{ "uniprot_canonical_ac": "Q9VTE2-1", "uniprot_ac": "Q9VTE2", "uniprot_id": "SUUR_DROME", "mass": { "chemical_mass": 107625.0, "monoisotopic_mass": 107625.0 }, "refseq": { "ac": "NP_524835", "name": "suppressor of Under-Replication", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524835" }, "gene_names": [ { "name": "SuUR", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9VTE2", "id": "Q9VTE2" }, { "name": "CG7869; Dmel\\CG7869; Dromel_CG7869_FBtr0076203_suur_mORF; Su(UR); SU(UR); su(UR)ES; Su(UR)ES; SUUR", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524835", "id": "NP_524835" }, { "name": "CG7869", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VTE2", "id": "Q9VTE2" }, { "name": "Su(UR)ES", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VTE2", "id": "Q9VTE2" }, { "name": "SuUR", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524835", "id": "NP_524835" } ], "protein_names": [ { "name": "Protein suppressor of underreplication", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9VTE2" }, { "name": "CG7869-PA; SuUR-PA; suppressor of underreplication; suppressor of Under- replication; suppressor of underreplication protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524835", "id": "NP_524835" }, { "name": "suppressor of Under-Replication", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524835", "id": "NP_524835" } ], "function": [ { "annotation": "Required for underreplication of DNA, which is found in many late replicating euchromatic regions of salivary gland polytene chromosomes (PubMed:11901119, PubMed:12456726, PubMed:30277458). Functions by promoting the localization and retention of Rif1 to active DNA replication forks where Rif1 inhibits replication fork progression (PubMed:30277458). Controls chromatin organization in polytene chromosomes (PubMed:12456726).", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2#function" }, { "database": "PubMed", "id": "12456726", "url": "https://glygen.org/publication/PubMed/12456726" }, { "database": "PubMed", "id": "11901119", "url": "https://glygen.org/publication/PubMed/11901119" }, { "database": "PubMed", "id": "30277458", "url": "https://glygen.org/publication/PubMed/30277458" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 2, "end_pos": 278, "sequence_org": "YHFVSEQTPEVRLTDEALVTSHVTQYLKSFQLDAVRFVYDRLAKREFCILNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDLQVYIIQGVQDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLNNSFCTSMLLKQFEGRVNVLISSVDVTSDVRLLYNVLRLGGRLEHQYKSFASFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKSLPLVAPEQYKHNLNLWLASKNSQSTISG", "sequence_mut": "", "comment": "Underreplication is suppressed in larval salivary glands.", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" }, { "database": "PubMed", "id": "30277458", "url": "https://glygen.org/publication/PubMed/30277458" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "SuUR", "url": "https://www.uniprot.org/uniprot/Q9VTE2", "locus": { "chromosome": "3L", "start_pos": 11069025, "end_pos": 11064991, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0025355", "url": "https://www.ensembl.org/id/FBgn0025355" } ] } } ], "crossref": [ { "id": "FBgn0025355", "url": "https://bgee.org/?page=gene&gene_id=FBgn0025355", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0025355", "url": "https://flybase.org/reports/FBgn0025355", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "45739", "url": "https://www.ncbi.nlm.nih.gov/gene/45739", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9VTE2", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9VTE2*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038718", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038718", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG7869", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG7869", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "LEQMFEP", "url": "https://omabrowser.org/oma/group/LEQMFEP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3612931at2759", "url": "http://www.orthodb.org/?query=3612931at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45629", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45629", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45629:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45629:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9VTE2", "url": "http://purl.obolibrary.org/obo/PR_Q9VTE2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_524835", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524835", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VTE2-1", "url": "https://www.uniprot.org/uniprot/Q9VTE2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYHFVSEQTPEVRLTDEALVTSHVTQYLKSFQLDAVRFVYDRLAKREFCILNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDLQVYIIQGVQDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLNNSFCTSMLLKQFEGRVNVLISSVDVTSDVRLLYNVLRLGGRLEHQYKSFASFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKSLPLVAPEQYKHNLNLWLASKNSQSTISGSDVCSTIASIDNNPAQQNKTGLFEETDRLSEHSVDDVAMSPLIFEYSESDDEPLTVEPDADQNPVLVVSSDDCEIVTPPSTPQNRTPSLNESPRTKSKKKFSKKTSPRKKADLTDSEEDDEATDNMPPRKRTRAATVHLTPKTRRLNVRILRVSLDTLSTPPPSRTTTAIVTPKTEPTARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKINSKYLKHRSLDDVKRSFPRRVKLEGNQTPRSSKQIVKQEPKSKVGQEKKQKTVDVPAQGTAKRKPGRPRKCQTKTEDLGKTKTKPNSKHLPPTPQVLSGSSLSSEYMQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVSIPLYKDPVETVVINSSHDECSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGLGLPPAKRSANKSPDLFSISSEHSQIPLAQPRPSSPFEGFKIFGSEVKQFQQQLAKVNISVPKKKRDRSCLDILEQMFEPRQQQSAKTSPKVLPTLPLTQKDDAESTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQQSVRPSQANKITNYLIGSGITQERTQPSNGNRNSILASLRKSPKSPKQGAKSTQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNSSTSAAACQTRSARSGGASGPTKRKRLELFK", "length": 