{ "uniprot_canonical_ac": "Q9VV60-1", "uniprot_ac": "Q9VV60", "uniprot_id": "Q9VV60_DROME", "mass": { "chemical_mass": 58159.0, "monoisotopic_mass": 58159.0 }, "refseq": { "ac": "NP_648895", "name": "Tyrosyl-tRNA synthetase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648895" }, "gene_names": [ { "name": "TyrRS", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9VV60", "id": "Q9VV60" }, { "name": "Aats-tyr; anon-EST:Posey261; CG4561; Dmel\\CG4561; dTyrRS; dYARS; EMAP; YARS; YRS", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648895", "id": "NP_648895" }, { "name": "Aats-tyr", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VV60", "id": "Q9VV60" }, { "name": "CG4561", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VV60", "id": "Q9VV60" }, { "name": "Dmel\\CG4561", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VV60", "id": "Q9VV60" }, { "name": "Dmel_CG4561", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VV60", "id": "Q9VV60" }, { "name": "EMAP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VV60", "id": "Q9VV60" }, { "name": "TyrRS", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648895", "id": "NP_648895" }, { "name": "YARS", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VV60", "id": "Q9VV60" }, { "name": "YRS", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VV60", "id": "Q9VV60" }, { "name": "anon-EST:Posey261", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VV60", "id": "Q9VV60" }, { "name": "dTyrRS", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VV60", "id": "Q9VV60" }, { "name": "dYARS", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VV60", "id": "Q9VV60" } ], "protein_names": [ { "name": "Tyrosine--tRNA ligase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9VV60" }, { "name": "6.1.1.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VV60" }, { "name": "CG4561-PA; TyrRS-PA; yars", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648895", "id": "NP_648895" }, { "name": "Tyrosyl-tRNA synthetase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648895", "id": "NP_648895" }, { "name": "Tyrosyl-tRNA synthetase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VV60" } ], "function": [], "disease": [ { "disease_id": "DOID:0110199", "recommended_name": { "id": "DOID:0110199", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110199", "name": "Charcot-Marie-Tooth disease dominant intermediate C", "description": "A Charcot-Marie-Tooth disease intermediate type that has_material_basis_in heterozygous mutation in the YARS gene on chromosome 1p35." }, "synonyms": [ { "id": "DOID:0110199", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110199", "name": "CMTDIC", "description": "" }, { "id": "DOID:0110199", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110199", "name": "DI-CMTC", "description": "" }, { "id": "DOID:0110199", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110199", "name": "Charcot-Marie-Tooth neuropathy dominant intermediate C", "description": "" }, { "id": "DOID:0110199", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110199", "name": "autosomal dominant intermediate Charcot-Marie-Tooth disease type C", "description": "" }, { "id": "MONDO:0012012", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012012", "name": "Charcot-Marie-Tooth disease dominant intermediate C", "description": "Autosomal dominant intermediate Charcot-Marie-Tooth disease type C is a rare hereditary motor and sensory neuropathy characterized by intermediate motor median nerve conduction velocities (usually between 25 and 60 m/s). It presents with moderately severe, slowly progressive usual clinical features of Charcot-Marie-Tooth disease (muscle weakness and atrophy of the distal extremities, distal sensory loss, reduced or absent deep tendon reflexes, feet deformities, extensor digitorum brevis atrophy). Findings in nerve biopsies include age-dependent axonal degeneration, reduced number of large myelinated fibers, segmental remyelination, and no onion bulbs." }, { "id": "MONDO:0012012", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012012", "name": "CMTDIC", "description": "" }, { "id": "MONDO:0012012", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012012", "name": "Charcot-Marie-Tooth disease caused by mutation in YARS", "description": "" }, { "id": "MONDO:0012012", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012012", "name": "Charcot-Marie-Tooth disease dominant intermediate type C", "description": "" }, { "id": "MONDO:0012012", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012012", "name": "Charcot-Marie-Tooth disease, dominant Intermediate type C", "description": "" }, { "id": "MONDO:0012012", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012012", "name": "Charcot-Marie-Tooth neuropathy dominant intermediate C", "description": "" }, { "id": "MONDO:0012012", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012012", "name": "DI-CMTC", "description": "" }, { "id": "MONDO:0012012", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012012", "name": "YARS Charcot-Marie-Tooth disease", "description": "" }, { "id": "MONDO:0012012", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012012", "name": "autosomal dominant intermediate Charcot-Marie-Tooth disease type C", "description": "" }, { "id": "MONDO:0012012", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012012", "name": "Charcot-Marie-Tooth disease, dominant intermediate C", "description": "" }, { "id": "MONDO:0012012", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012012", "name": "Charcot-Marie-Tooth neuropathy, dominant Intermediate C", "description": "" }, { "id": "MONDO:0012012", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012012", "name": "Di-Cmtc", "description": "" }, { "id": "MONDO:0012012", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012012", "name": "YARS-related intermediate Charcot-Marie-Tooth neuropathy", "description": "" }, { "id": "MIM:608323", "resource": "MIM", "url": "https://www.omim.org/entry/608323", "name": "Charcot-Marie-Tooth disease, dominant intermediate C", "description": "Charcot-Marie-Tooth disease, dominant intermediate C" } ], "evidence": [ { "id": "0110199", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110199" } ] }, { "disease_id": "DOID:070355", "recommended_name": { "id": "DOID:070355", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:070355", "name": "multisystem proteinopathy", "description": "A motor neuron disease that has_material_basis_in some inheritance and affects muscle, bone, and the nervous system." }, "synonyms": [], "evidence": [ { "id": "070355", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:070355" } ] }, { "disease_id": "DOID:10595", "recommended_name": { "id": "DOID:10595", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10595", "name": "Charcot-Marie-Tooth disease", "description": "A neuromuscular disease that is characterized by a slowly progressive degeneration of the muscles of the foot, lower leg, hand and forearm." }, "synonyms": [ { "id": "DOID:10595", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10595", "name": "CMT - Charcot-Marie-Tooth disease", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth disease type 1A", "description": "Charcot-Marie-Tooth disease type 1A (CMT1A) is a type ofinherited neurological disorder that affects the peripheral nerves. Affected individuals experience weakness and wasting (atrophy) of the muscles of the lower legs beginning in adolescence; later they experience hand weakness and sensory loss. CMT1A is caused byhaving an extra copy (a duplication) of the PMP22 gene. It is inherited in an autosomal dominant manner. Treatment for this condition may include physical therapy ; occupational therapy ; braces and other orthopedic devices; orthopedic surgery;and pain medications." }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "CMT1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth disease type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth disease, type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth neuropathy type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth syndrome type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "HMSN1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "autosomal dominant Charcot-Marie-Tooth disease with focally folded myelin sheaths type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "hereditary motor and sensory neuropathy 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "microduplication 17p12", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "CMT 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot Marie Tooth disease type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth disease, autosomal dominant, with focally folded myelin sheaths, type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth disease, demyelinating, type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth neuropathy, type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "HMSN 1A", "description": "" }, { "id": "MIM:118220", "resource": "MIM", "url": "https://www.omim.org/entry/118220", "name": "Charcot-Marie-Tooth disease, demyelinating, 1A", "description": "Charcot-Marie-Tooth disease, demyelinating, 1A" } ], "evidence": [ { "id": "10595", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10595" } ] }, { "disease_id": "DOID:162", "recommended_name": { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "cancer", "description": "A disease of cellular proliferation that is malignant and primary, characterized by uncontrolled cellular proliferation, local cell invasion and metastasis." }, "synonyms": [ { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant neoplasm", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant tumor", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "primary cancer", "description": "" } ], "evidence": [ { "id": "162", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:162" } ] }, { "disease_id": "DOID:870", "recommended_name": { "id": "DOID:870", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:870", "name": "neuropathy", "description": "A nervous system disease that is located_in nerves or nerve cells." }, "synonyms": [ { "id": "DOID:870", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:870", "name": "peripheral neuropathy", "description": "" } ], "evidence": [ { "id": "870", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:870" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "TyrRS", "url": "https://www.uniprot.org/uniprot/Q9VV60", "locus": { "chromosome": "3L", "start_pos": 16417349, "end_pos": 16419302, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0027080", "url": "https://www.ensembl.org/id/FBgn0027080" } ] } } ], "crossref": [ { "id": "FBgn0027080", "url": "https://bgee.org/?page=gene&gene_id=FBgn0027080", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00805", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00805", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd02799", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02799", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0027080", "url": "https://flybase.org/reports/FBgn0027080", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "39829", "url": "https://www.ncbi.nlm.nih.gov/gene/39829", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9VV60", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9VV60*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002305", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002305", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002307", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002307", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002547", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002547", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012340", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012340", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014729", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014729", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG4561", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG4561", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ERPEKFG", "url": "https://omabrowser.org/oma/group/ERPEKFG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1405752at2759", "url": "http://www.orthodb.org/?query=1405752at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11586", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11586", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11586:SF43", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11586:SF43", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00579", "url": "http://pfam.xfam.org/family/PF00579", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01588", "url": "http://pfam.xfam.org/family/PF01588", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_648895", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648895", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "10220", "url": "https://www.rhea-db.org/rhea/10220", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VV60-1", "url": "https://www.uniprot.org/uniprot/Q9VV60-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVGITPAEKKALITRNLQETLGDDKLTKILAERDLKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWSLLELRTKYYEQVIKAMLSSIGVPLEKLKFVKGSDYQLSKEYTLDVYKLSSVVTQHDAKKAGAEVVKQVEYPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFSEKYLPQLGYEKRIHFMNPMVPGLAGGKMSSSEEDSKIDLLDSPANVKKKLKKAFCEPGNIADNGLLSFVKHVLFSLFKEGEGFEVNREAEHGGDVTFLKYEDLEKYYAEDKLHPGDLKATVEKYINRLLDPIRKAFENPELQKLSAAAYPPPAKVKAGAAPAAGADEDAPHRLDIRVGKVVEVARHPDADTLYVLKIDLAEAQPRTIISGLVKFVTEEELNQRLVAVLCNLKPSKMRGILSEGMVLCTSNADHTVVEPIVLPATATAGSRLSFEGFSGTPDEQLNPKKKVWEKLSADFKTNSDGLAVWKDNFLLTPEGEKLSSKLANCSIK", "length": 525, "header": "tr|Q9VV60-1|Q9VV60_DROME Isoform 1 of Tyrosine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=TyrRS PE=1 SV=1 CANONICAL=Q9VV60-1" }, "isoforms": [ { "isoform_ac": "Q9VV60-1", "url": "", "sequence": { "sequence": "MVGITPAEKKALITRNLQETLGDDKLTKILAERDLKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWSLLELRTKYYEQVIKAMLSSIGVPLEKLKFVKGSDYQLSKEYTLDVYKLSSVVTQHDAKKAGAEVVKQVEYPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFSEKYLPQLGYEKRIHFMNPMVPGLAGGKMSSSEEDSKIDLLDSPANVKKKLKKAFCEPGNIADNGLLSFVKHVLFSLFKEGEGFEVNREAEHGGDVTFLKYEDLEKYYAEDKLHPGDLKATVEKYINRLLDPIRKAFENPELQKLSAAAYPPPAKVKAGAAPAAGADEDAPHRLDIRVGKVVEVARHPDADTLYVLKIDLAEAQPRTIISGLVKFVTEEELNQRLVAVLCNLKPSKMRGILSEGMVLCTSNADHTVVEPIVLPATATAGSRLSFEGFSGTPDEQLNPKKKVWEKLSADFKTNSDGLAVWKDNFLLTPEGEKLSSKLANCSIK", "length": 525, "header": "tr|Q9VV60-1|Q9VV60_DROME Isoform 1 of Tyrosine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=TyrRS PE=1 SV=1 CANONICAL=Q9VV60-1" }, "locus": { "chromosome": "3L", "start_pos": 16419243, "end_pos": 16417486, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0075410", "url": "https://www.ensembl.org/id/FBtr0075410" }, { "database": "Ensembl Peptide", "id": "FBpp0075168", "url": "https://www.ensembl.org/id/FBpp0075168" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.", "journal": "Genome Res.", "date": "2015", "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "reference": [ { "type": "PubMed", "id": "25589440", "url": "https://glygen.org/publication/PubMed/25589440" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "reference": [ { "type": "PubMed", "id": "26109356", "url": "https://glygen.org/publication/PubMed/26109356" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "reference": [ { "type": "PubMed", "id": "26109357", "url": "https://glygen.org/publication/PubMed/26109357" } ] } ], "pathway": [ { "id": "dme:Dmel_CG4561", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG4561", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "pmid": "" }, { "name": "tRNA binding", "id": "GO:0000049", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000049", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "pmid": "" }, { "name": "tyrosine-tRNA ligase activity", "id": "GO:0004831", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004831", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "tyrosyl-tRNA aminoacylation", "id": "GO:0006437", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006437", "evidence": [ { "database": "UniProtKB", "id": "Q9VV60", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 521, "end_pos": 523, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "10220", "name": "", "equation": "ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q4KM49-1", "Q5I0L3-1", "P54577-1", "Q9Y2Z4-1", "Q91WQ3-1", "Q8BYL4-1", "P36421-1", "P48527-1", "Q551A1-1", "Q54WD9-1", "Q9W107-1", "Q9VV60-1" ], "evidence": [ { "id": "10220", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10220" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P36421", "gene_name": "TYS1", "activity": [ { "ec_number": "6.1.1.1", "activity": "ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr).", "evidence": [ { "id": "P36421", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36421" } ] }, { "ec_number": "6.1.1.1", "activity": "", "evidence": [ { "id": "P36421", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36421" } ] } ] }, { "uniprot_ac": "P48527", "gene_name": "MSY1", "activity": [ { "ec_number": "6.1.1.1", "activity": "ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr).", "evidence": [ { "id": "P48527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48527" } ] }, { "ec_number": "6.1.1.1", "activity": "", "evidence": [ { "id": "P48527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48527" } ] } ] }, { "uniprot_ac": "P54577", "gene_name": "YARS1", "activity": [ { "ec_number": "6.1.1.1", "activity": "ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr).", "evidence": [ { "id": "P54577", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54577" } ] }, { "ec_number": "6.1.1.1", "activity": "", "evidence": [ { "id": "P54577", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54577" } ] } ] }, { "uniprot_ac": "Q4KM49", "gene_name": "Yars1", "activity": [ { "ec_number": "6.1.1.1", "activity": "ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr).", "evidence": [ { "id": "Q4KM49", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM49" } ] }, { "ec_number": "6.1.1.1", "activity": "", "evidence": [ { "id": "Q4KM49", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM49" } ] } ] }, { "uniprot_ac": "Q54WD9", "gene_name": "mtyrS", "activity": [ { "ec_number": "6.1.1.1", "activity": "ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr).", "evidence": [ { "id": "Q54WD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WD9" } ] }, { "ec_number": "6.1.1.1", "activity": "", "evidence": [ { "id": "Q54WD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WD9" } ] } ] }, { "uniprot_ac": "Q551A1", "gene_name": "tyrS", "activity": [ { "ec_number": "6.1.1.1", "activity": "ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr).", "evidence": [ { "id": "Q551A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q551A1" } ] }, { "ec_number": "6.1.1.1", "activity": "", "evidence": [ { "id": "Q551A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q551A1" } ] } ] }, { "uniprot_ac": "Q5I0L3", "gene_name": "Yars2", "activity": [ { "ec_number": "6.1.1.1", "activity": "ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr).", "evidence": [ { "id": "Q5I0L3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5I0L3" } ] }, { "ec_number": "6.1.1.1", "activity": "", "evidence": [ { "id": "Q5I0L3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5I0L3" } ] } ] }, { "uniprot_ac": "Q8BYL4", "gene_name": "Yars2", "activity": [ { "ec_number": "6.1.1.1", "activity": "ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr).", "evidence": [ { "id": "Q8BYL4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYL4" } ] }, { "ec_number": "6.1.1.1", "activity": "", "evidence": [ { "id": "Q8BYL4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYL4" } ] } ] }, { "uniprot_ac": "Q91WQ3", "gene_name": "Yars1", "activity": [ { "ec_number": "6.1.1.1", "activity": "ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr).", "evidence": [ { "id": "Q91WQ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WQ3" } ] }, { "ec_number": "6.1.1.1", "activity": "", "evidence": [ { "id": "Q91WQ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WQ3" } ] } ] }, { "uniprot_ac": "Q9VV60", "gene_name": "TyrRS", "activity": [ { "ec_number": "6.1.1.1", "activity": "ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr).", "evidence": [ { "id": "Q9VV60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ] }, { "ec_number": "6.1.1.1", "activity": "", "evidence": [ { "id": "Q9VV60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VV60" } ] } ] }, { "uniprot_ac": "Q9W107", "gene_name": "TyrRS-m", "activity": [ { "ec_number": "6.1.1.1", "activity": "ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr).", "evidence": [ { "id": "Q9W107", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W107" } ] }, { "ec_number": "6.1.1.1", "activity": "", "evidence": [ { "id": "Q9W107", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W107" } ] } ] }, { "uniprot_ac": "Q9Y2Z4", "gene_name": "YARS2", "activity": [ { "ec_number": "6.1.1.1", "activity": "ATP + L-tyrosine + tRNA(Tyr) = AMP + diphosphate + H(+) + L-tyrosyl-tRNA(Tyr).", "evidence": [ { "id": "Q9Y2Z4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Z4" } ] }, { "ec_number": "6.1.1.1", "activity": "", "evidence": [ { "id": "Q9Y2Z4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Z4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }