{ "uniprot_canonical_ac": "Q9WUK7-1", "uniprot_ac": "Q9WUK7", "uniprot_id": "OPN3_MOUSE", "mass": { "chemical_mass": 44947.0, "monoisotopic_mass": 44947.0 }, "refseq": { "ac": "NP_034228", "name": "opsin-3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228" }, "gene_names": [ { "name": "Opn3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9WUK7", "id": "Q9WUK7" }, { "name": "Ecpn; ERO", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228", "id": "NP_034228" }, { "name": "Ecpn", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9WUK7", "id": "Q9WUK7" }, { "name": "Opn3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228", "id": "NP_034228" } ], "protein_names": [ { "name": "Opsin-3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9WUK7" }, { "name": "Encephalopsin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9WUK7" }, { "name": "Panopsin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9WUK7" }, { "name": "opsin (encephalopsin); panopsin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228", "id": "NP_034228" }, { "name": "opsin-3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228", "id": "NP_034228" } ], "function": [ { "annotation": "Comprehensive Behavioral Analysis of Opsin 3 (Encephalopsin)-Deficient Mice Identifies Role in Modulation of Acoustic Startle Reflex. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_034228", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228" }, { "database": "PubMed", "id": "36041828", "url": "https://glygen.org/publication/PubMed/36041828" } ] }, { "annotation": "Encephalopsin (OPN3) is required for normal refractive development and the GO/GROW response to induced myopia. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_034228", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228" }, { "database": "PubMed", "id": "37287644", "url": "https://glygen.org/publication/PubMed/37287644" } ] }, { "annotation": "Endogenous Opsin 3 (OPN3) Protein Expression in the Adult Brain Using a Novel OPN3-mCherry Knock-In Mouse Model. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_034228", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228" }, { "database": "PubMed", "id": "32737180", "url": "https://glygen.org/publication/PubMed/32737180" } ] }, { "annotation": "G-protein coupled receptor which selectively activates G proteins via ultraviolet A (UVA) light-mediated activation in the skin (PubMed:30284927). Binds both 11-cis retinal and all-trans retinal (By similarity). Regulates melanogenesis in melanocytes via inhibition of alpha-MSH-induced MC1R-mediated cAMP signaling, modulation of calcium flux, regulation of CAMK2 phosphorylation, and subsequently phosphorylation of CREB, p38, ERK and MITF in response to blue light (By similarity). Plays a role in melanocyte survival through regulation of intracellular calcium levels and subsequent BCL2/RAF1 signaling (By similarity). Additionally regulates apoptosis via cytochrome c release and subsequent activation of the caspase cascade (By similarity). Required for TYR and DCT blue light-induced complex formation in melanocytes (By similarity). Involved in keratinocyte differentiation in response to blue-light (By similarity). Required for the UVA-mediated induction of calcium and mitogen-activated protein kinase signaling resulting in the expression of MMP1, MMP2, MMP3, MMP9 and TIMP1 in dermal fibroblasts (By similarity). Plays a role in light-mediated glucose uptake, mitochondrial respiration and fatty acid metabolism in brown adipocyte tissues (PubMed:32040503). May be involved in photorelaxation of airway smooth muscle cells, via blue-light dependent GPCR signaling pathways (PubMed:30284927).", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7#function" }, { "database": "UniProtKB", "id": "Q9H1Y3", "url": "https://www.uniprot.org/uniprot/Q9H1Y3#function" }, { "database": "PubMed", "id": "32040503", "url": "https://glygen.org/publication/PubMed/32040503" }, { "database": "PubMed", "id": "30284927", "url": "https://glygen.org/publication/PubMed/30284927" } ] }, { "annotation": "Opsin 3-Galphas Promotes Airway Smooth Muscle Relaxation Modulated by G Protein Receptor Kinase 2.", "evidence": [ { "database": "RefSeq", "id": "NP_034228", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228" }, { "database": "PubMed", "id": "33058732", "url": "https://glygen.org/publication/PubMed/33058732" } ] }, { "annotation": "Studies clearly show that activation of sensory transduction by unliganded opsin, and not the accumulation of retinyl esters, causes light-independent retinal degeneration in Leber congenital amaurosis", "evidence": [ { "database": "RefSeq", "id": "NP_034228", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228" }, { "database": "PubMed", "id": "14517541", "url": "https://glygen.org/publication/PubMed/14517541" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs3388519382", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388519382" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 127, "end_pos": 127, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (ITT->NTT).", "chr_id": "1", "chr_pos": "175493183", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I127", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 136, "end_pos": 138, "sequence_org": "ERY", "sequence_mut": "RDR", "comment": "Reduced basal glucose uptake and glucose-dependent mitochondrial respiration.", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" }, { "database": "PubMed", "id": "32040503", "url": "https://glygen.org/publication/PubMed/32040503" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Opn3", "url": "https://www.uniprot.org/uniprot/Q9WUK7", "locus": { "chromosome": "1", "start_pos": 175489987, "end_pos": 175520342, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000026525", "url": "https://www.ensembl.org/id/ENSMUSG00000026525" } ] } } ], "crossref": [ { "id": "ENSMUSG00000026525", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000026525", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "13603", "url": "https://www.ncbi.nlm.nih.gov/gene/13603", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027430", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027430", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:13603", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:13603", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1338022", "url": "http://www.informatics.jax.org/marker/MGI:1338022", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "IMIYCYG", "url": "https://omabrowser.org/oma/group/IMIYCYG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2960637at2759", "url": "http://www.orthodb.org/?query=2960637at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24240", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24240", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24240:SF197", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24240:SF197", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "http://pfam.xfam.org/family/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9WUK7", "url": "http://purl.obolibrary.org/obo/PR_Q9WUK7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-419771", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_034228", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9WUK7-1", "url": "https://www.uniprot.org/uniprot/Q9WUK7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYSGNRSGDQGYWEDGAGAEGAAPAGTRSPAPLFSPTAYERLALLLGCLALLGVGGNLLVLLLYSKFPRLRTPTHLFLVNLSLGDLLVSLFGVTFTFASCLRNGWVWDAVGCAWDGFSGSLFGFVSITTLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDIHGLGCTVDWRSKDANDSSFVLFLFLGCLVVPVGIIAHCYGHILYSVRMLRCVEDLQTIQVIKMLRYEKKVAKMCFLMAFVFLTCWMPYIVTRFLVVNGYGHLVTPTVSIVSYLFAKSSTVYNPVIYIFMNRKFRRSLLQLLCFRLLRCQRPAKNLPAAESEMHIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVEDSDRSSASKVDVIQVRPL", "length": 400, "header": "sp|Q9WUK7-1|OPN3_MOUSE Isoform 1 of Opsin-3 OS=Mus musculus OX=10090 GN=Opn3 PE=1 SV=1 CANONICAL=Q9WUK7-1" }, "isoforms": [ { "isoform_ac": "Q9WUK7-1", "url": "", "sequence": { "sequence": "MYSGNRSGDQGYWEDGAGAEGAAPAGTRSPAPLFSPTAYERLALLLGCLALLGVGGNLLVLLLYSKFPRLRTPTHLFLVNLSLGDLLVSLFGVTFTFASCLRNGWVWDAVGCAWDGFSGSLFGFVSITTLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDIHGLGCTVDWRSKDANDSSFVLFLFLGCLVVPVGIIAHCYGHILYSVRMLRCVEDLQTIQVIKMLRYEKKVAKMCFLMAFVFLTCWMPYIVTRFLVVNGYGHLVTPTVSIVSYLFAKSSTVYNPVIYIFMNRKFRRSLLQLLCFRLLRCQRPAKNLPAAESEMHIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVEDSDRSSASKVDVIQVRPL", "length": 400, "header": "sp|Q9WUK7-1|OPN3_MOUSE Isoform 1 of Opsin-3 OS=Mus musculus OX=10090 GN=Opn3 PE=1 SV=1 CANONICAL=Q9WUK7-1" }, "locus": { "chromosome": "1", "start_pos": 175520102, "end_pos": 175490460, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000027809", "url": "https://www.ensembl.org/id/ENSMUST00000027809" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000027809", "url": "https://www.ensembl.org/id/ENSMUSP00000027809" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 196, "start_aa": "Asn", "end_pos": 196, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn196", "evidence": [ { "id": "Q9WUK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUK7#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 5, "start_aa": "Asn", "end_pos": 5, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn5", "evidence": [ { "id": "Q9WUK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUK7#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Encephalopsin: a novel mammalian extraretinal opsin discretely localized in the brain.", "journal": "J. Neurosci.", "date": "1999", "authors": "Blackshaw S, Snyder SH", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "reference": [ { "type": "PubMed", "id": "10234000", "url": "https://glygen.org/publication/PubMed/10234000" } ] }, { "title": "Different structural organization of the encephalopsin gene in man and mouse.", "journal": "Gene", "date": "2002", "authors": "Kasper G, Taudien S, Staub E, Mennerich D, Rieder M, Hinzmann B, Dahl E, Schwidetzky U, Rosenthal A, Rump A", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "reference": [ { "type": "PubMed", "id": "12242008", "url": "https://glygen.org/publication/PubMed/12242008" } ] }, { "title": "Spontaneous activity of opsin apoprotein is a cause of Leber congenital amaurosis.", "journal": "Nature genetics", "date": "2003", "authors": "Woodruff ML, Wang Z, Chung HY, Redmond TM, Fain GL, Lem J", "evidence": [ { "database": "RefSeq", "id": "NP_034228", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228" } ], "reference": [ { "type": "PubMed", "id": "14517541", "url": "https://glygen.org/publication/PubMed/14517541" } ] }, { "title": "Airway smooth muscle photorelaxation via opsin receptor activation.", "journal": "Am. J. Physiol.", "date": "2019", "authors": "Yim PD, Gallos G, Perez-Zoghbi JF, Zhang Y, Xu D, Wu A, Berkowitz DE, Emala CW", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "reference": [ { "type": "PubMed", "id": "30284927", "url": "https://glygen.org/publication/PubMed/30284927" } ] }, { "title": "Cell-autonomous light sensitivity via Opsin3 regulates fuel utilization in brown adipocytes.", "journal": "PLoS Biol.", "date": "2020", "authors": "Sato M, Tsuji T, Yang K, Ren X, Dreyfuss JM, Huang TL, Wang CH, Shamsi F, Leiria LO, Lynes MD, Yau KW, Tseng YH", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "reference": [ { "type": "PubMed", "id": "32040503", "url": "https://glygen.org/publication/PubMed/32040503" } ] }, { "title": "Endogenous Opsin 3 (OPN3) Protein Expression in the Adult Brain Using a Novel OPN3-mCherry Knock-In Mouse Model.", "journal": "eNeuro", "date": "2020", "authors": "Olinski LE, Tsuda AC, Kauer JA, Oancea E", "evidence": [ { "database": "RefSeq", "id": "NP_034228", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228" } ], "reference": [ { "type": "PubMed", "id": "32737180", "url": "https://glygen.org/publication/PubMed/32737180" } ] }, { "title": "Opsin 3-Galphas Promotes Airway Smooth Muscle Relaxation Modulated by G Protein Receptor Kinase 2.", "journal": "American journal of respiratory cell and molecular biology", "date": "2021", "authors": "Wu AD, Dan W, Zhang Y, Vemaraju S, Upton BA, Lang RA, Buhr ED, Berkowitz DE, Gallos G, Emala CW, Yim PD", "evidence": [ { "database": "RefSeq", "id": "NP_034228", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228" } ], "reference": [ { "type": "PubMed", "id": "33058732", "url": "https://glygen.org/publication/PubMed/33058732" } ] }, { "title": "Comprehensive Behavioral Analysis of Opsin 3 (Encephalopsin)-Deficient Mice Identifies Role in Modulation of Acoustic Startle Reflex.", "journal": "eNeuro", "date": "2022", "authors": "Upton BA, Nayak G, Schweinzger I, D'Souza SP, Vorhees CV, Williams MT, Earl BR, Lang RA", "evidence": [ { "database": "RefSeq", "id": "NP_034228", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228" } ], "reference": [ { "type": "PubMed", "id": "36041828", "url": "https://glygen.org/publication/PubMed/36041828" } ] }, { "title": "Encephalopsin (OPN3) is required for normal refractive development and the GO/GROW response to induced myopia.", "journal": "Molecular vision", "date": "2023", "authors": "Linne Courtney, Mon Khine Yin, D'Souza Shane, Jeong Heonuk, Jiang Xiaoyan, Brown Dillon M, Zhang Kevin, Vemaraju Shruti, Tsubota Kazuo, Kurihara Toshihide, Pardue Machelle T, Lang Richard A", "evidence": [ { "database": "RefSeq", "id": "NP_034228", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034228" } ], "reference": [ { "type": "PubMed", "id": "37287644", "url": "https://glygen.org/publication/PubMed/37287644" } ] } ], "pathway": [ { "id": "mmu:13603", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:13603", "resource": "KEGG Pathway" }, { "id": "R-MMU-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" }, { "id": "R-MMU-419771", "name": "Opsins", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-419771", "resource": "Reactome", "description": "Opsins" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZFS1-1", "protein_name": "Opsin 3", "gene_name": "Opn3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MYSGNRSGGQGYWEDGAGAEGAAPAGTRSPAPLFSPTAYERLALLLGCLALLGVGGNLLVLLLYSKFPRLRTPTHLFLVNLSLGDLLVSLFGVTFTFASCLRNGWVWDAVGCAWDGFSGSLFGFVSITTLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPMGIIAHCYGHILYSVRMLRCVEDLQTIQVIKMLRYEKKVAKMCFLMAFVFLTCWMPYVVTRFLVVNGYGHLVTPTVSIVSYLFAKSSTVYNPVIYIFMIRKFRRSLLQLLCFRLLRCQRPAKNLPAAESEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVEDSDRSSASKVDVIQVRPL", "length": 400 }, "evidence": [ { "id": "45229605", "url": "http://www.informatics.jax.org/homology/45229605", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9H1Y3-1", "protein_name": "Opsin-3", "gene_name": "OPN3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL", "length": 402 }, "evidence": [ { "id": "45229605", "url": "http://www.informatics.jax.org/homology/45229605", "database": "MGI" }, { "id": "Q9WUK7", "url": "https://omabrowser.org/oma/group/Q9WUK7/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "negative regulation of melanin biosynthetic process", "id": "GO:0048022", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048022", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "keratinocyte differentiation", "id": "GO:0030216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030216", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "positive regulation of glucose import", "id": "GO:0046326", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046326", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "phototransduction", "id": "GO:0007602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007602", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "positive regulation of melanin biosynthetic process", "id": "GO:0048023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048023", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "positive regulation of cellular respiration", "id": "GO:1901857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901857", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "cellular response to UV-A", "id": "GO:0071492", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071492", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "cellular response to light stimulus", "id": "GO:0071482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071482", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "response to blue light", "id": "GO:0009637", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009637", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "photoreceptor outer segment", "id": "GO:0001750", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001750", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "all-trans retinal binding", "id": "GO:0005503", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005503", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "11-cis retinal binding", "id": "GO:0005502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005502", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" }, { "name": "G protein-coupled photoreceptor activity", "id": "GO:0008020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008020", "evidence": [ { "database": "UniProtKB", "id": "Q9WUK7", "url": "https://www.uniprot.org/uniprot/Q9WUK7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 148, "end_pos": 150, "annotation": "n_glycosylation_sequon" }, { "start_pos": 196, "end_pos": 198, "annotation": "n_glycosylation_sequon" }, { "start_pos": 365, "end_pos": 367, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" }, { "start_pos": 80, "end_pos": 82, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }