{
    "uniprot_canonical_ac": "Q9VWU1-1",
    "uniprot_ac": "Q9VWU1",
    "uniprot_id": "PSH_DROME",
    "mass": {
        "chemical_mass": 42228.0,
        "monoisotopic_mass": 42228.0
    },
    "refseq": {
        "ac": "NP_573297",
        "name": "persephone",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_573297"
    },
    "gene_names": [
        {
            "name": "psh",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9VWU1",
            "id": "Q9VWU1"
        },
        {
            "name": "CG6367",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VWU1",
            "id": "Q9VWU1"
        },
        {
            "name": "c-SP28; CG6367; cSP28; Dmel\\CG6367; Psh; PSH; SP28",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_573297",
            "id": "NP_573297"
        },
        {
            "name": "psh",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_573297",
            "id": "NP_573297"
        }
    ],
    "protein_names": [
        {
            "name": "Serine protease persephone",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q9VWU1"
        },
        {
            "name": "3.4.21.-",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9VWU1"
        },
        {
            "name": "CG6367-PA; psh-PA",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_573297",
            "id": "NP_573297"
        },
        {
            "name": "persephone",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_573297",
            "id": "NP_573297"
        }
    ],
    "function": [
        {
            "annotation": "Serine protease that plays a key role in innate immunity in response to Gram-positive bacterial and fungal proteases (PubMed:12098703, PubMed:18724373, PubMed:16399077). Acts as a component of the Toll pathway upstream of protease spz processing enzyme SPE and Tl ligand spz (PubMed:12098703, PubMed:18724373, PubMed:16399077). Nec regulates the cascade by inhibiting psh (PubMed:12098703).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VWU1",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1#function"
                },
                {
                    "database": "PubMed",
                    "id": "12098703",
                    "url": "https://glygen.org/publication/PubMed/12098703"
                },
                {
                    "database": "PubMed",
                    "id": "18724373",
                    "url": "https://glygen.org/publication/PubMed/18724373"
                },
                {
                    "database": "PubMed",
                    "id": "16399077",
                    "url": "https://glygen.org/publication/PubMed/16399077"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [
        {
            "start_pos": 187,
            "end_pos": 187,
            "sequence_org": "H",
            "sequence_mut": "Y",
            "comment": "In psh1 and psh4; immune response defective. Reduced levels of Drs following immune challenge with fungal or bacterial proteases.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VWU1",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                },
                {
                    "database": "PubMed",
                    "id": "12098703",
                    "url": "https://glygen.org/publication/PubMed/12098703"
                },
                {
                    "database": "PubMed",
                    "id": "21576362",
                    "url": "https://glygen.org/publication/PubMed/21576362"
                },
                {
                    "database": "PubMed",
                    "id": "18724373",
                    "url": "https://glygen.org/publication/PubMed/18724373"
                },
                {
                    "database": "PubMed",
                    "id": "16399077",
                    "url": "https://glygen.org/publication/PubMed/16399077"
                }
            ]
        },
        {
            "start_pos": 341,
            "end_pos": 341,
            "sequence_org": "G",
            "sequence_mut": "E",
            "comment": "In psh5; immune response defective.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VWU1",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                },
                {
                    "database": "PubMed",
                    "id": "12098703",
                    "url": "https://glygen.org/publication/PubMed/12098703"
                }
            ]
        }
    ],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Drosophila melanogaster",
            "taxid": 7227,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VWU1",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                }
            ],
            "common_name": "Fruit fly"
        }
    ],
    "gene": [
        {
            "name": "psh",
            "url": "https://www.uniprot.org/uniprot/Q9VWU1",
            "locus": {
                "chromosome": "X",
                "start_pos": 18484487,
                "end_pos": 18486921,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "FBgn0030926",
                        "url": "https://www.ensembl.org/id/FBgn0030926"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "FBgn0030926",
            "url": "https://bgee.org/?page=gene&gene_id=FBgn0030926",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "cd00190",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00190",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "FBgn0030926",
            "url": "https://flybase.org/reports/FBgn0030926",
            "database": "FlyBase",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "32832",
            "url": "https://www.ncbi.nlm.nih.gov/gene/32832",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR001254",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001254",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001314",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001314",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR009003",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR009003",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR018114",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR018114",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR022700",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR022700",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR033116",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR033116",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR043504",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR043504",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "dme:Dmel_CG6367",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG6367",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "CPNESSI",
            "url": "https://omabrowser.org/oma/group/CPNESSI/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "3676963at2759",
            "url": "http://www.orthodb.org/?query=3676963at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR24260:SF135",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24260:SF135",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00089",
            "url": "http://pfam.xfam.org/family/PF00089",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q9VWU1",
            "url": "http://purl.obolibrary.org/obo/PR_Q9VWU1",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_573297",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_573297",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9VWU1",
            "url": "https://www.uniprot.org/uniprot/Q9VWU1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9VWU1-1",
            "url": "https://www.uniprot.org/uniprot/Q9VWU1-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MPLKWSLLLGTFVLISCSSVEAAVTVGRACKVTDTMPGICRTSSDCEPLIDGYIKSGVLTLNDVPSCGLGAWGEIFCCPTKPCCDNSTITSVSTSSTTSTKAPMTSGRVDVPTFGSGDRPAVAACKKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIVIRSVKIHPQYVGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFIEGIVWPDNRV",
        "length": 394,
        "header": "sp|Q9VWU1-1|PSH_DROME Isoform 1 of Serine protease persephone  OS=Drosophila melanogaster OX=7227 GN=psh PE=1 SV=1 CANONICAL=Q9VWU1-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q9VWU1-1",
            "url": "",
            "sequence": {
                "sequence": "MPLKWSLLLGTFVLISCSSVEAAVTVGRACKVTDTMPGICRTSSDCEPLIDGYIKSGVLTLNDVPSCGLGAWGEIFCCPTKPCCDNSTITSVSTSSTTSTKAPMTSGRVDVPTFGSGDRPAVAACKKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIVIRSVKIHPQYVGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFIEGIVWPDNRV",
                "length": 394,
                "header": "sp|Q9VWU1-1|PSH_DROME Isoform 1 of Serine protease persephone  OS=Drosophila melanogaster OX=7227 GN=psh PE=1 SV=1 CANONICAL=Q9VWU1-1"
            },
            "locus": {
                "chromosome": "X",
                "start_pos": 18486138,
                "end_pos": 18484652,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0074629",
                        "url": "https://www.ensembl.org/id/FBtr0074629"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0074400",
                        "url": "https://www.ensembl.org/id/FBpp0074400"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 277,
            "start_aa": "Asn",
            "end_pos": 277,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn277",
            "evidence": [
                {
                    "id": "Q9VWU1",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 301,
            "start_aa": "Asn",
            "end_pos": 301,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn301",
            "evidence": [
                {
                    "id": "Q9VWU1",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 86,
            "start_aa": "Asn",
            "end_pos": 86,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn86",
            "evidence": [
                {
                    "id": "Q9VWU1",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "enzyme",
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "The genome sequence of Drosophila melanogaster.",
            "journal": "Science",
            "date": "2000",
            "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VWU1",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10731132",
                    "url": "https://glygen.org/publication/PubMed/10731132"
                }
            ]
        },
        {
            "title": "Activation of Drosophila Toll during fungal infection by a blood serine protease.",
            "journal": "Science",
            "date": "2002",
            "authors": "Ligoxygakis P, Pelte N, Hoffmann JA, Reichhart JM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VWU1",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12098703",
                    "url": "https://glygen.org/publication/PubMed/12098703"
                }
            ]
        },
        {
            "title": "A Drosophila full-length cDNA resource.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VWU1",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537569",
                    "url": "https://glygen.org/publication/PubMed/12537569"
                }
            ]
        },
        {
            "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VWU1",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537572",
                    "url": "https://glygen.org/publication/PubMed/12537572"
                }
            ]
        },
        {
            "title": "A Spatzle-processing enzyme required for toll signaling activation in Drosophila innate immunity.",
            "journal": "Dev. Cell",
            "date": "2006",
            "authors": "Jang IH, Chosa N, Kim SH, Nam HJ, Lemaitre B, Ochiai M, Kambris Z, Brun S, Hashimoto C, Ashida M, Brey PT, Lee WJ",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VWU1",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16399077",
                    "url": "https://glygen.org/publication/PubMed/16399077"
                }
            ]
        },
        {
            "title": "A screen for immunity genes evolving under positive selection in Drosophila.",
            "journal": "J. Evol. Biol.",
            "date": "2007",
            "authors": "Jiggins FM, Kim KW",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VWU1",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17465907",
                    "url": "https://glygen.org/publication/PubMed/17465907"
                }
            ]
        },
        {
            "title": "Sensing of 'danger signals' and pathogen-associated molecular patterns defines binary signaling pathways 'upstream' of Toll.",
            "journal": "Nat. Immunol.",
            "date": "2008",
            "authors": "El Chamy L, Leclerc V, Caldelari I, Reichhart JM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VWU1",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18724373",
                    "url": "https://glygen.org/publication/PubMed/18724373"
                }
            ]
        },
        {
            "title": "Spn1 regulates the GNBP3-dependent Toll signaling pathway in Drosophila melanogaster.",
            "journal": "Mol. Cell. Biol.",
            "date": "2011",
            "authors": "Fullaondo A, Garcia-Sanchez S, Sanz-Parra A, Recio E, Lee SY, Gubb D",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VWU1",
                    "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21576362",
                    "url": "https://glygen.org/publication/PubMed/21576362"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "dme:Dmel_CG6367",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG6367",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "serine-type endopeptidase activity",
                        "id": "GO:0004252",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004252",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VWU1",
                                "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "peptidase activity",
                        "id": "GO:0008233",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008233",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VWU1",
                                "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "extracellular region",
                        "id": "GO:0005576",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VWU1",
                                "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 10,
                "go_terms": [
                    {
                        "name": "proteolysis",
                        "id": "GO:0006508",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VWU1",
                                "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "innate immune response",
                        "id": "GO:0045087",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VWU1",
                                "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "defense response to Gram-positive bacterium",
                        "id": "GO:0050830",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VWU1",
                                "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "defense response to fungus",
                        "id": "GO:0050832",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050832",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VWU1",
                                "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cellular response to molecule of bacterial origin",
                        "id": "GO:0071219",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071219",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VWU1",
                                "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "antifungal innate immune response",
                        "id": "GO:0061760",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061760",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VWU1",
                                "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of antibacterial peptide biosynthetic process",
                        "id": "GO:0006963",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006963",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VWU1",
                                "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of antifungal peptide production",
                        "id": "GO:0002804",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002804",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VWU1",
                                "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of melanization defense response",
                        "id": "GO:0035008",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035008",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VWU1",
                                "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "Toll receptor ligand protein activation cascade",
                        "id": "GO:0160032",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0160032",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VWU1",
                                "url": "https://www.uniprot.org/uniprot/Q9VWU1"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 277,
            "end_pos": 279,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 301,
            "end_pos": 303,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 86,
            "end_pos": 88,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                },
                {
                    "field": "total_sites",
                    "count": 3
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 3
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                },
                {
                    "field": "total_sites",
                    "count": 3
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 3
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 8
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}