962, "header": "sp|Q9VTE2-1|SUUR_DROME Isoform 1 of Protein suppressor of underreplication OS=Drosophila melanogaster OX=7227 GN=SuUR PE=1 SV=3 CANONICAL=Q9VTE2-1" }, "isoforms": [ { "isoform_ac": "Q9VTE2-1", "url": "", "sequence": { "sequence": "MYHFVSEQTPEVRLTDEALVTSHVTQYLKSFQLDAVRFVYDRLAKREFCILNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDLQVYIIQGVQDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLNNSFCTSMLLKQFEGRVNVLISSVDVTSDVRLLYNVLRLGGRLEHQYKSFASFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKSLPLVAPEQYKHNLNLWLASKNSQSTISGSDVCSTIASIDNNPAQQNKTGLFEETDRLSEHSVDDVAMSPLIFEYSESDDEPLTVEPDADQNPVLVVSSDDCEIVTPPSTPQNRTPSLNESPRTKSKKKFSKKTSPRKKADLTDSEEDDEATDNMPPRKRTRAATVHLTPKTRRLNVRILRVSLDTLSTPPPSRTTTAIVTPKTEPTARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKINSKYLKHRSLDDVKRSFPRRVKLEGNQTPRSSKQIVKQEPKSKVGQEKKQKTVDVPAQGTAKRKPGRPRKCQTKTEDLGKTKTKPNSKHLPPTPQVLSGSSLSSEYMQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVSIPLYKDPVETVVINSSHDECSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGLGLPPAKRSANKSPDLFSISSEHSQIPLAQPRPSSPFEGFKIFGSEVKQFQQQLAKVNISVPKKKRDRSCLDILEQMFEPRQQQSAKTSPKVLPTLPLTQKDDAESTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQQSVRPSQANKITNYLIGSGITQERTQPSNGNRNSILASLRKSPKSPKQGAKSTQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNSSTSAAACQTRSARSGGASGPTKRKRLELFK", "length": 962, "header": "sp|Q9VTE2-1|SUUR_DROME Isoform 1 of Protein suppressor of underreplication OS=Drosophila melanogaster OX=7227 GN=SuUR PE=1 SV=3 CANONICAL=Q9VTE2-1" }, "locus": { "chromosome": "3L", "start_pos": 11068539, "end_pos": 11065395, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0076203", "url": "https://www.ensembl.org/id/FBtr0076203" }, { "database": "Ensembl Peptide", "id": "FBpp0075933", "url": "https://www.ensembl.org/id/FBpp0075933" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 432, "end_pos": 432, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" }, { "database": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" }, { "database": "phospho.ELM", "id": "Q9VTE2", "url": "http://phospho.elm.eu.org/byAccession/Q9VTE2.html" }, { "database": "iPTMnet", "id": "Q9VTE2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9VTE2" } ], "site_lbl": "Ser432" }, { "start_pos": 438, "end_pos": 438, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" }, { "database": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" }, { "database": "phospho.ELM", "id": "Q9VTE2", "url": "http://phospho.elm.eu.org/byAccession/Q9VTE2.html" }, { "database": "iPTMnet", "id": "Q9VTE2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9VTE2" } ], "site_lbl": "Thr438" }, { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" }, { "database": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" }, { "database": "phospho.ELM", "id": "Q9VTE2", "url": "http://phospho.elm.eu.org/byAccession/Q9VTE2.html" }, { "database": "iPTMnet", "id": "Q9VTE2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9VTE2" } ], "site_lbl": "Thr466" }, { "start_pos": 468, "end_pos": 468, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" }, { "database": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" }, { "database": "phospho.ELM", "id": "Q9VTE2", "url": "http://phospho.elm.eu.org/byAccession/Q9VTE2.html" }, { "database": "iPTMnet", "id": "Q9VTE2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9VTE2" } ], "site_lbl": "Ser468" }, { "start_pos": 810, "end_pos": 810, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" }, { "database": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" }, { "database": "phospho.ELM", "id": "Q9VTE2", "url": "http://phospho.elm.eu.org/byAccession/Q9VTE2.html" }, { "database": "iPTMnet", "id": "Q9VTE2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9VTE2" } ], "site_lbl": "Thr810" }, { "start_pos": 827, "end_pos": 827, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" }, { "database": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" }, { "database": "phospho.ELM", "id": "Q9VTE2", "url": "http://phospho.elm.eu.org/byAccession/Q9VTE2.html" }, { "database": "iPTMnet", "id": "Q9VTE2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9VTE2" } ], "site_lbl": "Ser827" }, { "start_pos": 833, "end_pos": 833, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" }, { "database": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" }, { "database": "phospho.ELM", "id": "Q9VTE2", "url": "http://phospho.elm.eu.org/byAccession/Q9VTE2.html" }, { "database": "iPTMnet", "id": "Q9VTE2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9VTE2" } ], "site_lbl": "Ser833" }, { "start_pos": 834, "end_pos": 834, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" }, { "database": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" }, { "database": "phospho.ELM", "id": "Q9VTE2", "url": "http://phospho.elm.eu.org/byAccession/Q9VTE2.html" }, { "database": "iPTMnet", "id": "Q9VTE2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9VTE2" } ], "site_lbl": "Ser834" }, { "start_pos": 838, "end_pos": 838, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" }, { "database": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" }, { "database": "phospho.ELM", "id": "Q9VTE2", "url": "http://phospho.elm.eu.org/byAccession/Q9VTE2.html" }, { "database": "iPTMnet", "id": "Q9VTE2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9VTE2" } ], "site_lbl": "Ser838" } ], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "The Drosophila suppressor of underreplication protein binds to late-replicating regions of polytene chromosomes.", "journal": "Genetics", "date": "2002", "authors": "Pirrotta V., Belyaeva E.S., Makunin I.V., Nabirochkina E.N., Volkova E.I., Zhimulev I.F.", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "reference": [ { "type": "PubMed", "id": "11901119", "url": "https://glygen.org/publication/PubMed/11901119" } ] }, { "title": "Overexpression of the SuUR gene induces reversible modifications at pericentric, telomeric and intercalary heterochromatin of Drosophila melanogaster polytene chromosomes.", "journal": "J. Cell Sci.", "date": "2003", "authors": "Shloma V.V., Belyaeva E.S., Makunin I.V., Semeshin V.F., Volkova E.I., Zhimulev I.F.", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "reference": [ { "type": "PubMed", "id": "12456726", "url": "https://glygen.org/publication/PubMed/12456726" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "Influence of the SuUR gene on intercalary heterochromatin in Drosophila melanogaster polytene chromosomes.", "journal": "Chromosoma", "date": "2003", "authors": "Pirrotta V., Alekseyenko A.A., Andreyeva E.N., Belyaeva E.S., Boldyreva L.V., Demakova O.V., Makarevich G.F., Makunin I.V., Nanayev R.A., Volkova E.I., Zhimulev I.F.", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "reference": [ { "type": "PubMed", "id": "12644953", "url": "https://glygen.org/publication/PubMed/12644953" } ] }, { "title": "Phosphoproteome analysis of Drosophila melanogaster embryos.", "journal": "Journal of proteome research", "date": "2008", "authors": "Zhai B, Villen J, Beausoleil SA, Mintseris J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" }, { "database": "iPTMnet", "id": "Q9VTE2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9VTE2" } ], "reference": [ { "type": "PubMed", "id": "18327897", "url": "https://glygen.org/publication/PubMed/18327897" } ] } ], "pathway": [ { "id": "dme:Dmel_CG7869", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG7869", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "positive regulation of DNA endoreduplication", "id": "GO:0032877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032877", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated DNA replication", "id": "GO:2000104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000104", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "DNA replication", "id": "GO:0006260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006260", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "chromatin organization", "id": "GO:0006325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006325", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "maintenance of protein location", "id": "GO:0045185", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045185", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "protein localization to chromosome", "id": "GO:0034502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034502", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "DNA endoreduplication", "id": "GO:0042023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042023", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "heterochromatin formation", "id": "GO:0031507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031507", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "negative regulation of DNA replication", "id": "GO:0008156", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008156", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "chromosome organization", "id": "GO:0051276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051276", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nuclear replication fork", "id": "GO:0043596", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043596", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "heterochromatin", "id": "GO:0000792", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000792", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "pericentric heterochromatin", "id": "GO:0005721", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005721", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "intercalary heterochromatin", "id": "GO:0005725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005725", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" }, { "name": "polytene chromosome", "id": "GO:0005700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005700", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "Q9VTE2", "url": "https://www.uniprot.org/uniprot/Q9VTE2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 150, "end_pos": 152, "annotation": "n_glycosylation_sequon" }, { "start_pos": 296, "end_pos": 298, "annotation": "n_glycosylation_sequon" }, { "start_pos": 362, "end_pos": 364, "annotation": "n_glycosylation_sequon" }, { "start_pos": 368, "end_pos": 370, "annotation": "n_glycosylation_sequon" }, { "start_pos": 517, "end_pos": 519, "annotation": "n_glycosylation_sequon" }, { "start_pos": 639, "end_pos": 641, "annotation": "n_glycosylation_sequon" }, { "start_pos": 659, "end_pos": 661, "annotation": "n_glycosylation_sequon" }, { "start_pos": 690, "end_pos": 692, "annotation": "n_glycosylation_sequon" }, { "start_pos": 707, "end_pos": 709, "annotation": "n_glycosylation_sequon" }, { "start_pos": 754, "end_pos": 756, "annotation": "n_glycosylation_sequon" }, { "start_pos": 832, "end_pos": 834, "annotation": "n_glycosylation_sequon" }, { "start_pos": 931, "end_pos": 933, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }