{ "uniprot_canonical_ac": "Q9VT50-1", "uniprot_ac": "Q9VT50", "uniprot_id": "INSL1_DROME", "mass": { "chemical_mass": 16851.0, "monoisotopic_mass": 16851.0 }, "refseq": { "ac": "NP_648359", "name": "Insulin-like peptide 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648359" }, "gene_names": [ { "name": "Ilp1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9VT50", "id": "Q9VT50" }, { "name": "CG14173; dilp; dILP; Dilp; DILP; Dilp 1; DILP 1; dilp-1; Dilp-1; DILP-1; dilp1; dILP1; Dilp1; DILP1; DILPs; dlp; Dmel\\CG14173; Ilp; Ilp-1; ilp1; ILP1; ILPs", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648359", "id": "NP_648359" }, { "name": "CG14173", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VT50", "id": "Q9VT50" }, { "name": "Ilp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648359", "id": "NP_648359" } ], "protein_names": [ { "name": "Probable insulin-like peptide 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9VT50" }, { "name": "CG14173-PA; Ilp1-PA; drosophila insulin-like peptide; drosophila insulin-like peptide 1; insulin/insulin-like growth factor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648359", "id": "NP_648359" }, { "name": "Insulin-like peptide 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648359", "id": "NP_648359" }, { "name": "Insulin-related peptide 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VT50" }, { "name": "dILP1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VT50" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VT50", "url": "https://www.uniprot.org/uniprot/Q9VT50" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Ilp1", "url": "https://www.uniprot.org/uniprot/Q9VT50", "locus": { "chromosome": "3L", "start_pos": 9799050, "end_pos": 9798420, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0044051", "url": "https://www.ensembl.org/id/FBgn0044051" } ] } } ], "crossref": [ { "id": "FBgn0044051", "url": "https://bgee.org/?page=gene&gene_id=FBgn0044051", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd04366", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04366", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0044051", "url": "https://flybase.org/reports/FBgn0044051", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "39149", "url": "https://www.ncbi.nlm.nih.gov/gene/39149", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR016179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022352", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022352", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022353", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022353", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036438", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036438", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040228", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040228", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG14173", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG14173", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VYDECCV", "url": "https://omabrowser.org/oma/group/VYDECCV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR13647", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13647", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13647:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13647:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00049", "url": "http://pfam.xfam.org/family/PF00049", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9VT50", "url": "http://purl.obolibrary.org/obo/PR_Q9VT50", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DME-110478", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110478", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_648359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648359", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9VT50", "url": "https://www.uniprot.org/uniprot/Q9VT50", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VT50-1", "url": "https://www.uniprot.org/uniprot/Q9VT50-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFSQHNGAAVHGLRLQSLLIAAMLTAAMAMVTPTGSGHQLLPPGNHKLCGPALSDAMDVVCPHGFNTLPRKRESLLGNSDDDEDTEQEVQDDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELAIYCLPK", "length": 154, "header": "sp|Q9VT50-1|INSL1_DROME Isoform 1 of Probable insulin-like peptide 1 OS=Drosophila melanogaster OX=7227 GN=Ilp1 PE=3 SV=1 CANONICAL=Q9VT50-1" }, "isoforms": [ { "isoform_ac": "Q9VT50-1", "url": "", "sequence": { "sequence": "MFSQHNGAAVHGLRLQSLLIAAMLTAAMAMVTPTGSGHQLLPPGNHKLCGPALSDAMDVVCPHGFNTLPRKRESLLGNSDDDEDTEQEVQDDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELAIYCLPK", "length": 154, "header": "sp|Q9VT50-1|INSL1_DROME Isoform 1 of Probable insulin-like peptide 1 OS=Drosophila melanogaster OX=7227 GN=Ilp1 PE=3 SV=1 CANONICAL=Q9VT50-1" }, "locus": { "chromosome": "3L", "start_pos": 9798895, "end_pos": 9798434, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0076328", "url": "https://www.ensembl.org/id/FBtr0076328" }, { "database": "Ensembl Peptide", "id": "FBpp0076057", "url": "https://www.ensembl.org/id/FBpp0076057" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The carboxyl terminal extension of the Drosophila insulin receptor homologue binds IRS-1 and influences cell survival.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Marin-Hincapie M, Garofalo RS", "evidence": [ { "database": "Reactome", "id": "R-DME-110478", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110478" } ], "reference": [ { "type": "PubMed", "id": "10455177", "url": "https://glygen.org/publication/PubMed/10455177" } ] }, { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9VT50", "url": "https://www.uniprot.org/uniprot/Q9VT50" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Characterization of Drosophila insulin receptor substrate.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Poltilove RM, Jacobs AR, Haft CR, Xu P, Taylor SI", "evidence": [ { "database": "Reactome", "id": "R-DME-110478", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110478" } ], "reference": [ { "type": "PubMed", "id": "10801879", "url": "https://glygen.org/publication/PubMed/10801879" } ] }, { "title": "An evolutionarily conserved function of the Drosophila insulin receptor and insulin-like peptides in growth control.", "journal": "Curr. Biol.", "date": "2001", "authors": "Brogiolo W, Stocker H, Ikeya T, Rintelen F, Fernandez R, Hafen E", "evidence": [ { "database": "UniProtKB", "id": "Q9VT50", "url": "https://www.uniprot.org/uniprot/Q9VT50" }, { "database": "Reactome", "id": "R-DME-110478", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110478" } ], "reference": [ { "type": "PubMed", "id": "11250149", "url": "https://glygen.org/publication/PubMed/11250149" } ] }, { "title": "PDK1 regulates growth through Akt and S6K in Drosophila.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Rintelen F, Stocker H, Thomas G, Hafen E", "evidence": [ { "database": "Reactome", "id": "R-DME-110478", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110478" } ], "reference": [ { "type": "PubMed", "id": "11752451", "url": "https://glygen.org/publication/PubMed/11752451" } ] }, { "title": "Living with lethal PIP3 levels: viability of flies lacking PTEN restored by a PH domain mutation in Akt/PKB.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Stocker H, Andjelkovic M, Oldham S, Laffargue M, Wymann MP, Hemmings BA, Hafen E", "evidence": [ { "database": "Reactome", "id": "R-DME-110478", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110478" } ], "reference": [ { "type": "PubMed", "id": "11872800", "url": "https://glygen.org/publication/PubMed/11872800" } ] }, { "title": "The Drosophila insulin/IGF receptor controls growth and size by modulating PtdInsP(3) levels.", "journal": "Development (Cambridge, England)", "date": "2002", "authors": "Oldham S, Stocker H, Laffargue M, Wittwer F, Wymann M, Hafen E", "evidence": [ { "database": "Reactome", "id": "R-DME-110478", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110478" } ], "reference": [ { "type": "PubMed", "id": "12163412", "url": "https://glygen.org/publication/PubMed/12163412" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VT50", "url": "https://www.uniprot.org/uniprot/Q9VT50" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "Control of cell number by Drosophila FOXO: downstream and feedback regulation of the insulin receptor pathway.", "journal": "Genes & development", "date": "2003", "authors": "Puig O, Marr MT, Ruhf ML, Tjian R", "evidence": [ { "database": "Reactome", "id": "R-DME-110478", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110478" } ], "reference": [ { "type": "PubMed", "id": "12893776", "url": "https://glygen.org/publication/PubMed/12893776" } ] }, { "title": "The Drosophila insulin receptor homolog: a gene essential for embryonic development encodes two receptor isoforms with different signaling potential.", "journal": "The EMBO journal", "date": "1995", "authors": "Fernandez R, Tabarini D, Azpiazu N, Frasch M, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-DME-110478", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110478" } ], "reference": [ { "type": "PubMed", "id": "7628438", "url": "https://glygen.org/publication/PubMed/7628438" } ] }, { "title": "The Drosophila phosphoinositide 3-kinase Dp110 promotes cell growth.", "journal": "The EMBO journal", "date": "1996", "authors": "Leevers SJ, Weinkove D, MacDougall LK, Hafen E, Waterfield MD", "evidence": [ { "database": "Reactome", "id": "R-DME-110478", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110478" } ], "reference": [ { "type": "PubMed", "id": "8978685", "url": "https://glygen.org/publication/PubMed/8978685" } ] }, { "title": "p60 is an adaptor for the Drosophila phosphoinositide 3-kinase, Dp110.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Weinkove D, Leevers SJ, MacDougall LK, Waterfield MD", "evidence": [ { "database": "Reactome", "id": "R-DME-110478", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110478" } ], "reference": [ { "type": "PubMed", "id": "9169420", "url": "https://glygen.org/publication/PubMed/9169420" } ] }, { "title": "3-Phosphoinositide-dependent protein kinase-1 (PDK1): structural and functional homology with the Drosophila DSTPK61 kinase.", "journal": "Current biology : CB", "date": "1997", "authors": "Alessi DR, Deak M, Casamayor A, Caudwell FB, Morrice N, Norman DG, Gaffney P, Reese CB, MacDougall CN, Harbison D, Ashworth A, Bownes M", "evidence": [ { "database": "Reactome", "id": "R-DME-110478", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110478" } ], "reference": [ { "type": "PubMed", "id": "9368760", "url": "https://glygen.org/publication/PubMed/9368760" } ] } ], "pathway": [ { "id": "dme:Dmel_CG14173", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG14173", "resource": "KEGG Pathway" }, { "id": "R-DME-110478", "name": "Insulin signaling pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110478", "resource": "Reactome", "description": "Insulin signaling pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "insulin receptor binding", "id": "GO:0005158", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005158", "evidence": [ { "database": "UniProtKB", "id": "Q9VT50", "url": "https://www.uniprot.org/uniprot/Q9VT50" } ], "pmid": "" }, { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "Q9VT50", "url": "https://www.uniprot.org/uniprot/Q9VT50" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q9VT50", "url": "https://www.uniprot.org/uniprot/Q9VT50" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "Q9VT50", "url": "https://www.uniprot.org/uniprot/Q9VT50" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "insulin receptor signaling pathway", "id": "GO:0008286", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008286", "evidence": [ { "database": "UniProtKB", "id": "Q9VT50", "url": "https://www.uniprot.org/uniprot/Q9VT50" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }