{ "uniprot_canonical_ac": "Q9VZN1-1", "uniprot_ac": "Q9VZN1", "uniprot_id": "Q9VZN1_DROME", "mass": { "chemical_mass": 48865.0, "monoisotopic_mass": 48865.0 }, "refseq": { "ac": "NP_647826", "name": "pickpocket 27", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_647826" }, "gene_names": [ { "name": "ppk27", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9VZN1", "id": "Q9VZN1" }, { "name": "CG10858; Dmel\\CG10858; Ppk27", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_647826", "id": "NP_647826" }, { "name": "CG10858", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VZN1", "id": "Q9VZN1" }, { "name": "Dmel\\CG10858", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VZN1", "id": "Q9VZN1" }, { "name": "Dmel_CG10858", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VZN1", "id": "Q9VZN1" }, { "name": "Ppk27", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VZN1", "id": "Q9VZN1" }, { "name": "ppk27", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_647826", "id": "NP_647826" } ], "protein_names": [ { "name": "CG10858-PB; ppk27-PB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_647826", "id": "NP_647826" }, { "name": "Pickpocket 27", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VZN1" }, { "name": "pickpocket 27", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_647826", "id": "NP_647826" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "ppk27", "url": "https://www.uniprot.org/uniprot/Q9VZN1", "locus": { "chromosome": "3L", "start_pos": 3753693, "end_pos": 3755201, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0035458", "url": "https://www.ensembl.org/id/FBgn0035458" } ] } } ], "crossref": [ { "id": "FBgn0035458", "url": "https://bgee.org/?page=gene&gene_id=FBgn0035458", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0035458", "url": "https://flybase.org/reports/FBgn0035458", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "38440", "url": "https://www.ncbi.nlm.nih.gov/gene/38440", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001873", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001873", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG10858", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG10858", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "LKICSGY", "url": "https://omabrowser.org/oma/group/LKICSGY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3414706at2759", "url": "http://www.orthodb.org/?query=3414706at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11690", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11690", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11690:SF237", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11690:SF237", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00858", "url": "http://pfam.xfam.org/family/PF00858", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_647826", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_647826", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VZN1-1", "url": "https://www.uniprot.org/uniprot/Q9VZN1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSRIVTAFNKTVVEYFRKTSLNGFGLLYFIRKRRIQRIFWFLFISFGILFASYAVFSMVLEFLSYSTIADLSELKVLEDEIHFPELKICSGYKFSYRNMLASAHDLVSSQNKSLDYWLNKLSLLSGYFDALSVKAENVDDLNSLLDIKNISSFLLALTPACESLILKCKLNNIPANCLKLFTLKAYNDGNCCVLRNSNLTGELTLFMDSSQIDEYPLNGNLPGFSLHVPSWQGRVSINPGEMAAVEIEVMELQGNSQLNEYAVEKRACYFSQEGESREKCLHECRIKATLINCQCVPYPFEFRTQKFGYCTLENIRCLQLVERNWSPAQCPQCLPLCNQLFYRLNKQILGHLHPWRSELNFKFKTPHRQRYKTNILYHWYQMLSNVGGVLGICIGCSFISGFELIYFLVFRLWTNYLRQPET", "length": 422, "header": "tr|Q9VZN1-1|Q9VZN1_DROME Isoform 1 of Pickpocket 27 OS=Drosophila melanogaster OX=7227 GN=ppk27 PE=3 SV=2 CANONICAL=Q9VZN1-1" }, "isoforms": [ { "isoform_ac": "Q9VZN1-1", "url": "", "sequence": { "sequence": "MSRIVTAFNKTVVEYFRKTSLNGFGLLYFIRKRRIQRIFWFLFISFGILFASYAVFSMVLEFLSYSTIADLSELKVLEDEIHFPELKICSGYKFSYRNMLASAHDLVSSQNKSLDYWLNKLSLLSGYFDALSVKAENVDDLNSLLDIKNISSFLLALTPACESLILKCKLNNIPANCLKLFTLKAYNDGNCCVLRNSNLTGELTLFMDSSQIDEYPLNGNLPGFSLHVPSWQGRVSINPGEMAAVEIEVMELQGNSQLNEYAVEKRACYFSQEGESREKCLHECRIKATLINCQCVPYPFEFRTQKFGYCTLENIRCLQLVERNWSPAQCPQCLPLCNQLFYRLNKQILGHLHPWRSELNFKFKTPHRQRYKTNILYHWYQMLSNVGGVLGICIGCSFISGFELIYFLVFRLWTNYLRQPET", "length": 422, "header": "tr|Q9VZN1-1|Q9VZN1_DROME Isoform 1 of Pickpocket 27 OS=Drosophila melanogaster OX=7227 GN=ppk27 PE=3 SV=2 CANONICAL=Q9VZN1-1" }, "locus": { "chromosome": "3L", "start_pos": 3755089, "end_pos": 3753696, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0303094", "url": "https://www.ensembl.org/id/FBtr0303094" }, { "database": "Ensembl Peptide", "id": "FBpp0292213", "url": "https://www.ensembl.org/id/FBpp0292213" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] } ], "pathway": [ { "id": "dme:Dmel_CG10858", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG10858", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "sodium ion transmembrane transport", "id": "GO:0035725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035725", "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "pmid": "" }, { "name": "sodium ion transport", "id": "GO:0006814", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006814", "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "ligand-gated sodium channel activity", "id": "GO:0015280", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015280", "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "pmid": "" }, { "name": "sodium channel activity", "id": "GO:0005272", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005272", "evidence": [ { "database": "UniProtKB", "id": "Q9VZN1", "url": "https://www.uniprot.org/uniprot/Q9VZN1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 111, "end_pos": 113, "annotation": "n_glycosylation_sequon" }, { "start_pos": 149, "end_pos": 151, "annotation": "n_glycosylation_sequon" }, { "start_pos": 198, "end_pos": 200, "annotation": "n_glycosylation_sequon" }, { "start_pos": 324, "end_pos": 326, "annotation": "n_glycosylation_sequon" }, { "start_pos": 9, "end_pos": 11, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }