{ "uniprot_canonical_ac": "Q9WTP9-1", "uniprot_ac": "Q9WTP9", "uniprot_id": "VAX2_MOUSE", "mass": { "chemical_mass": 31701.0, "monoisotopic_mass": 31701.0 }, "refseq": { "ac": "NP_036042", "name": "ventral anterior homeobox 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036042" }, "gene_names": [ { "name": "Vax2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9WTP9", "id": "Q9WTP9" }, { "name": "Dres93", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036042", "id": "NP_036042" }, { "name": "Vax2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036042", "id": "NP_036042" }, { "name": "Vex", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9WTP9", "id": "Q9WTP9" } ], "protein_names": [ { "name": "Ventral anterior homeobox 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9WTP9" }, { "name": "Ventral retina homeodomain protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9WTP9" }, { "name": "ventral anterior homeobox 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036042", "id": "NP_036042" }, { "name": "ventral retina homeodomain protein; ventral anterior homeobox containing gene 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036042", "id": "NP_036042" } ], "function": [ { "annotation": "Transcription factor that may function in dorsoventral specification of the forebrain. Regulates the expression of Wnt signaling antagonists including the expression of a truncated TCF7L2 isoform that cannot bind CTNNB1 and acts therefore as a potent dominant-negative Wnt antagonist. Plays a crucial role in eye development and, in particular, in the specification of the ventral optic vesicle. May be a regulator of axial polarization in the retina.", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9#function" }, { "database": "PubMed", "id": "21856776", "url": "https://glygen.org/publication/PubMed/21856776" }, { "database": "PubMed", "id": "10421837", "url": "https://glygen.org/publication/PubMed/10421837" }, { "database": "PubMed", "id": "11830578", "url": "https://glygen.org/publication/PubMed/11830578" }, { "database": "PubMed", "id": "10595508", "url": "https://glygen.org/publication/PubMed/10595508" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Vax2", "url": "https://www.uniprot.org/uniprot/Q9WTP9", "locus": { "chromosome": "6", "start_pos": 83715295, "end_pos": 83688246, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000034777", "url": "https://www.ensembl.org/id/ENSMUSG00000034777" } ] } } ], "crossref": [ { "id": "ENSMUSG00000034777", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000034777", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00086", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00086", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "24113", "url": "https://www.ncbi.nlm.nih.gov/gene/24113", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9WTP9", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9WTP9*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000047", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000047", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001356", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001356", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017970", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017970", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020479", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020479", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:24113", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:24113", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1346018", "url": "http://www.informatics.jax.org/marker/MGI:1346018", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "GETDHCR", "url": "https://omabrowser.org/oma/group/GETDHCR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "903523at2759", "url": "http://www.orthodb.org/?query=903523at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24339", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24339", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24339:SF34", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24339:SF34", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00046", "url": "http://pfam.xfam.org/family/PF00046", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9WTP9", "url": "http://purl.obolibrary.org/obo/PR_Q9WTP9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_036042", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036042", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9WTP9-1", "url": "https://www.uniprot.org/uniprot/Q9WTP9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGDGGAERDRGPKRREEPGGRSGRHGEHRGAEDLRADTGSASPREIAGTSASSPAGSRESGGDSDGQQALGETDHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDLEKRASSSASEAFATSNVLRLLEQGRLLSVPRAPSLLALTPGLPGLPASHRGTSLVDPRNSSPRLNPMPSASASSPLPPPLPAICFSSAPLLDLPAGYKLGSSAFEPYSRLEQQKVGSPGQSDKKADI", "length": 292, "header": "sp|Q9WTP9-1|VAX2_MOUSE Isoform 1 of Ventral anterior homeobox 2 OS=Mus musculus OX=10090 GN=Vax2 PE=1 SV=1 CANONICAL=Q9WTP9-1" }, "isoforms": [ { "isoform_ac": "Q9WTP9-1", "url": "", "sequence": { "sequence": "MGDGGAERDRGPKRREEPGGRSGRHGEHRGAEDLRADTGSASPREIAGTSASSPAGSRESGGDSDGQQALGETDHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDLEKRASSSASEAFATSNVLRLLEQGRLLSVPRAPSLLALTPGLPGLPASHRGTSLVDPRNSSPRLNPMPSASASSPLPPPLPAICFSSAPLLDLPAGYKLGSSAFEPYSRLEQQKVGSPGQSDKKADI", "length": 292, "header": "sp|Q9WTP9-1|VAX2_MOUSE Isoform 1 of Ventral anterior homeobox 2 OS=Mus musculus OX=10090 GN=Vax2 PE=1 SV=1 CANONICAL=Q9WTP9-1" }, "locus": { "chromosome": "6", "start_pos": 83714962, "end_pos": 83688279, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000037807", "url": "https://www.ensembl.org/id/ENSMUST00000037807" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000035976", "url": "https://www.ensembl.org/id/ENSMUSP00000035976" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Expression of the Vax family homeobox genes suggests multiple roles in eye development.", "journal": "Genes Cells", "date": "1999", "authors": "Ohsaki K, Morimitsu T, Ishida Y, Kominami R, Takahashi N", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "reference": [ { "type": "PubMed", "id": "10421837", "url": "https://glygen.org/publication/PubMed/10421837" } ] }, { "title": "A homeobox gene, vax2, controls the patterning of the eye dorsoventral axis.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1999", "authors": "Barbieri AM, Lupo G, Bulfone A, Andreazzoli M, Mariani M, Fougerousse F, Consalez GG, Borsani G, Beckmann JS, Barsacchi G, Ballabio A, Banfi S", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "reference": [ { "type": "PubMed", "id": "10485894", "url": "https://glygen.org/publication/PubMed/10485894" } ] }, { "title": "Misexpression of the Emx-related homeobox genes cVax and mVax2 ventralizes the retina and perturbs the retinotectal map.", "journal": "Neuron", "date": "1999", "authors": "Kozak C.A., Cepko C.L., Furukawa T., Schulte D., Peters M.A.", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "reference": [ { "type": "PubMed", "id": "10595508", "url": "https://glygen.org/publication/PubMed/10595508" } ] }, { "title": "The homeodomain protein Vax2 patterns the dorsoventral and nasotemporal axes of the eye.", "journal": "Development", "date": "2002", "authors": "Mui SH, Hindges R, O'Leary DD, Lemke G, Bertuzzi S", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "reference": [ { "type": "PubMed", "id": "11830578", "url": "https://glygen.org/publication/PubMed/11830578" } ] }, { "title": "A novel mechanism for the transcriptional regulation of Wnt signaling in development.", "journal": "Genes Dev.", "date": "2011", "authors": "Vacik T, Stubbs JL, Lemke G", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "reference": [ { "type": "PubMed", "id": "21856776", "url": "https://glygen.org/publication/PubMed/21856776" } ] } ], "pathway": [ { "id": "mmu:24113", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:24113", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9JLZ9-1", "protein_name": "Ventral anterior homeobox 2", "gene_name": "Vax2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGDGGAERDRGPKRREEPGGRSGCRGEHRGAEDLRADTGSTSPREIAGTSASSPAGSRESGGDSDGQQALGETDHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDLEKRASSSAFEAFATSNVLRLLEQGRLLSVPRAPSLLALSPGLPGLTAGHRGTSLGDPRNSSQRLNPMPSASASSPLPPPLPAVCFSAAPLLDLPASYKLGSSAFEPYSRLEQQKVGSPGQSDKKADI", "length": 292 }, "evidence": [ { "id": "45225807", "url": "http://www.informatics.jax.org/homology/45225807", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9UIW0-1", "protein_name": "Ventral anterior homeobox 2", "gene_name": "VAX2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGDGGAERDRGPARRAESGGGGGRCGDRSGAGDLRADGGGHSPTEVAGTSASSPAGSRESGADSDGQPGPGEADHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDLEKRASSSASEAFATSNILRLLEQGRLLSVPRAPSLLALTPSLPGLPASHRGTSLGDPRNSSPRLNPLSSASASPPLPPPLPAVCFSSAPLLDLPAGYELGSSAFEPYSWLERKVGSASSCKKANT", "length": 290 }, "evidence": [ { "id": "45225807", "url": "http://www.informatics.jax.org/homology/45225807", "database": "MGI" }, { "id": "Q9WTP9", "url": "https://omabrowser.org/oma/group/Q9WTP9/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "axonogenesis", "id": "GO:0007409", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007409", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "forebrain development", "id": "GO:0030900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030900", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "central nervous system development", "id": "GO:0007417", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007417", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "brain development", "id": "GO:0007420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007420", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "retina development in camera-type eye", "id": "GO:0060041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060041", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "neuron differentiation", "id": "GO:0030182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030182", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "embryonic eye morphogenesis", "id": "GO:0048048", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048048", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "Wnt signaling pathway", "id": "GO:0016055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016055", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "camera-type eye development", "id": "GO:0043010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043010", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "dorsal/ventral axis specification", "id": "GO:0009950", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009950", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "DNA-binding transcription repressor activity, RNA polymerase II-specific", "id": "GO:0001227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001227", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "chromatin DNA binding", "id": "GO:0031490", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031490", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding", "id": "GO:0001162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001162", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "Q9WTP9", "url": "https://www.uniprot.org/uniprot/Q9WTP9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 140, "end_pos": 142, "annotation": "n_glycosylation_sequon" }, { "start_pos": 224, "end_pos": 226, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }