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9BUB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BUB5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9BUB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BUB5" } ] } ] }, { "uniprot_ac": "Q9BVS4", "gene_name": "RIOK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9BVS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BVS4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9BVS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BVS4" } ] } ] }, { "uniprot_ac": "Q9BWU1", "gene_name": "CDK19", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9BWU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BWU1" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q9BWU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BWU1" } ] } ] }, { "uniprot_ac": "Q9BX84", "gene_name": "TRPM6", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9BX84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BX84" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9BX84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BX84" } ] } ] }, { "uniprot_ac": "Q9BXA6", "gene_name": "TSSK6", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9BXA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXA6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9BXA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXA6" } ] } ] }, { "uniprot_ac": "Q9BXA7", "gene_name": "TSSK1B", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9BXA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXA7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9BXA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXA7" } ] } ] }, { "uniprot_ac": "Q9BXM7", "gene_name": "PINK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9BXM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXM7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9BXM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXM7" } ] } ] }, { "uniprot_ac": "Q9BXU1", "gene_name": "STK31", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9BXU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXU1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9BXU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXU1" } ] } ] }, { "uniprot_ac": "Q9BYP7", "gene_name": "WNK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9BYP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYP7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9BYP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYP7" } ] } ] }, { "uniprot_ac": "Q9BYT3", "gene_name": "STK33", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9BYT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYT3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9BYT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYT3" } ] } ] }, { "uniprot_ac": "Q9BZL6", "gene_name": "PRKD2", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9BZL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZL6" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q9BZL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZL6" } ] } ] }, { "uniprot_ac": "Q9C098", "gene_name": "DCLK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9C098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C098" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9C098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C098" } ] } ] }, { "uniprot_ac": "Q9CQS5", "gene_name": "Riok2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9CQS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQS5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9CQS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQS5" } ] } ] }, { "uniprot_ac": "Q9CXB8", "gene_name": "Alpk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9CXB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CXB8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9CXB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CXB8" } ] } ] }, { "uniprot_ac": "Q9D2E1", "gene_name": "Tssk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9D2E1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2E1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9D2E1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2E1" } ] } ] }, { "uniprot_ac": "Q9D411", "gene_name": "Tssk4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9D411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D411" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9D411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D411" } ] } ] }, { "uniprot_ac": "Q9DBU3", "gene_name": "Riok3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9DBU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBU3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9DBU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBU3" } ] } ] }, { "uniprot_ac": "Q9DC28", "gene_name": "Csnk1d", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9DC28", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DC28" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q9DC28", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DC28" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9DC28", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DC28" } ] } ] }, { "uniprot_ac": "Q9EQY0", "gene_name": "Ern1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9EQY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQY0" } ] }, { "ec_number": "3.1.26.-", "activity": "", "evidence": [ { "id": "Q9EQY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQY0" } ] } ] }, { "uniprot_ac": "Q9ERE3", "gene_name": "Sgk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9ERE3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERE3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9ERE3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERE3" } ] } ] }, { "uniprot_ac": "Q9ERH7", "gene_name": "Hipk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9ERH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERH7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9ERH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERH7" } ] } ] }, { "uniprot_ac": "Q9ERK0", "gene_name": "Ripk4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9ERK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERK0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9ERK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERK0" } ] } ] }, { "uniprot_ac": "Q9ES70", "gene_name": "Nek6", "activity": [ { "ec_number": "2.7.11.34", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9ES70", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ES70" } ] }, { "ec_number": "2.7.11.34", "activity": "", "evidence": [ { "id": "Q9ES70", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ES70" } ] } ] }, { "uniprot_ac": "Q9ES74", "gene_name": "Nek7", "activity": [ { "ec_number": "2.7.11.34", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9ES74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ES74" } ] }, { "ec_number": "2.7.11.34", "activity": "", "evidence": [ { "id": "Q9ES74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ES74" } ] } ] }, { "uniprot_ac": "Q9ESG9", "gene_name": "Pkmyt1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9ESG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESG9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9ESG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESG9" } ] } ] }, { "uniprot_ac": "Q9ESL4", "gene_name": "Map3k20", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9ESL4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESL4" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q9ESL4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESL4" } ] } ] }, { "uniprot_ac": "Q9H093", "gene_name": "NUAK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9H093", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H093" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9H093", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H093" } ] } ] }, { "uniprot_ac": "Q9H0K1", "gene_name": "SIK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9H0K1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0K1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9H0K1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0K1" } ] } ] }, { "uniprot_ac": "Q9H2G2", "gene_name": "SLK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9H2G2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H2G2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9H2G2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H2G2" } ] } ] }, { "uniprot_ac": "Q9H2K8", "gene_name": "TAOK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9H2K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H2K8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9H2K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H2K8" } ] } ] }, { "uniprot_ac": "Q9H2X6", "gene_name": "HIPK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9H2X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H2X6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9H2X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H2X6" } ] } ] }, { "uniprot_ac": "Q9H422", "gene_name": "HIPK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9H422", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H422" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9H422", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H422" } ] } ] }, { "uniprot_ac": "Q9H4A3", "gene_name": "WNK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9H4A3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4A3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9H4A3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4A3" } ] } ] }, { "uniprot_ac": "Q9H4B4", "gene_name": "PLK3", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9H4B4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4B4" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "Q9H4B4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4B4" } ] } ] }, { "uniprot_ac": "Q9HAZ1", "gene_name": "CLK4", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9HAZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAZ1" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q9HAZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAZ1" } ] } ] }, { "uniprot_ac": "Q9HBH9", "gene_name": "MKNK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9HBH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBH9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9HBH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBH9" } ] } ] }, { "uniprot_ac": "Q9HBY8", "gene_name": "SGK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9HBY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBY8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9HBY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBY8" } ] } ] }, { "uniprot_ac": "Q9HC98", "gene_name": "NEK6", "activity": [ { "ec_number": "2.7.11.34", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9HC98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HC98" } ] }, { "ec_number": "2.7.11.34", "activity": "", "evidence": [ { "id": "Q9HC98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HC98" } ] } ] }, { "uniprot_ac": "Q9HCP0", "gene_name": "CSNK1G1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9HCP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCP0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9HCP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCP0" } ] } ] }, { "uniprot_ac": "Q9JHG7", "gene_name": "Pik3cg", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] }, { "ec_number": "2.7.1.154", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] }, { "ec_number": "2.7.1.154", "activity": "", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] } ] }, { "uniprot_ac": "Q9JHU3", "gene_name": "Cdk20", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JHU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHU3" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q9JHU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHU3" } ] } ] }, { "uniprot_ac": "Q9JI10", "gene_name": "Stk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JI10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JI10" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9JI10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JI10" } ] } ] }, { "uniprot_ac": "Q9JI11", "gene_name": "Stk4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JI11", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JI11" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9JI11", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JI11" } ] } ] }, { "uniprot_ac": "Q9JIH7", "gene_name": "Wnk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JIH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIH7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9JIH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIH7" } ] } ] }, { "uniprot_ac": "Q9JIK5", "gene_name": "Ddx21", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q9JIK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIK5" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "Q9JIK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIK5" } ] } ] }, { "uniprot_ac": "Q9JIX9", "gene_name": "Fastk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JIX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIX9" } ] }, { "ec_number": "2.7.11.8", "activity": "ATP + L-threonyl-[Fas-activated protein] = ADP + H(+) + O-phospho-L-threonyl-[Fas-activated protein].", "evidence": [ { "id": "Q9JIX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIX9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9JIX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIX9" } ] }, { "ec_number": "2.7.11.8", "activity": "", "evidence": [ { "id": "Q9JIX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIX9" } ] } ] }, { "uniprot_ac": "Q9JJ78", "gene_name": "Pbk", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JJ78", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJ78" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "Q9JJ78", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJ78" } ] } ] }, { "uniprot_ac": "Q9JJX8", "gene_name": "Stk32b", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JJX8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJX8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9JJX8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJX8" } ] } ] }, { "uniprot_ac": "Q9JKK8", "gene_name": "Atr", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JKK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JKK8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9JKK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JKK8" } ] } ] }, { "uniprot_ac": "Q9JKV2", "gene_name": "Cilk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JKV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JKV2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9JKV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JKV2" } ] } ] }, { "uniprot_ac": "Q9JLM8", "gene_name": "Dclk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JLM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLM8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9JLM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLM8" } ] } ] }, { "uniprot_ac": "Q9JLN9", "gene_name": "Mtor", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JLN9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLN9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9JLN9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLN9" } ] } ] }, { "uniprot_ac": "Q9JLS3", "gene_name": "Taok2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JLS3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLS3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9JLS3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLS3" } ] } ] }, { "uniprot_ac": "Q9JM01", "gene_name": "Cdkl3", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JM01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JM01" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q9JM01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JM01" } ] } ] }, { "uniprot_ac": "Q9JM52", "gene_name": "Mink1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JM52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JM52" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9JM52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JM52" } ] } ] }, { "uniprot_ac": "Q9JMK2", "gene_name": "Csnk1e", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JMK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JMK2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9JMK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JMK2" } ] } ] }, { "uniprot_ac": "Q9NBK5", "gene_name": "trc", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NBK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NBK5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9NBK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NBK5" } ] } ] }, { "uniprot_ac": "Q9NGW9", "gene_name": "mkcB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NGW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NGW9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9NGW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NGW9" } ] } ] }, { "uniprot_ac": "Q9NI63", "gene_name": "Myt1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NI63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NI63" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9NI63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NI63" } ] } ] }, { "uniprot_ac": "Q9NIV1", "gene_name": "PEK", "activity": [ { "ec_number": "2.7.11.20", "activity": "[translation elongation factor 2] + ATP = [translation elongation factor 2]-phosphate + ADP + H(+).", "evidence": [ { "id": "Q9NIV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NIV1" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "Q9NIV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NIV1" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NIV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NIV1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9NIV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NIV1" } ] } ] }, { "uniprot_ac": "Q9NQU5", "gene_name": "PAK6", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NQU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQU5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9NQU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQU5" } ] } ] }, { "uniprot_ac": "Q9NR20", "gene_name": "DYRK4", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NR20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NR20" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q9NR20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NR20" } ] } ] }, { "uniprot_ac": "Q9NRH2", "gene_name": "SNRK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NRH2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRH2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9NRH2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRH2" } ] } ] }, { "uniprot_ac": "Q9NRM7", "gene_name": "LATS2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NRM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRM7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9NRM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRM7" } ] } ] }, { "uniprot_ac": "Q9NRP7", "gene_name": "STK36", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NRP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRP7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9NRP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRP7" } ] } ] }, { "uniprot_ac": "Q9NSY1", "gene_name": "BMP2K", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NSY1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NSY1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9NSY1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NSY1" } ] } ] }, { "uniprot_ac": "Q9NWZ3", "gene_name": "IRAK4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NWZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NWZ3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9NWZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NWZ3" } ] } ] }, { "uniprot_ac": "Q9NY57", "gene_name": "STK32B", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NY57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NY57" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9NY57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NY57" } ] } ] }, { "uniprot_ac": "Q9NYL2", "gene_name": "MAP3K20", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NYL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYL2" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q9NYL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYL2" } ] } ] }, { "uniprot_ac": "Q9NYV4", "gene_name": "CDK12", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NYV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYV4" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q9NYV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYV4" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q9NYV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYV4" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q9NYV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYV4" } ] } ] }, { "uniprot_ac": "Q9NYY3", "gene_name": "PLK2", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NYY3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYY3" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "Q9NYY3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYY3" } ] } ] }, { "uniprot_ac": "Q9NZJ5", "gene_name": "EIF2AK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9NZJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZJ5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9NZJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZJ5" } ] } ] }, { "uniprot_ac": "Q9P0L2", "gene_name": "MARK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9P0L2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P0L2" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q9P0L2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P0L2" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "Q9P0L2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P0L2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9P0L2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P0L2" } ] } ] }, { "uniprot_ac": "Q9P1W9", "gene_name": "PIM2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9P1W9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P1W9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9P1W9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P1W9" } ] } ] }, { "uniprot_ac": "Q9P286", "gene_name": "PAK5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9P286", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P286" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9P286", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P286" } ] } ] }, { "uniprot_ac": "Q9P289", "gene_name": "STK26", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9P289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P289" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9P289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P289" } ] } ] }, { "uniprot_ac": "Q9P2K8", "gene_name": "EIF2AK4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9P2K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P2K8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9P2K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P2K8" } ] } ] }, { "uniprot_ac": "Q9QUK0", "gene_name": "Cdkl2", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9QUK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUK0" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q9QUK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUK0" } ] } ] }, { "uniprot_ac": "Q9QY01", "gene_name": "Ulk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9QY01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QY01" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9QY01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QY01" } ] } ] }, { "uniprot_ac": "Q9QY78", "gene_name": "Ikbkb", "activity": [ { "ec_number": "2.7.11.10", "activity": "ATP + L-seryl-[I-kappa-B protein] = ADP + H(+) + O-phospho-L-seryl-[I-kappa-B protein].", "evidence": [ { "id": "Q9QY78", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QY78" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9QY78", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QY78" } ] }, { "ec_number": "2.7.11.10", "activity": "", "evidence": [ { "id": "Q9QY78", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QY78" } ] } ] }, { "uniprot_ac": "Q9QYK9", "gene_name": "Pnck", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9QYK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYK9" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q9QYK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYK9" } ] } ] }, { "uniprot_ac": "Q9QYZ3", "gene_name": "Smok2b", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9QYZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYZ3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9QYZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYZ3" } ] } ] }, { "uniprot_ac": "Q9QYZ4", "gene_name": "Smok1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9QYZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYZ4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9QYZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYZ4" } ] } ] }, { "uniprot_ac": "Q9QYZ6", "gene_name": "Smok2a", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9QYZ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYZ6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9QYZ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYZ6" } ] } ] }, { "uniprot_ac": "Q9QZ05", "gene_name": "Eif2ak4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9QZ05", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZ05" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9QZ05", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZ05" } ] } ] }, { "uniprot_ac": "Q9QZL0", "gene_name": "Ripk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9QZL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZL0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9QZL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZL0" } ] } ] }, { "uniprot_ac": "Q9QZR5", "gene_name": "Hipk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9QZR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZR5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9QZR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZR5" } ] } ] }, { "uniprot_ac": "Q9QZS5", "gene_name": "Sgk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9QZS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZS5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9QZS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZS5" } ] } ] }, { "uniprot_ac": "Q9R011", "gene_name": "Plk3", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9R011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R011" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "Q9R011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R011" } ] } ] }, { "uniprot_ac": "Q9R012", "gene_name": "Plk2", "activity": [ { "ec_number": "2.7.11.21", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9R012", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R012" } ] }, { "ec_number": "2.7.11.21", "activity": "", "evidence": [ { "id": "Q9R012", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R012" } ] } ] }, { "uniprot_ac": "Q9R0A5", "gene_name": "Nek3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9R0A5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0A5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9R0A5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0A5" } ] } ] }, { "uniprot_ac": "Q9R0G8", "gene_name": "Nrk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9R0G8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0G8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9R0G8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0G8" } ] } ] }, { "uniprot_ac": "Q9R1L5", "gene_name": "Mast1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9R1L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1L5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9R1L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1L5" } ] } ] }, { "uniprot_ac": "Q9R1U5", "gene_name": "Sik1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9R1U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1U5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9R1U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1U5" } ] } ] }, { "uniprot_ac": "Q9UBE8", "gene_name": "NLK", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UBE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBE8" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q9UBE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBE8" } ] } ] }, { "uniprot_ac": "Q9UBS0", "gene_name": "RPS6KB2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UBS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBS0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9UBS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBS0" } ] } ] }, { "uniprot_ac": "Q9UEE5", "gene_name": "STK17A", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UEE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UEE5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9UEE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UEE5" } ] } ] }, { "uniprot_ac": "Q9UEW8", "gene_name": "STK39", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UEW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UEW8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9UEW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UEW8" } ] } ] }, { "uniprot_ac": "Q9UHD2", "gene_name": "TBK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UHD2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9UHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UHD2" } ] } ] }, { "uniprot_ac": "Q9UIK4", "gene_name": "DAPK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UIK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UIK4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9UIK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UIK4" } ] } ] }, { "uniprot_ac": "Q9UK32", "gene_name": "RPS6KA6", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UK32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UK32" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9UK32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UK32" } ] } ] }, { "uniprot_ac": "Q9UKE5", "gene_name": "TNIK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UKE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UKE5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9UKE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UKE5" } ] } ] }, { "uniprot_ac": "Q9UKI8", "gene_name": "TLK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UKI8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UKI8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9UKI8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UKI8" } ] } ] }, { "uniprot_ac": "Q9UL54", "gene_name": "TAOK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UL54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UL54" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9UL54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UL54" } ] } ] }, { "uniprot_ac": "Q9UPE1", "gene_name": "SRPK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UPE1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UPE1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9UPE1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UPE1" } ] } ] }, { "uniprot_ac": "Q9UPZ9", "gene_name": "CILK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UPZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UPZ9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9UPZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UPZ9" } ] } ] }, { "uniprot_ac": "Q9UQ07", "gene_name": "MOK", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UQ07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQ07" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q9UQ07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQ07" } ] } ] }, { "uniprot_ac": "Q9UQ88", "gene_name": "CDK11A", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UQ88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQ88" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q9UQ88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQ88" } ] } ] }, { "uniprot_ac": "Q9UQB9", "gene_name": "AURKC", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UQB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQB9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9UQB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQB9" } ] } ] }, { "uniprot_ac": "Q9UQM7", "gene_name": "CAMK2A", "activity": [ { "ec_number": "2.7.11.17", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9UQM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQM7" } ] }, { "ec_number": "2.7.11.17", "activity": "", "evidence": [ { "id": "Q9UQM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQM7" } ] } ] }, { "uniprot_ac": "Q9V3D5", "gene_name": "Dyrk2", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9V3D5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3D5" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q9V3D5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3D5" } ] } ] }, { "uniprot_ac": "Q9V3I5", "gene_name": "JIL-1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9V3I5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3I5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9V3I5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3I5" } ] } ] }, { "uniprot_ac": "Q9V3Q6", "gene_name": "Tak1", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9V3Q6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3Q6" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q9V3Q6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3Q6" } ] } ] }, { "uniprot_ac": "Q9VA38", "gene_name": "wts", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VA38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VA38" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VA38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VA38" } ] } ] }, { "uniprot_ac": "Q9VBU2", "gene_name": "RIOK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VBU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBU2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VBU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBU2" } ] } ] }, { "uniprot_ac": "Q9VCV0", "gene_name": "Takl2", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VCV0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCV0" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q9VCV0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCV0" } ] } ] }, { "uniprot_ac": "Q9VD82", "gene_name": "Dmel\\CG6800", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VD82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VD82" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q9VD82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VD82" } ] } ] }, { "uniprot_ac": "Q9VGF9", "gene_name": "aurA", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VGF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGF9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VGF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGF9" } ] } ] }, { "uniprot_ac": "Q9VHH2", "gene_name": "Vps15", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VHH2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHH2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VHH2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHH2" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "Q9VHH2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHH2" } ] } ] }, { "uniprot_ac": "Q9VI13", "gene_name": "Pak", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VI13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VI13" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VI13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VI13" } ] } ] }, { "uniprot_ac": "Q9VK45", "gene_name": "mTor", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VK45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VK45" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VK45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VK45" } ] } ] }, { "uniprot_ac": "Q9VKN7", "gene_name": "aurB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VKN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VKN7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VKN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VKN7" } ] } ] }, { "uniprot_ac": "Q9VL34", "gene_name": "Dmel\\CG4839", "activity": [ { "ec_number": "2.7.11.12", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VL34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VL34" } ] }, { "ec_number": "2.7.11.12", "activity": "", "evidence": [ { "id": "Q9VL34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VL34" } ] } ] }, { "uniprot_ac": "Q9VM90", "gene_name": "meng", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VM90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VM90" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VM90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VM90" } ] } ] }, { "uniprot_ac": "Q9VP22", "gene_name": "Cdk12", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VP22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VP22" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q9VP22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VP22" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q9VP22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VP22" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q9VP22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VP22" } ] } ] }, { "uniprot_ac": "Q9VPC0", "gene_name": "Pitslre", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VPC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VPC0" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q9VPC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VPC0" } ] } ] }, { "uniprot_ac": "Q9VR42", "gene_name": "Dmel\\CG3008", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VR42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VR42" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VR42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VR42" } ] } ] }, { "uniprot_ac": "Q9VR61", "gene_name": "S6kII", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VR61", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VR61" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VR61", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VR61" } ] } ] }, { "uniprot_ac": "Q9VRJ6", "gene_name": "Tcs5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VRJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VRJ6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VRJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VRJ6" } ] } ] }, { "uniprot_ac": "Q9VT57", "gene_name": "Cdk8", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VT57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VT57" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q9VT57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VT57" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q9VT57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VT57" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q9VT57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VT57" } ] } ] }, { "uniprot_ac": "Q9VTL5", "gene_name": "RIOK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VTL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VTL5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VTL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VTL5" } ] } ] }, { "uniprot_ac": "Q9VUQ9", "gene_name": "dop", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VUQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUQ9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VUQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUQ9" } ] } ] }, { "uniprot_ac": "Q9VW24", "gene_name": "wnd", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VW24", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VW24" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q9VW24", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VW24" } ] } ] }, { "uniprot_ac": "Q9VXE3", "gene_name": "Rok", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VXE3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VXE3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VXE3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VXE3" } ] } ] }, { "uniprot_ac": "Q9VXE5", "gene_name": "mbt", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VXE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VXE5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VXE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VXE5" } ] } ] }, { "uniprot_ac": "Q9VXG8", "gene_name": "mei-41", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VXG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VXG8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VXG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VXG8" } ] } ] }, { "uniprot_ac": "Q9VZI2", "gene_name": "Ack", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q9VZI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VZI2" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9VZI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VZI2" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "Q9VZI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VZI2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9VZI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VZI2" } ] } ] }, { "uniprot_ac": "Q9W002", "gene_name": "msn", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9W002", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W002" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9W002", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W002" } ] } ] }, { "uniprot_ac": "Q9W0V1", "gene_name": "Pdk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9W0V1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W0V1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9W0V1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W0V1" } ] } ] }, { "uniprot_ac": "Q9W1B0", "gene_name": "gek", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9W1B0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W1B0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9W1B0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W1B0" } ] } ] }, { "uniprot_ac": "Q9W354", "gene_name": "Erk7", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9W354", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W354" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q9W354", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W354" } ] } ] }, { "uniprot_ac": "Q9WTK7", "gene_name": "Stk11", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WTK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTK7" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9WTK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTK7" } ] } ] }, { "uniprot_ac": "Q9WTQ0", "gene_name": "Prkcq", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WTQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTQ0" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q9WTQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTQ0" } ] } ] }, { "uniprot_ac": "Q9WTQ1", "gene_name": "Prkd1", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WTQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTQ1" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q9WTQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTQ1" } ] } ] }, { "uniprot_ac": "Q9WTR2", "gene_name": "Map3k6", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WTR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTR2" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q9WTR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTR2" } ] } ] }, { "uniprot_ac": "Q9WTU6", "gene_name": "Mapk9", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WTU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTU6" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q9WTU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTU6" } ] } ] }, { "uniprot_ac": "Q9WTY9", "gene_name": "Mapk13", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WTY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTY9" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q9WTY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTY9" } ] } ] }, { "uniprot_ac": "Q9WUA6", "gene_name": "Akt3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WUA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUA6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9WUA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUA6" } ] } ] }, { "uniprot_ac": "Q9WUI1", "gene_name": "Mapk11", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WUI1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUI1" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q9WUI1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUI1" } ] } ] }, { "uniprot_ac": "Q9WUL6", "gene_name": "Map3k14", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WUL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUL6" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q9WUL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUL6" } ] } ] }, { "uniprot_ac": "Q9WUN2", "gene_name": "Tbk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WUN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUN2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9WUN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUN2" } ] } ] }, { "uniprot_ac": "Q9WUT3", "gene_name": "Rps6ka2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WUT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUT3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9WUT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUT3" } ] } ] }, { "uniprot_ac": "Q9WV60", "gene_name": "Gsk3b", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WV60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ] }, { "ec_number": "2.7.11.26", "activity": "ATP + L-seryl-[tau protein] = ADP + H(+) + O-phospho-L-seryl-[tau protein].", "evidence": [ { "id": "Q9WV60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ] }, { "ec_number": "2.7.11.26", "activity": "", "evidence": [ { "id": "Q9WV60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV60" } ] } ] }, { "uniprot_ac": "Q9WVC6", "gene_name": "Sgk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WVC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVC6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9WVC6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVC6" } ] } ] }, { "uniprot_ac": "Q9WVS4", "gene_name": "Mok", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WVS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVS4" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q9WVS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVS4" } ] } ] }, { "uniprot_ac": "Q9WVS7", "gene_name": "Map2k5", "activity": [ { "ec_number": "2.7.12.2", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WVS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVS7" } ] }, { "ec_number": "2.7.12.2", "activity": "", "evidence": [ { "id": "Q9WVS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVS7" } ] } ] }, { "uniprot_ac": "Q9WVS8", "gene_name": "Mapk7", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9WVS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVS8" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q9WVS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVS8" } ] } ] }, { "uniprot_ac": "Q9Y243", "gene_name": "AKT3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y243", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y243" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Y243", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y243" } ] } ] }, { "uniprot_ac": "Q9Y2H1", "gene_name": "STK38L", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y2H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2H1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Y2H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2H1" } ] } ] }, { "uniprot_ac": "Q9Y2H9", "gene_name": "MAST1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y2H9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2H9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Y2H9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2H9" } ] } ] }, { "uniprot_ac": "Q9Y2I7", "gene_name": "PIKFYVE", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y2I7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2I7" } ] }, { "ec_number": "2.7.1.150", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,5-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q9Y2I7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2I7" } ] }, { "ec_number": "2.7.1.150", "activity": "", "evidence": [ { "id": "Q9Y2I7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2I7" } ] } ] }, { "uniprot_ac": "Q9Y2K2", "gene_name": "SIK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y2K2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2K2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Y2K2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2K2" } ] } ] }, { "uniprot_ac": "Q9Y2U5", "gene_name": "MAP3K2", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y2U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2U5" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q9Y2U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2U5" } ] } ] }, { "uniprot_ac": "Q9Y3S1", "gene_name": "WNK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y3S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3S1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Y3S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3S1" } ] } ] }, { "uniprot_ac": "Q9Y463", "gene_name": "DYRK1B", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y463", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y463" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q9Y463", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y463" } ] } ] }, { "uniprot_ac": "Q9Y4A5", "gene_name": "TRRAP", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y4A5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y4A5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Y4A5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y4A5" } ] } ] }, { "uniprot_ac": "Q9Y4B6", "gene_name": "DCAF1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y4B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y4B6" } ] } ] }, { "uniprot_ac": "Q9Y4K4", "gene_name": "MAP4K5", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y4K4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y4K4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Y4K4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y4K4" } ] } ] }, { "uniprot_ac": "Q9Y572", "gene_name": "RIPK3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y572", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y572" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Y572", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y572" } ] } ] }, { "uniprot_ac": "Q9Y5S2", "gene_name": "CDC42BPB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y5S2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y5S2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Y5S2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y5S2" } ] } ] }, { "uniprot_ac": "Q9Y6E0", "gene_name": "STK24", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y6E0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6E0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Y6E0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6E0" } ] } ] }, { "uniprot_ac": "Q9Y6M4", "gene_name": "CSNK1G3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y6M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6M4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Y6M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6M4" } ] } ] }, { "uniprot_ac": "Q9Y6R4", "gene_name": "MAP3K4", "activity": [ { "ec_number": "2.7.11.25", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y6R4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6R4" } ] }, { "ec_number": "2.7.11.25", "activity": "", "evidence": [ { "id": "Q9Y6R4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6R4" } ] } ] }, { "uniprot_ac": "Q9Y6S9", "gene_name": "RPS6KL1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Y6S9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6S9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Y6S9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6S9" } ] } ] }, { "uniprot_ac": "Q9Z0G2", "gene_name": "Srpk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z0G2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0G2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z0G2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0G2" } ] } ] }, { "uniprot_ac": "Q9Z0H0", "gene_name": "Cdc7", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z0H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0H0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z0H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0H0" } ] } ] }, { "uniprot_ac": "Q9Z0R0", "gene_name": "Haspin", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z0R0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0R0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z0R0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0R0" } ] } ] }, { "uniprot_ac": "Q9Z188", "gene_name": "Dyrk1b", "activity": [ { "ec_number": "2.7.12.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z188", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z188" } ] }, { "ec_number": "2.7.12.1", "activity": "", "evidence": [ { "id": "Q9Z188", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z188" } ] } ] }, { "uniprot_ac": "Q9Z1B7", "gene_name": "Mapk13", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z1B7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B7" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q9Z1B7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B7" } ] } ] }, { "uniprot_ac": "Q9Z1J2", "gene_name": "Nek4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z1J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1J2" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z1J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1J2" } ] } ] }, { "uniprot_ac": "Q9Z1L0", "gene_name": "Pik3cb", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z1L0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1L0" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q9Z1L0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1L0" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "Q9Z1L0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1L0" } ] } ] }, { "uniprot_ac": "Q9Z1M4", "gene_name": "Rps6kb2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z1M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1M4" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z1M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1M4" } ] } ] }, { "uniprot_ac": "Q9Z1S0", "gene_name": "Bub1b", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z1S0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1S0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z1S0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1S0" } ] } ] }, { "uniprot_ac": "Q9Z1T6", "gene_name": "Pikfyve", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z1T6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1T6" } ] }, { "ec_number": "2.7.1.150", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,5-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q9Z1T6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1T6" } ] }, { "ec_number": "2.7.1.150", "activity": "", "evidence": [ { "id": "Q9Z1T6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1T6" } ] } ] }, { "uniprot_ac": "Q9Z1W9", "gene_name": "Stk39", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z1W9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1W9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z1W9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1W9" } ] } ] }, { "uniprot_ac": "Q9Z1Z1", "gene_name": "Eif2ak3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z1Z1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1Z1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z1Z1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1Z1" } ] } ] }, { "uniprot_ac": "Q9Z265", "gene_name": "Chek2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z265" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z265" } ] } ] }, { "uniprot_ac": "Q9Z277", "gene_name": "Baz1b", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q9Z277", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z277" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "Q9Z277", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z277" } ] } ] }, { "uniprot_ac": "Q9Z2A0", "gene_name": "Pdpk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z2A0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A0" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z2A0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A0" } ] } ] }, { "uniprot_ac": "Q9Z2A6", "gene_name": "Mapk15", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z2A6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A6" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q9Z2A6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A6" } ] } ] }, { "uniprot_ac": "Q9Z2B5", "gene_name": "Eif2ak3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z2B5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2B5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z2B5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2B5" } ] } ] }, { "uniprot_ac": "Q9Z2B9", "gene_name": "Rps6ka4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z2B9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2B9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z2B9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2B9" } ] } ] }, { "uniprot_ac": "Q9Z2E3", "gene_name": "Ern2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z2E3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2E3" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z2E3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2E3" } ] }, { "ec_number": "3.1.26.-", "activity": "", "evidence": [ { "id": "Q9Z2E3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2E3" } ] } ] }, { "uniprot_ac": "Q9Z2P5", "gene_name": "Ripk3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z2P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2P5" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z2P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2P5" } ] } ] }, { "uniprot_ac": "Q9Z2R9", "gene_name": "Eif2ak1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z2R9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2R9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z2R9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2R9" } ] } ] }, { "uniprot_ac": "Q9Z2W1", "gene_name": "Stk25", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z2W1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2W1" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z2W1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2W1" } ] } ] }, { "uniprot_ac": "Q9Z335", "gene_name": "Sbk1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z335", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z335" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9Z335", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z335" } ] } ] }, { "uniprot_ac": "X2JAG8", "gene_name": "Prp4k", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "X2JAG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/X2JAG8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "X2JAG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/X2JAG8" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 195 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }