{ "uniprot_canonical_ac": "Q9VU38-1", "uniprot_ac": "Q9VU38", "uniprot_id": "Q9VU38_DROME", "mass": { "chemical_mass": 37774.0, "monoisotopic_mass": 37774.0 }, "refseq": { "ac": "NP_729863", "name": "adenosine kinase 2, isoform B", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_729863" }, "gene_names": [ { "name": "Adk2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9VU38", "id": "Q9VU38" }, { "name": "AdenoK; AdoK; CG11255; DmAdk2; Dmel\\CG11255", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_729863", "id": "NP_729863" }, { "name": "AdenoK", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VU38", "id": "Q9VU38" }, { "name": "Adk2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_729863", "id": "NP_729863" }, { "name": "AdoK", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VU38", "id": "Q9VU38" }, { "name": "CG11255", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VU38", "id": "Q9VU38" }, { "name": "DmAdk2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VU38", "id": "Q9VU38" }, { "name": "Dmel\\CG11255", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VU38", "id": "Q9VU38" }, { "name": "Dmel_CG11255", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VU38", "id": "Q9VU38" } ], "protein_names": [ { "name": "Adenosine kinase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9VU38" }, { "name": "2.7.1.20", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VU38" }, { "name": "AK", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VU38" }, { "name": "Adenosine 5'-phosphotransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VU38" }, { "name": "CG11255-PB; Adk2-PB; adenosine kinase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_729863", "id": "NP_729863" }, { "name": "CG11255-PC; Adk2-PC; adenosine kinase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001287054", "id": "NP_001287054" }, { "name": "adenosine kinase 2, isoform B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_729863", "id": "NP_729863" }, { "name": "adenosine kinase 2, isoform C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001287054", "id": "NP_001287054" } ], "function": [ { "annotation": "ATP dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives.", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38#function" }, { "database": "UniProtKB", "id": "RU368116", "url": "https://www.uniprot.org/uniprot/RU368116#function" }, { "database": "UniProtKB", "id": "Q9VU39", "url": "https://www.uniprot.org/uniprot/Q9VU39#function" } ] } ], "disease": [ { "disease_id": "DOID:0111038", "recommended_name": { "id": "DOID:0111038", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111038", "name": "hypermethioninemia due to adenosine kinase deficiency", "description": "A hypermethioninemia characterized by autosomal recessive inheritance of developmental delay, early-onset seizures, mild dysmorphic features, and characteristic biochemical anomalies, including persistent hypermethioninemia that has_material_basis_in homozygous mutation in the ADK gene on chromosome 10q22." }, "synonyms": [ { "id": "DOID:0111038", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111038", "name": "hypermethioninemia encephalopathy due to ADK deficiency", "description": "" }, { "id": "DOID:0111038", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111038", "name": "ADK hypermethioninemia", "description": "" }, { "id": "DOID:0111038", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111038", "name": "MRT8", "description": "" }, { "id": "DOID:0111038", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111038", "name": "autosomal recessive mental retardation 8", "description": "" }, { "id": "DOID:0111038", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111038", "name": "hypermethioninemia encephalopathy due to adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "adenosine kinase deficiency", "description": "A rare inborn error of metabolism characterized by persistent hypermethioninemia with increased levels of S-adenosylmethionine and S-adenosylhomocysteine which manifests with encephalopathy, severe global developmental delay, mild to severe liver dysfunction, hypotonia and facial dysmorphism (most significant is frontal bossing, macrocephaly, hypertelorism and depressed nasal bridge). Epileptic seizures, hypoglycemia and/or cardiac defects (pulmonary stenosis, atrial and/or ventricular septal defect, coarctation of the aorta) may be associated. Clinical picture may range from neurological symptoms only to multi-organ involvement." }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "ADK deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "ADK hypermethioninemia", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "MRT8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "autosomal recessive intellectual disability 8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "autosomal recessive mental retardation 8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "hypermethioninemia due to adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "hypermethioninemia encephalopathy due to ADK deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "hypermethioninemia encephalopathy due to adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "mental retardation, autosomal recessive 8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "mental retardation, autosomal recessive 8, formerly", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "mental retardation, autosomal recessive 8; MRT8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "adenosine kinase deficiency", "description": "A rare inborn error of metabolism characterized by persistent hypermethioninemia with increased levels of S-adenosylmethionine and S-adenosylhomocysteine which manifests with encephalopathy, severe global developmental delay, mild to severe liver dysfunction, hypotonia and facial dysmorphism (most significant is frontal bossing, macrocephaly, hypertelorism and depressed nasal bridge). Epileptic seizures, hypoglycemia and/or cardiac defects (pulmonary stenosis, atrial and/or ventricular septal defect, coarctation of the aorta) may be associated. Clinical picture may range from neurological symptoms only to multi-organ involvement." }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "ADK deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "ADK hypermethioninemia", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "MRT8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "autosomal recessive intellectual disability 8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "autosomal recessive mental retardation 8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "hypermethioninemia due to adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "hypermethioninemia encephalopathy due to ADK deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "hypermethioninemia encephalopathy due to adenosine kinase deficiency", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "mental retardation, autosomal recessive 8", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "mental retardation, autosomal recessive 8, formerly", "description": "" }, { "id": "MONDO:0100255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100255", "name": "mental retardation, autosomal recessive 8; MRT8", "description": "" }, { "id": "MIM:614300", "resource": "MIM", "url": "https://www.omim.org/entry/614300", "name": "Hypermethioninemia due to adenosine kinase deficiency", "description": "Hypermethioninemia due to adenosine kinase deficiency" } ], "evidence": [ { "id": "0111038", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111038" } ] }, { "disease_id": "DOID:3328", "recommended_name": { "id": "DOID:3328", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3328", "name": "temporal lobe epilepsy", "description": "A focal epilepsy that is characterized by recurrent, unprovoked focal seizures that originate in the temporal lobe of the brain and last about one or two minutes." }, "synonyms": [ { "id": "DOID:3328", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3328", "name": "epilepsy, temporal lobe", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, familial temporal lobe, 1", "description": "An autosomal dominant condition caused by mutation(s) in the LGI1 gene, encoding leucine-rich glioma-inactivated protein 1. It is characterized by partial seizures originating in the temporal lobe and often accompanied by auditory sensory manifestations." }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "ETL1", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, familial temporal lobe, type 1", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, lateral temporal lobe, autosomal dominant", "description": "" }, { "id": "MONDO:0700090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700090", "name": "epilepsy, partial, with auditory features", "description": "" }, { "id": "MIM:600512", "resource": "MIM", "url": "https://www.omim.org/entry/600512", "name": "Epilepsy, familial temporal lobe, 1", "description": "Epilepsy, familial temporal lobe, 1" } ], "evidence": [ { "id": "3328", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3328" } ] }, { "disease_id": "DOID:3454", "recommended_name": { "id": "DOID:3454", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3454", "name": "brain infarction", "description": "A cerebrovascular disease that is characterized by tissue necrosis located_in the brain, resulting from inadequate blood flow through the brain." }, "synonyms": [], "evidence": [ { "id": "3454", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3454" } ] }, { "disease_id": "DOID:9452", "recommended_name": { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "steatotic liver disease", "description": "A lipid storage disease characterized by the accumulation of large vacuoles of triglyceride fat in at least 5% of hepatocytes." }, "synonyms": [ { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "SLD", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "fatty liver disease", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "Fatty change of liver", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "Steatosis of liver", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "alcoholic fatty liver", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "hepatic lipidosis", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "hepatic steatosis", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "visceral steatosis, congenital", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "visceral steatosis, congenital", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "White liver disease", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "fatal neonatal hepatic steatosis", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "fatty liver disease, congenital", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "fatty metamorphosis of viscera", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "steatosis of liver", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "visceral steatosis", "description": "" } ], "evidence": [ { "id": "9452", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9452" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Adk2", "url": "https://www.uniprot.org/uniprot/Q9VU38", "locus": { "chromosome": "3L", "start_pos": 13019715, "end_pos": 13022688, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0036337", "url": "https://www.ensembl.org/id/FBgn0036337" } ] } } ], "crossref": [ { "id": "FBgn0036337", "url": "https://bgee.org/?page=gene&gene_id=FBgn0036337", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01168", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01168", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0036337", "url": "https://flybase.org/reports/FBgn0036337", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "39479", "url": "https://www.ncbi.nlm.nih.gov/gene/39479", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9VU39", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9VU39*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001805", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001805", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002173", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002173", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011611", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011611", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029056", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029056", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG11255", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG11255", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "APFIAQF", "url": "https://omabrowser.org/oma/group/APFIAQF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "22683at2759", "url": "http://www.orthodb.org/?query=22683at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45769", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45769", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45769:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45769:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00294", "url": "http://pfam.xfam.org/family/PF00294", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-DME-74217", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-74217", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-9755088", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9755088", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_729863", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_729863", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "20824", "url": "https://www.rhea-db.org/rhea/20824", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VU38-1", "url": "https://www.uniprot.org/uniprot/Q9VU38-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VU39", "url": "https://www.uniprot.org/uniprot/Q9VU39", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VU39-1", "url": "https://www.uniprot.org/uniprot/Q9VU39-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCDRVREGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAEFLAGGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKDVPTGTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIMQVAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGDLREIGKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDAFVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYSGEPEFVE", "length": 345, "header": "tr|Q9VU38-1|Q9VU38_DROME Isoform 1 of Adenosine kinase OS=Drosophila melanogaster OX=7227 GN=Adk2 PE=1 SV=1 CANONICAL=Q9VU38-1" }, "isoforms": [ { "isoform_ac": "Q9VU38-1", "url": "", "sequence": { "sequence": "MCDRVREGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAEFLAGGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKDVPTGTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIMQVAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGDLREIGKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDAFVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYSGEPEFVE", "length": 345, "header": "tr|Q9VU38-1|Q9VU38_DROME Isoform 1 of Adenosine kinase OS=Drosophila melanogaster OX=7227 GN=Adk2 PE=1 SV=1 CANONICAL=Q9VU38-1" }, "locus": { "chromosome": "3L", "start_pos": 13021644, "end_pos": 13020293, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0075896", "url": "https://www.ensembl.org/id/FBtr0075896" }, { "database": "Ensembl Peptide", "id": "FBpp0075630", "url": "https://www.ensembl.org/id/FBpp0075630" } ] } }, { "isoform_ac": "Q9VU39-1", "url": "", "sequence": { "sequence": "MTSTLQEGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAEFLAGGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKDVPTGTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIMQVAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGDLREIGKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDAFVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYSGEPEFVE", "length": 345, "header": "tr|Q9VU39-1|Q9VU39_DROME Computationally mapped isoform of Adenosine kinase OS=Drosophila melanogaster OX=7227 GN=Adk2 PE=1 SV=1 CANONICAL=Q9VU38-1" }, "locus": { "chromosome": "3L", "start_pos": 13022454, "end_pos": 13020293, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0075895", "url": "https://www.ensembl.org/id/FBtr0075895" }, { "database": "Ensembl Peptide", "id": "FBpp0075629", "url": "https://www.ensembl.org/id/FBpp0075629" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" }, { "database": "UniProtKB", "id": "Q9VU39", "url": "https://www.uniprot.org/uniprot/Q9VU39" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" }, { "database": "UniProtKB", "id": "Q9VU39", "url": "https://www.uniprot.org/uniprot/Q9VU39" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" }, { "database": "UniProtKB", "id": "Q9VU39", "url": "https://www.uniprot.org/uniprot/Q9VU39" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" }, { "database": "UniProtKB", "id": "Q9VU39", "url": "https://www.uniprot.org/uniprot/Q9VU39" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" }, { "database": "UniProtKB", "id": "Q9VU39", "url": "https://www.uniprot.org/uniprot/Q9VU39" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" }, { "database": "UniProtKB", "id": "Q9VU39", "url": "https://www.uniprot.org/uniprot/Q9VU39" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" }, { "database": "UniProtKB", "id": "Q9VU39", "url": "https://www.uniprot.org/uniprot/Q9VU39" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" }, { "database": "UniProtKB", "id": "Q9VU39", "url": "https://www.uniprot.org/uniprot/Q9VU39" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.", "journal": "Genome Res.", "date": "2015", "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VU39", "url": "https://www.uniprot.org/uniprot/Q9VU39" } ], "reference": [ { "type": "PubMed", "id": "25589440", "url": "https://glygen.org/publication/PubMed/25589440" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q9VU39", "url": "https://www.uniprot.org/uniprot/Q9VU39" } ], "reference": [ { "type": "PubMed", "id": "26109356", "url": "https://glygen.org/publication/PubMed/26109356" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q9VU39", "url": "https://www.uniprot.org/uniprot/Q9VU39" } ], "reference": [ { "type": "PubMed", "id": "26109357", "url": "https://glygen.org/publication/PubMed/26109357" } ] } ], "pathway": [ { "id": "dme:Dmel_CG11255", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG11255", "resource": "KEGG Pathway" }, { "id": "R-DME-74217", "name": "Purine salvage", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-74217", "resource": "Reactome", "description": "Purine salvage" }, { "id": "R-DME-9755088", "name": "Ribavirin ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9755088", "resource": "Reactome", "description": "Ribavirin ADME" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ], "pmid": "" }, { "name": "adenosine kinase activity", "id": "GO:0004001", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004001", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ], "pmid": "" }, { "name": "AMP salvage", "id": "GO:0044209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044209", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ], "pmid": "" }, { "name": "purine ribonucleoside salvage", "id": "GO:0006166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006166", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ], "pmid": "" }, { "name": "purine nucleobase metabolic process", "id": "GO:0006144", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006144", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ], "pmid": "" }, { "name": "AMP biosynthetic process", "id": "GO:0006167", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006167", "evidence": [ { "database": "UniProtKB", "id": "Q9VU38", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 143, "end_pos": 145, "annotation": "n_glycosylation_sequon" }, { "start_pos": 195, "end_pos": 197, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "20824", "name": "", "equation": "adenosine + ATP = ADP + AMP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64640-1", "P55263-1", "P55264-1", "P47143-1", "Q54MB5-1", "Q7JWW6-1", "Q9VU38-1", "Q8T3U8-1" ], "evidence": [ { "id": "20824", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/20824" } ] }, { "id": "R-DME-109624", "name": "(2'-deoxy)adenosine + ATP => (d)AMP + ADP (ADK)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9VU38-1" ], "evidence": [ { "id": "R-DME-109624", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-109624" } ] }, { "id": "R-DME-9754974", "name": "ADK phosphorylates RBV", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-9680963" ], "output_participant_list": [ "R-ALL-9755028" ], "enzyme_list": [ "Q9VU38-1" ], "evidence": [ { "id": "R-DME-9754974", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9754974" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-9680963", "participant_name": "RBV [cytosol]", "crossref": [ { "id": "6842", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC01183", "database": "PharmacoDB", "url": "" }, { "id": "178103448", "database": "PubChem Compound", "url": "" }, { "id": "6842", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC01183", "database": "PharmacoDB", "url": "" }, { "id": "178103448", "database": "PubChem Compound", "url": "" }, { "id": "PDBC01183", "database": "PharmacoDB", "url": "" }, { "id": "178103448", "database": "PubChem Compound", "url": "" }, { "id": "6842", "database": "Guide to Pharmacology", "url": "" }, { "id": "6842", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC01183", "database": "PharmacoDB", "url": "" }, { "id": "178103448", "database": "PubChem Compound", "url": "" }, { "id": "6842", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC01183", "database": "PharmacoDB", "url": "" }, { "id": "178103448", "database": "PubChem Compound", "url": "" }, { "id": "6842", "database": "Guide to Pharmacology", "url": "" }, { "id": "PDBC01183", "database": "PharmacoDB", "url": "" }, { "id": "178103448", "database": "PubChem Compound", "url": "" } ] }, { "participant_id": "R-ALL-9755028", "participant_name": "RBV-MP [cytosol]", "crossref": [ { "id": "189091", "database": "ChEBI", "url": "" }, { "id": "189091", "database": "ChEBI", "url": "" }, { "id": "189091", "database": "ChEBI", "url": "" }, { "id": "189091", "database": "ChEBI", "url": "" }, { "id": "189091", "database": "ChEBI", "url": "" }, { "id": "189091", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P47143", "gene_name": "ADO1", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "P47143", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47143" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "P47143", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47143" } ] } ] }, { "uniprot_ac": "P55263", "gene_name": "ADK", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "P55263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55263" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "P55263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55263" } ] } ] }, { "uniprot_ac": "P55264", "gene_name": "Adk", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "P55264", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55264" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "P55264", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55264" } ] } ] }, { "uniprot_ac": "Q54MB5", "gene_name": "adk", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "Q54MB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MB5" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "Q54MB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MB5" } ] } ] }, { "uniprot_ac": "Q64640", "gene_name": "Adk", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "Q64640", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64640" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "Q64640", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64640" } ] } ] }, { "uniprot_ac": "Q7JWW6", "gene_name": "Adk3", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "Q7JWW6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JWW6" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "Q7JWW6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JWW6" } ] } ] }, { "uniprot_ac": "Q8T3U8", "gene_name": "Adk1", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "Q8T3U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T3U8" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "Q8T3U8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8T3U8" } ] } ] }, { "uniprot_ac": "Q9VU38", "gene_name": "Adk2", "activity": [ { "ec_number": "2.7.1.20", "activity": "adenosine + ATP = ADP + AMP + H(+).", "evidence": [ { "id": "Q9VU38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ] }, { "ec_number": "2.7.1.20", "activity": "", "evidence": [ { "id": "Q9VU38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VU38" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }