{
    "uniprot_canonical_ac": "Q9W2M2-1",
    "uniprot_ac": "Q9W2M2",
    "uniprot_id": "TREA_DROME",
    "mass": {
        "chemical_mass": 67689.0,
        "monoisotopic_mass": 67689.0
    },
    "refseq": {
        "ac": "NP_001261115",
        "name": "trehalase, isoform G",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001261115"
    },
    "gene_names": [
        {
            "name": "Treh",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "id": "Q9W2M2"
        },
        {
            "name": "87D3T; anon-EST:Posey159; anon-sts38; CG9364; Dmel\\CG9364; DmTre; ESTS:87D3T; Tre; TRE; TREH",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001261115",
            "id": "NP_001261115"
        },
        {
            "name": "87D3T",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "id": "Q9W2M2"
        },
        {
            "name": "CG9364",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "id": "Q9W2M2"
        },
        {
            "name": "DmTre",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "id": "Q9W2M2"
        },
        {
            "name": "Dmel\\CG9364",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "id": "Q9W2M2"
        },
        {
            "name": "Dmel_CG9364",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "id": "Q9W2M2"
        },
        {
            "name": "ESTS:87D3T",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "id": "Q9W2M2"
        },
        {
            "name": "TREH",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "id": "Q9W2M2"
        },
        {
            "name": "TRE",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "id": "Q9W2M2"
        },
        {
            "name": "Treh",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001261115",
            "id": "NP_001261115"
        },
        {
            "name": "Tre",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "id": "Q9W2M2"
        },
        {
            "name": "anon-EST:Posey159",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "id": "Q9W2M2"
        },
        {
            "name": "anon-sts38",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "id": "Q9W2M2"
        }
    ],
    "protein_names": [
        {
            "name": "Trehalase",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q9W2M2"
        },
        {
            "name": "3.2.1.28",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9W2M2"
        },
        {
            "name": "Alpha,alpha-trehalase",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9W2M2"
        },
        {
            "name": "Alpha,alpha-trehalose glucohydrolase",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9W2M2"
        },
        {
            "name": "CG9364-PG; Treh-PG; trehalase",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001261115",
            "id": "NP_001261115"
        },
        {
            "name": "trehalase, isoform G",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001261115",
            "id": "NP_001261115"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Drosophila melanogaster",
            "taxid": 7227,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9W2M2",
                    "url": "https://www.uniprot.org/uniprot/Q9W2M2"
                }
            ],
            "common_name": "Fruit fly"
        }
    ],
    "gene": [
        {
            "name": "Treh",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "locus": {
                "chromosome": "2R",
                "start_pos": 21088945,
                "end_pos": 21074018,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "FBgn0003748",
                        "url": "https://www.ensembl.org/id/FBgn0003748"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "FBgn0003748",
            "url": "https://bgee.org/?page=gene&gene_id=FBgn0003748",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "3.2.1.28",
            "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.2.1.28&UniProtAcc=Q9W2M2",
            "database": "BRENDA",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "GH37",
            "url": "http://www.cazy.org/GH37.html",
            "database": "CAZy",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "FBgn0003748",
            "url": "https://flybase.org/reports/FBgn0003748",
            "database": "FlyBase",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "45368",
            "url": "https://www.ncbi.nlm.nih.gov/gene/45368",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q9W2M2",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9W2M2*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR001661",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001661",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR008928",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR008928",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR012341",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR012341",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR018232",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR018232",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "dme:Dmel_CG9364",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG9364",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "WDASDTP",
            "url": "https://omabrowser.org/oma/group/WDASDTP/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "1329212at2759",
            "url": "http://www.orthodb.org/?query=1329212at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR23403",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23403",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR23403:SF1",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23403:SF1",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF01204",
            "url": "http://pfam.xfam.org/family/PF01204",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q9W2M2",
            "url": "http://purl.obolibrary.org/obo/PR_Q9W2M2",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_001261115",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001261115",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "32675",
            "url": "https://www.rhea-db.org/rhea/32675",
            "database": "Rhea",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "A4UZR3",
            "url": "https://www.uniprot.org/uniprot/A4UZR3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A4UZR3-1",
            "url": "https://www.uniprot.org/uniprot/A4UZR3-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9W2M2",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9W2M2-1",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9W2M2-2",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2-2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9W2M2-3",
            "url": "https://www.uniprot.org/uniprot/Q9W2M2-3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MFKLPTISLLLVSWSCLVALSQAKTYSLPDLTTDYNNAIPVDEEEAQDPFASCKIYCEGNLLHTIQTAVPKLFADSKTFVDMKLNNSPDKTLEDFNAMMEAKNQTPSSEDLKQFVDKYFSAPGTELEKWTPTDWKENPSFLDLISDPDLKQWGVELNSIWKDLGRKMKDEVSKNPEYYSIIPVPNPVIVPGGRFIEFYYWDSYWIIRGLLYSQMFDTARGMIENFFSIVNRFGFIPNGGRVYYHGRSQPPLLTGMVKSYVDFTNDDKFAIDALDTLEHEFEFFVNNHNVTVKNHSLCVYRDSSSGPRPESYREDVETGEEFPTDEAKELHYSELKAGAESGMDFSSRWFISPTGTNDGNRSALSTTSIVPVDLNAYLYWNAKLIAEFHSKAGNTKKVTEYETKAEKLLLGIQEVLWNEEAGVWLDYDMINQKPRDYYTPTNLSPLWVKAFNISESEKISASVMAYIERNKLDSFPGGVPNTLSYTGEQWDAPNVWAPMQYILVEGLNNLNTPEAKNMSLKWATRWVKTNFAAFSKDRHMYEKYNADEFGVGGGGGEYEVQTGFGWSNGVIIEWLSKHGRDISIGSGCGCLAGEKRQ",
        "length": 596,
        "header": "sp|Q9W2M2-1|TREA_DROME Isoform 1 of Trehalase  OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1 CANONICAL=Q9W2M2-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A4UZR3-1",
            "url": "",
            "sequence": {
                "sequence": "MASPANPSSNHKMNGNGKIYCEGNLLHTIQTAVPKLFADSKTFVDMKLNNSPDKTLEDFNAMMEAKNQTPSSEDLKQFVDKYFSAPGTELEKWTPTDWKENPSFLDLISDPDLKQWGVELNSIWKDLGRKMKDEVSKNPEYYSIIPVPNPVIVPGGRFIEFYYWDSYWIIRGLLYSQMFDTARGMIENFFSIVNRFGFIPNGGRVYYHGRSQPPLLTGMVKSYVDFTNDDKFAIDALDTLEHEFEFFVNNHNVTVKNHSLCVYRDSSSGPRPESYREDVETGEEFPTDEAKELHYSELKAGAESGMDFSSRWFISPTGTNDGNRSALSTTSIVPVDLNAYLYWNAKLIAEFHSKAGNTKKVTEYETKAEKLLLGIQEVLWNEEAGVWLDYDMINQKPRDYYTPTNLSPLWVKAFNISESEKISASVMAYIERNKLDSFPGGVPNTLSYTGEQWDAPNVWAPMQYILVEGLNNLNTPEAKNMSLKWATRWVKTNFAAFSKDRHMYEKYNADEFGVGGGGGEYEVQTGFGWSNGVIIEWLSKHGRDISIGSGCGCLAGEKRQ",
                "length": 560,
                "header": "tr|A4UZR3-1|A4UZR3_DROME Computationally mapped isoform of Trehalase  OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1 CANONICAL=Q9W2M2-1"
            },
            "locus": {}
        },
        {
            "isoform_ac": "Q9W2M2-1",
            "url": "",
            "sequence": {
                "sequence": "MFKLPTISLLLVSWSCLVALSQAKTYSLPDLTTDYNNAIPVDEEEAQDPFASCKIYCEGNLLHTIQTAVPKLFADSKTFVDMKLNNSPDKTLEDFNAMMEAKNQTPSSEDLKQFVDKYFSAPGTELEKWTPTDWKENPSFLDLISDPDLKQWGVELNSIWKDLGRKMKDEVSKNPEYYSIIPVPNPVIVPGGRFIEFYYWDSYWIIRGLLYSQMFDTARGMIENFFSIVNRFGFIPNGGRVYYHGRSQPPLLTGMVKSYVDFTNDDKFAIDALDTLEHEFEFFVNNHNVTVKNHSLCVYRDSSSGPRPESYREDVETGEEFPTDEAKELHYSELKAGAESGMDFSSRWFISPTGTNDGNRSALSTTSIVPVDLNAYLYWNAKLIAEFHSKAGNTKKVTEYETKAEKLLLGIQEVLWNEEAGVWLDYDMINQKPRDYYTPTNLSPLWVKAFNISESEKISASVMAYIERNKLDSFPGGVPNTLSYTGEQWDAPNVWAPMQYILVEGLNNLNTPEAKNMSLKWATRWVKTNFAAFSKDRHMYEKYNADEFGVGGGGGEYEVQTGFGWSNGVIIEWLSKHGRDISIGSGCGCLAGEKRQ",
                "length": 596,
                "header": "sp|Q9W2M2-1|TREA_DROME Isoform 1 of Trehalase  OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1 CANONICAL=Q9W2M2-1"
            },
            "locus": {
                "chromosome": "2R",
                "start_pos": 21086951,
                "end_pos": 21084541,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0071540",
                        "url": "https://www.ensembl.org/id/FBtr0071540"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0071469",
                        "url": "https://www.ensembl.org/id/FBpp0071469"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q9W2M2-2",
            "url": "",
            "sequence": {
                "sequence": "MASPANPSSNHKMNGNGKIYCEGNLLHTIQTAVPKLFADSKTFVDMKLNNSPDKTLEDFNAMMEAKNQTPSSEDLKQFVDKYFSAPGTELEKWTPTDWKENPSFLDLISDPDLKQWGVELNSIWKDLGRKMKDEVSKNPEYYSIIPVPNPVIVPGGRFIEFYYWDSYWIIRGLLYSQMFDTARGMIENFFSIVNRFGFIPNGGRVYYHGRSQPPLLTGMVKSYVDFTNDDKFAIDALDTLEHEFEFFVNNHNVTVKNHSLCVYRDSSSGPRPESYREDVETGEEFPTDEAKELHYSELKAGAESGMDFSSRWFISPTGTNDGNRSALSTTSIVPVDLNAYLYWNAKLIAEFHSKAGNTKKVTEYETKAEKLLLGIQEVLWNEEAGVWLDYDMINQKPRDYYTPTNLSPLWVKAFNISESEKISASVMAYIERNKLDSFPGGVPNTLSYTGEQWDAPNVWAPMQYILVEGLNNLNTPEAKNMSLKWATRWVKTNFAAFSKDRHMYEKYNADEFGVGGGGGEYEVQTGFGWSNGVIIEWLSKHGRDISIGSGCGCLAGEKRQ",
                "length": 560,
                "header": "sp|Q9W2M2-2|TREA_DROME Isoform 2 of Trehalase  OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1 CANONICAL=Q9W2M2-1"
            },
            "locus": {
                "chromosome": "2R",
                "start_pos": 21086951,
                "end_pos": 21077090,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0071535",
                        "url": "https://www.ensembl.org/id/FBtr0071535"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0071464",
                        "url": "https://www.ensembl.org/id/FBpp0071464"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q9W2M2-3",
            "url": "",
            "sequence": {
                "sequence": "MKLNNSPDKTLEDFNAMMEAKNQTPSSEDLKQFVDKYFSAPGTELEKWTPTDWKENPSFLDLISDPDLKQWGVELNSIWKDLGRKMKDEVSKNPEYYSIIPVPNPVIVPGGRFIEFYYWDSYWIIRGLLYSQMFDTARGMIENFFSIVNRFGFIPNGGRVYYHGRSQPPLLTGMVKSYVDFTNDDKFAIDALDTLEHEFEFFVNNHNVTVKNHSLCVYRDSSSGPRPESYREDVETGEEFPTDEAKELHYSELKAGAESGMDFSSRWFISPTGTNDGNRSALSTTSIVPVDLNAYLYWNAKLIAEFHSKAGNTKKVTEYETKAEKLLLGIQEVLWNEEAGVWLDYDMINQKPRDYYTPTNLSPLWVKAFNISESEKISASVMAYIERNKLDSFPGGVPNTLSYTGEQWDAPNVWAPMQYILVEGLNNLNTPEAKNMSLKWATRWVKTNFAAFSKDRHMYEKYNADEFGVGGGGGEYEVQTGFGWSNGVIIEWLSKHGRDISIGSGCGCLAGEKRQ",
                "length": 515,
                "header": "sp|Q9W2M2-3|TREA_DROME Isoform 3 of Trehalase  OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1 CANONICAL=Q9W2M2-1"
            },
            "locus": {
                "chromosome": "2R",
                "start_pos": 21086951,
                "end_pos": 21085283,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0071538",
                        "url": "https://www.ensembl.org/id/FBtr0071538"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0071467",
                        "url": "https://www.ensembl.org/id/FBpp0071467"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 288,
            "start_aa": "Asn",
            "end_pos": 288,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn288",
            "evidence": [
                {
                    "id": "Q9W2M2",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9W2M2#ptm_processing"
                },
                {
                    "id": "PRU00498",
                    "database": "PROSITE-PRORULE",
                    "url": "https://prosite.expasy.org/rule/PRU00498"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 293,
            "start_aa": "Asn",
            "end_pos": 293,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn293",
            "evidence": [
                {
                    "id": "Q9W2M2",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9W2M2#ptm_processing"
                },
                {
                    "id": "PRU00498",
                    "database": "PROSITE-PRORULE",
                    "url": "https://prosite.expasy.org/rule/PRU00498"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 359,
            "start_aa": "Asn",
            "end_pos": 359,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn359",
            "evidence": [
                {
                    "id": "Q9W2M2",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9W2M2#ptm_processing"
                },
                {
                    "id": "PRU00498",
                    "database": "PROSITE-PRORULE",
                    "url": "https://prosite.expasy.org/rule/PRU00498"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 451,
            "start_aa": "Asn",
            "end_pos": 451,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn451",
            "evidence": [
                {
                    "id": "Q9W2M2",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9W2M2#ptm_processing"
                },
                {
                    "id": "17893096",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/17893096"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 516,
            "start_aa": "Asn",
            "end_pos": 516,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn516",
            "evidence": [
                {
                    "id": "Q9W2M2",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9W2M2#ptm_processing"
                },
                {
                    "id": "PRU00498",
                    "database": "PROSITE-PRORULE",
                    "url": "https://prosite.expasy.org/rule/PRU00498"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "enzyme",
        "glycohydrolase-activity",
        "glycoprotein",
        "glycoprotein_reported"
    ],
    "publication": [
        {
            "title": "The genome sequence of Drosophila melanogaster.",
            "journal": "Science",
            "date": "2000",
            "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9W2M2",
                    "url": "https://www.uniprot.org/uniprot/Q9W2M2"
                },
                {
                    "database": "UniProtKB",
                    "id": "A4UZR3",
                    "url": "https://www.uniprot.org/uniprot/A4UZR3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10731132",
                    "url": "https://glygen.org/publication/PubMed/10731132"
                }
            ]
        },
        {
            "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A4UZR3",
                    "url": "https://www.uniprot.org/uniprot/A4UZR3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537568",
                    "url": "https://glygen.org/publication/PubMed/12537568"
                }
            ]
        },
        {
            "title": "A Drosophila full-length cDNA resource.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9W2M2",
                    "url": "https://www.uniprot.org/uniprot/Q9W2M2"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537569",
                    "url": "https://glygen.org/publication/PubMed/12537569"
                }
            ]
        },
        {
            "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9W2M2",
                    "url": "https://www.uniprot.org/uniprot/Q9W2M2"
                },
                {
                    "database": "UniProtKB",
                    "id": "A4UZR3",
                    "url": "https://www.uniprot.org/uniprot/A4UZR3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537572",
                    "url": "https://glygen.org/publication/PubMed/12537572"
                }
            ]
        },
        {
            "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A4UZR3",
                    "url": "https://www.uniprot.org/uniprot/A4UZR3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537573",
                    "url": "https://glygen.org/publication/PubMed/12537573"
                }
            ]
        },
        {
            "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A4UZR3",
                    "url": "https://www.uniprot.org/uniprot/A4UZR3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537574",
                    "url": "https://glygen.org/publication/PubMed/12537574"
                }
            ]
        },
        {
            "title": "Combined evidence annotation of transposable elements in genome sequences.",
            "journal": "PLoS Comput. Biol.",
            "date": "2005",
            "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A4UZR3",
                    "url": "https://www.uniprot.org/uniprot/A4UZR3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16110336",
                    "url": "https://glygen.org/publication/PubMed/16110336"
                }
            ]
        },
        {
            "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.",
            "journal": "Science",
            "date": "2007",
            "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A4UZR3",
                    "url": "https://www.uniprot.org/uniprot/A4UZR3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17569856",
                    "url": "https://glygen.org/publication/PubMed/17569856"
                }
            ]
        },
        {
            "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.",
            "journal": "Science",
            "date": "2007",
            "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A4UZR3",
                    "url": "https://www.uniprot.org/uniprot/A4UZR3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17569867",
                    "url": "https://glygen.org/publication/PubMed/17569867"
                }
            ]
        },
        {
            "title": "Identification of N-glycosylated proteins from the central nervous system of Drosophila melanogaster.",
            "journal": "Glycobiology",
            "date": "2007",
            "authors": "Koles K, Lim JM, Aoki K, Porterfield M, Tiemeyer M, Wells L, Panin V",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9W2M2",
                    "url": "https://www.uniprot.org/uniprot/Q9W2M2#ptm_processing"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9W2M2",
                    "url": "https://www.uniprot.org/uniprot/Q9W2M2"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17893096",
                    "url": "https://glygen.org/publication/PubMed/17893096"
                }
            ]
        },
        {
            "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.",
            "journal": "Genome Res.",
            "date": "2015",
            "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A4UZR3",
                    "url": "https://www.uniprot.org/uniprot/A4UZR3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25589440",
                    "url": "https://glygen.org/publication/PubMed/25589440"
                }
            ]
        },
        {
            "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.",
            "journal": "G3 (Bethesda)",
            "date": "2015",
            "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A4UZR3",
                    "url": "https://www.uniprot.org/uniprot/A4UZR3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26109356",
                    "url": "https://glygen.org/publication/PubMed/26109356"
                }
            ]
        },
        {
            "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.",
            "journal": "G3 (Bethesda)",
            "date": "2015",
            "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A4UZR3",
                    "url": "https://www.uniprot.org/uniprot/A4UZR3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26109357",
                    "url": "https://glygen.org/publication/PubMed/26109357"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "dme:Dmel_CG9364",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG9364",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "O43280-1",
            "protein_name": "Trehalase",
            "gene_name": "TREH",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MPGRTWELCLLLLLGLGLGSQEALPPPCESEIYCHGELLNQVQMAKLYQDDKQFVDMPLSIAPEQVLQTFTELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKISDAKLRAWAGQLHQLWKKLGKKMKPEVLSHPERFSLIYSEHPFIVPGGRFVEFYYWDSYWVMEGLLLSEMAETVKGMLQNFLDLVKTYGHVPNGGRVYYLQRSQPPLLTLMMDCYLTHTNDTAFLQENIETLALELDFWTKNRTVSVSLEGKNYLLNRYYVPYGGPRPESYSKDVELADTLPEGDREALWAELKAGAESGWDFSSRWLIGGPNPNSLSGIRTSKLVPVDLNAFLCQAEELMSNFYSRLGNDSQATKYRILRSQRLAALNTVLWDEQTGAWFDYDLEKKKKNREFYPSNLTPLWAGCFSDPGVADKALKYLEDNRILTYQYGIPTSLQKTGQQWDFPNAWAPLQDLVIRGLAKAPLRRAQEVAFQLAQNWIRTNFDVYSQKSAMYEKYDVSNGGQPGGGGEYEVQEGFGWTNGVVLMLLDRYGDRLTSGAKLAFLEPHCLAATLLPSLLLSLLPW",
                "length": 583
            },
            "evidence": [
                {
                    "id": "Q9W2M2",
                    "url": "https://omabrowser.org/oma/group/Q9W2M2/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q9JLT2-1",
            "protein_name": "Trehalase",
            "gene_name": "Treh",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MTWELHLLLLLGLGLRSQEALPPPCESQIYCHGELLHQVQMAQLYQDDKQFVDMSLATSPDEVLQKFSELATVHNHSIPKEQLQEFVQSHFQPVGQELQSWTPEDWKDSPQFLQKISDANLRVWAEELHKIWKKLGKKMKAEVLSYPERSSLIYSKHPFIVPGGRFVEFYYWDSYWVMEGLLLSEMASTVKGMLQNFLDLVKTYGHIPNGGRIYYLQRSQPPLLTLMMDRYVAHTKDVAFLQENIGTLASELDFWTVNRTVSVVSGGQSYVLNRYYVPYGGPRPESYRKDAELANSVPEGDRETLWAELKAGAESGWDFSSRWLVGGPDPDLLSSIRTSKMVPADLNAFLCQAEELMSNFYSRLGNDTEATKYRNLRAQRLAAMEAVLWDEQKGAWFDYDLEKGKKNLEFYPSNLSPLWAGCFSDPSVADKALKYLEDSKILTYQYGIPTSLRNTGQQWDFPNAWAPLQDLVIRGLAKSASPRTQEVAFQLAQNWIKTNFKVYSQKSAMFEKYDISNGGHPGGGGEYEVQEGFGWTNGLALMLLDRYGDQLTSGTQLASLGPHCLVAALLLSLLLQ",
                "length": 576
            },
            "evidence": [
                {
                    "id": "Q9W2M2",
                    "url": "https://omabrowser.org/oma/group/Q9W2M2/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "cytoplasm",
                        "id": "GO:0005737",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9W2M2",
                                "url": "https://www.uniprot.org/uniprot/Q9W2M2"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 3,
                "go_terms": [
                    {
                        "name": "neuronal stem cell population maintenance",
                        "id": "GO:0097150",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097150",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9W2M2",
                                "url": "https://www.uniprot.org/uniprot/Q9W2M2"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "trehalose metabolic process",
                        "id": "GO:0005991",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005991",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9W2M2",
                                "url": "https://www.uniprot.org/uniprot/Q9W2M2"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "trehalose catabolic process",
                        "id": "GO:0005993",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005993",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9W2M2",
                                "url": "https://www.uniprot.org/uniprot/Q9W2M2"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "alpha,alpha-trehalase activity",
                        "id": "GO:0004555",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004555",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9W2M2",
                                "url": "https://www.uniprot.org/uniprot/Q9W2M2"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 103,
            "end_pos": 105,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 288,
            "end_pos": 290,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 293,
            "end_pos": 295,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 359,
            "end_pos": 361,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 441,
            "end_pos": 443,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 451,
            "end_pos": 453,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 516,
            "end_pos": 518,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 85,
            "end_pos": 87,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [
        {
            "id": "32675",
            "name": "",
            "equation": "alpha,alpha-trehalose + H2O = alpha-D-glucose + beta-D-glucose",
            "summary": "",
            "cellular_location": "",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "G3V7Q9-1",
                "O43280-1",
                "Q9JLT2-1",
                "P32356-1",
                "P48016-1",
                "P35172-1",
                "Q54QZ5-1",
                "Q9W2M2-1",
                "A1ZAE9-1"
            ],
            "evidence": [
                {
                    "id": "32675",
                    "database": "Rhea",
                    "url": "https://www.rhea-db.org/rhea/32675"
                }
            ]
        }
    ],
    "reaction_participants": [],
    "reaction_enzymes": [
        {
            "uniprot_ac": "A1ZAE9",
            "gene_name": "Dmel\\CG6262",
            "activity": [
                {
                    "ec_number": "3.2.1.28",
                    "activity": "alpha,alpha-trehalose + H2O = alpha-D-glucose + beta-D-glucose.",
                    "evidence": [
                        {
                            "id": "A1ZAE9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A1ZAE9"
                        }
                    ]
                },
                {
                    "ec_number": "3.2.1.28",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A1ZAE9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A1ZAE9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "G3V7Q9",
            "gene_name": "Treh",
            "activity": [
                {
                    "ec_number": "3.2.1.28",
                    "activity": "alpha,alpha-trehalose + H2O = alpha-D-glucose + beta-D-glucose.",
                    "evidence": [
                        {
                            "id": "G3V7Q9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V7Q9"
                        }
                    ]
                },
                {
                    "ec_number": "3.2.1.28",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V7Q9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V7Q9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O43280",
            "gene_name": "TREH",
            "activity": [
                {
                    "ec_number": "3.2.1.28",
                    "activity": "alpha,alpha-trehalose + H2O = alpha-D-glucose + beta-D-glucose.",
                    "evidence": [
                        {
                            "id": "O43280",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43280"
                        }
                    ]
                },
                {
                    "ec_number": "3.2.1.28",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O43280",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43280"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P32356",
            "gene_name": "NTH1",
            "activity": [
                {
                    "ec_number": "3.2.1.28",
                    "activity": "alpha,alpha-trehalose + H2O = alpha-D-glucose + beta-D-glucose.",
                    "evidence": [
                        {
                            "id": "P32356",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32356"
                        }
                    ]
                },
                {
                    "ec_number": "3.2.1.28",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P32356",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32356"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35172",
            "gene_name": "NTH2",
            "activity": [
                {
                    "ec_number": "3.2.1.28",
                    "activity": "alpha,alpha-trehalose + H2O = alpha-D-glucose + beta-D-glucose.",
                    "evidence": [
                        {
                            "id": "P35172",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35172"
                        }
                    ]
                },
                {
                    "ec_number": "3.2.1.28",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35172",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35172"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P48016",
            "gene_name": "ATH1",
            "activity": [
                {
                    "ec_number": "3.2.1.28",
                    "activity": "alpha,alpha-trehalose + H2O = alpha-D-glucose + beta-D-glucose.",
                    "evidence": [
                        {
                            "id": "P48016",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48016"
                        }
                    ]
                },
                {
                    "ec_number": "3.2.1.28",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P48016",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48016"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54QZ5",
            "gene_name": "treh",
            "activity": [
                {
                    "ec_number": "3.2.1.28",
                    "activity": "alpha,alpha-trehalose + H2O = alpha-D-glucose + beta-D-glucose.",
                    "evidence": [
                        {
                            "id": "Q54QZ5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54QZ5"
                        }
                    ]
                },
                {
                    "ec_number": "3.2.1.28",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54QZ5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54QZ5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9JLT2",
            "gene_name": "Treh",
            "activity": [
                {
                    "ec_number": "3.2.1.28",
                    "activity": "alpha,alpha-trehalose + H2O = alpha-D-glucose + beta-D-glucose.",
                    "evidence": [
                        {
                            "id": "Q9JLT2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9JLT2"
                        }
                    ]
                },
                {
                    "ec_number": "3.2.1.28",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9JLT2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9JLT2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9W2M2",
            "gene_name": "Treh",
            "activity": [
                {
                    "ec_number": "3.2.1.28",
                    "activity": "alpha,alpha-trehalose + H2O = alpha-D-glucose + beta-D-glucose.",
                    "evidence": [
                        {
                            "id": "Q9W2M2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9W2M2"
                        }
                    ]
                },
                {
                    "ec_number": "3.2.1.28",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9W2M2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9W2M2"
                        }
                    ]
                }
            ]
        }
    ],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 5
                },
                {
                    "field": "total_sites",
                    "count": 5
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 5
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 5
                },
                {
                    "field": "total_sites",
                    "count": 5
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 5
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 13
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}