{ "uniprot_canonical_ac": "Q9VSL6-1", "uniprot_ac": "Q9VSL6", "uniprot_id": "Q9VSL6_DROME", "mass": { "chemical_mass": 29974.0, "monoisotopic_mass": 29974.0 }, "refseq": { "ac": "NP_648237", "name": "glutathione S transferase O1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648237" }, "gene_names": [ { "name": "GstO1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9VSL6", "id": "Q9VSL6" }, { "name": "CG6662; dGstO1; Dmel\\CG6662; DmGSTO1; GSTO1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648237", "id": "NP_648237" }, { "name": "CG6662", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VSL6", "id": "Q9VSL6" }, { "name": "DmGSTO1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VSL6", "id": "Q9VSL6" }, { "name": "Dmel\\CG6662", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VSL6", "id": "Q9VSL6" }, { "name": "Dmel_CG6662", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VSL6", "id": "Q9VSL6" }, { "name": "GSTO1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VSL6", "id": "Q9VSL6" }, { "name": "GstO1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648237", "id": "NP_648237" }, { "name": "dGstO1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VSL6", "id": "Q9VSL6" } ], "protein_names": [ { "name": "1.8.5.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VSL6" }, { "name": "2.5.1.18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VSL6" }, { "name": "CG6662-PA; GstO1-PA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648237", "id": "NP_648237" }, { "name": "Glutathione S transferase O1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VSL6" }, { "name": "Glutathione S-transferase omega class", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VSL6" }, { "name": "RE55814p", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VSL6" }, { "name": "glutathione S transferase O1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648237", "id": "NP_648237" } ], "function": [], "disease": [ { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:14330", "recommended_name": { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson's disease", "description": "A synucleinopathy that has_material_basis_in degeneration of the central nervous system that often impairs motor skills, speech, and other functions." }, "synonyms": [ { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson disease", "description": "" }, { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "paralysis agitans", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "A Parkinson disease that begins after around the age of 50." }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "LOPD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PARK", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, age of onset, modifier, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "autosomal dominant late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson's disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "" }, { "id": "MIM:168600", "resource": "MIM", "url": "https://www.omim.org/entry/168600", "name": "Parkinson disease", "description": "Parkinson disease" } ], "evidence": [ { "id": "14330", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:14330" } ] }, { "disease_id": "DOID:1574", "recommended_name": { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol use disorder", "description": "A substance abuse that involves the recurring use of alcoholic beverages despite negative consequences." }, "synonyms": [ { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "Ethanol abuse", "description": "" }, { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol abuse", "description": "" } ], "evidence": [ { "id": "1574", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1574" } ] }, { "disease_id": "DOID:2841", "recommended_name": { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "asthma", "description": "A bronchial disease that is characterized by chronic inflammation and narrowing of the airways, which is caused by a combination of environmental and genetic factors. The disease has_symptom recurring periods of wheezing (a whistling sound while breathing), has_symptom chest tightness, has_symptom shortness of breath, has_symptom mucus production and has_symptom coughing." }, "synonyms": [ { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "Exercise induced asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "bronchial hyperreactivity", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with acute exacerbation", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with status asthmaticus", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "exercise-induced asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "inherited susceptibility to asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, nocturnal, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, bronchial", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, diminished response to Antileukotriene treatment 1N", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, protection against", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma-related traits, susceptibility to", "description": "" }, { "id": "MIM:600807", "resource": "MIM", "url": "https://www.omim.org/entry/600807", "name": "Asthma", "description": "Asthma" } ], "evidence": [ { "id": "2841", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2841" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "GstO1", "url": "https://www.uniprot.org/uniprot/Q9VSL6", "locus": { "chromosome": "3L", "start_pos": 8523742, "end_pos": 8524866, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0035907", "url": "https://www.ensembl.org/id/FBgn0035907" } ] } } ], "crossref": [ { "id": "FBgn0035907", "url": "https://bgee.org/?page=gene&gene_id=FBgn0035907", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03184", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03184", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0035907", "url": "https://flybase.org/reports/FBgn0035907", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "38975", "url": "https://www.ncbi.nlm.nih.gov/gene/38975", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9VSL6", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9VSL6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR004045", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004045", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005442", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005442", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010987", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010987", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036282", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036282", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG6662", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG6662", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MWPWCER", "url": "https://omabrowser.org/oma/group/MWPWCER/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "103277at2759", "url": "http://www.orthodb.org/?query=103277at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43968:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43968:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13410", "url": "http://pfam.xfam.org/family/PF13410", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13417", "url": "http://pfam.xfam.org/family/PF13417", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-DME-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-156590", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-196836", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-196836", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_648237", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_648237", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VSL6-1", "url": "https://www.uniprot.org/uniprot/Q9VSL6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSNTQHLTIGSPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFELSPERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKYMNSRRSGQADYNMLYNEAKRVKLG", "length": 254, "header": "tr|Q9VSL6-1|Q9VSL6_DROME Isoform 1 of RE55814p OS=Drosophila melanogaster OX=7227 GN=GstO1 PE=1 SV=1 CANONICAL=Q9VSL6-1" }, "isoforms": [ { "isoform_ac": "Q9VSL6-1", "url": "", "sequence": { "sequence": "MSNTQHLTIGSPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFELSPERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKYMNSRRSGQADYNMLYNEAKRVKLG", "length": 254, "header": "tr|Q9VSL6-1|Q9VSL6_DROME Isoform 1 of RE55814p OS=Drosophila melanogaster OX=7227 GN=GstO1 PE=1 SV=1 CANONICAL=Q9VSL6-1" }, "locus": { "chromosome": "3L", "start_pos": 8524802, "end_pos": 8523870, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0076652", "url": "https://www.ensembl.org/id/FBtr0076652" }, { "database": "Ensembl Peptide", "id": "FBpp0076376", "url": "https://www.ensembl.org/id/FBpp0076376" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "Evolution of the GST omega gene family in 12 Drosophila species.", "journal": "J. Hered.", "date": "2009", "authors": "Johnson D.L., Grant P., Walters K.B.", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "reference": [ { "type": "PubMed", "id": "19608790", "url": "https://glygen.org/publication/PubMed/19608790" } ] }, { "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.", "journal": "Genome Res.", "date": "2015", "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "reference": [ { "type": "PubMed", "id": "25589440", "url": "https://glygen.org/publication/PubMed/25589440" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "reference": [ { "type": "PubMed", "id": "26109356", "url": "https://glygen.org/publication/PubMed/26109356" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "reference": [ { "type": "PubMed", "id": "26109357", "url": "https://glygen.org/publication/PubMed/26109357" } ] } ], "pathway": [ { "id": "dme:Dmel_CG6662", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG6662", "resource": "KEGG Pathway" }, { "id": "R-DME-156590", "name": "Glutathione conjugation", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-156590", "resource": "Reactome", "description": "Glutathione conjugation" }, { "id": "R-DME-196836", "name": "Vitamin C (ascorbate) metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-196836", "resource": "Reactome", "description": "Vitamin C (ascorbate) metabolism" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "glutathione transferase activity", "id": "GO:0004364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004364", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "pmid": "" }, { "name": "glutathione dehydrogenase (ascorbate) activity", "id": "GO:0045174", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045174", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "glutathione metabolic process", "id": "GO:0006749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006749", "evidence": [ { "database": "UniProtKB", "id": "Q9VSL6", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-DME-176054", "name": "GST dimers conjugate GSH with cytosolic substrates", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8MRM0-1", "Q9VSL3-1", "E1JJS1-1", "Q9VSL2-1", "Q9VSL5-1", "P41043-1", "A1Z7X7-1", "Q9VHD2-1", "Q7K0B6-1", "Q9VSL6-1" ], "evidence": [ { "id": "R-DME-176054", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-176054" } ] }, { "id": "R-DME-198813", "name": "GSTO dimers reduce DeHA to AscH-", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-198827" ], "output_participant_list": [ "R-ALL-111745", "R-ALL-198816" ], "enzyme_list": [ "Q9VSL3-1", "Q9VSL2-1", "Q9VSL5-1", "Q9VSL6-1" ], "evidence": [ { "id": "R-DME-198813", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-198813" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-111745", "participant_name": "GSSG [cytosol]", "crossref": [ { "id": "C00127", "database": "COMPOUND", "url": "" }, { "id": "58297", "database": "ChEBI", "url": "" }, { "id": "000003870129", "database": "ZINC", "url": "" }, { "id": "000003870129", "database": "ZINC", "url": "" }, { "id": "C00127", "database": "COMPOUND", "url": "" }, { "id": "58297", "database": "ChEBI", "url": "" }, { "id": "58297", "database": "ChEBI", "url": "" }, { "id": "C00127", "database": "COMPOUND", "url": "" }, { "id": "000003870129", "database": "ZINC", "url": "" }, { "id": "000003870129", "database": "ZINC", "url": "" }, { "id": "C00127", "database": "COMPOUND", "url": "" }, { "id": "58297", "database": "ChEBI", "url": "" }, { "id": "000003870129", "database": "ZINC", "url": "" }, { "id": "C00127", "database": "COMPOUND", "url": "" }, { "id": "58297", "database": "ChEBI", "url": "" }, { "id": "C00127", "database": "COMPOUND", "url": "" }, { "id": "58297", "database": "ChEBI", "url": "" }, { "id": "000003870129", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-198816", "participant_name": "AscH- [cytosol]", "crossref": [ { "id": "38290", "database": "ChEBI", "url": "" }, { "id": "000100006770", "database": "ZINC", "url": "" }, { "id": "ASCORBATE", "database": "AraCyc", "url": "" }, { "id": "50-81-7", "database": "CAS", "url": "" }, { "id": "C00072", "database": "COMPOUND", "url": "" }, { "id": "44229109", "database": "PubChem Compound", "url": "" }, { "id": "38290", "database": "ChEBI", "url": "" }, { "id": "000100006770", "database": "ZINC", "url": "" }, { "id": "ASCORBATE", "database": "AraCyc", "url": "" }, { "id": "50-81-7", "database": "CAS", "url": "" }, { "id": "C00072", "database": "COMPOUND", "url": "" }, { "id": "44229109", "database": "PubChem Compound", "url": "" }, { "id": "38290", "database": "ChEBI", "url": "" }, { "id": "000100006770", "database": "ZINC", "url": "" }, { "id": "ASCORBATE", "database": "AraCyc", "url": "" }, { "id": "50-81-7", "database": "CAS", "url": "" }, { "id": "C00072", "database": "COMPOUND", "url": "" }, { "id": "44229109", "database": "PubChem Compound", "url": "" }, { "id": "38290", "database": "ChEBI", "url": "" }, { "id": "000100006770", "database": "ZINC", "url": "" }, { "id": "ASCORBATE", "database": "AraCyc", "url": "" }, { "id": "50-81-7", "database": "CAS", "url": "" }, { "id": "C00072", "database": "COMPOUND", "url": "" }, { "id": "44229109", "database": "PubChem Compound", "url": "" }, { "id": "000100006770", "database": "ZINC", "url": "" }, { "id": "50-81-7", "database": "CAS", "url": "" }, { "id": "44229109", "database": "PubChem Compound", "url": "" }, { "id": "ASCORBATE", "database": "AraCyc", "url": "" }, { "id": "38290", "database": "ChEBI", "url": "" }, { "id": "C00072", "database": "COMPOUND", "url": "" }, { "id": "38290", "database": "ChEBI", "url": "" }, { "id": "000100006770", "database": "ZINC", "url": "" }, { "id": "ASCORBATE", "database": "AraCyc", "url": "" }, { "id": "50-81-7", "database": "CAS", "url": "" }, { "id": "C00072", "database": "COMPOUND", "url": "" }, { "id": "44229109", "database": "PubChem Compound", "url": "" } ] }, { "participant_id": "R-ALL-198827", "participant_name": "DeHA [cytosol]", "crossref": [ { "id": "58539", "database": "ChEBI", "url": "" }, { "id": "L-DEHYDRO-ASCORBATE", "database": "RiceCyc", "url": "" }, { "id": "000100082301", "database": "ZINC", "url": "" }, { "id": "58539", "database": "ChEBI", "url": "" }, { "id": "000100082301", "database": "ZINC", "url": "" }, { "id": "L-DEHYDRO-ASCORBATE", "database": "RiceCyc", "url": "" }, { "id": "58539", "database": "ChEBI", "url": "" }, { "id": "000100082301", "database": "ZINC", "url": "" }, { "id": "L-DEHYDRO-ASCORBATE", "database": "RiceCyc", "url": "" }, { "id": "58539", "database": "ChEBI", "url": "" }, { "id": "L-DEHYDRO-ASCORBATE", "database": "RiceCyc", "url": "" }, { "id": "000100082301", "database": "ZINC", "url": "" }, { "id": "58539", "database": "ChEBI", "url": "" }, { "id": "000100082301", "database": "ZINC", "url": "" }, { "id": "L-DEHYDRO-ASCORBATE", "database": "RiceCyc", "url": "" }, { "id": "000100082301", "database": "ZINC", "url": "" }, { "id": "L-DEHYDRO-ASCORBATE", "database": "RiceCyc", "url": "" }, { "id": "58539", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A1Z7X7", "gene_name": "GstT2", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "A1Z7X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z7X7" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A1Z7X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z7X7" } ] } ] }, { "uniprot_ac": "E1JJS1", "gene_name": "GstT3", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "E1JJS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E1JJS1" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "E1JJS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E1JJS1" } ] } ] }, { "uniprot_ac": "P41043", "gene_name": "GstS1", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] } ] }, { "uniprot_ac": "Q7K0B6", "gene_name": "GstT1", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "Q7K0B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K0B6" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q7K0B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K0B6" } ] } ] }, { "uniprot_ac": "Q8MRM0", "gene_name": "GstT4", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "Q8MRM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MRM0" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q8MRM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MRM0" } ] } ] }, { "uniprot_ac": "Q9VHD2", "gene_name": "GstZ2", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] } ] }, { "uniprot_ac": "Q9VSL2", "gene_name": "GstO3", "activity": [ { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q9VSL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VSL2" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VSL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VSL2" } ] } ] }, { "uniprot_ac": "Q9VSL3", "gene_name": "se", "activity": [ { "ec_number": "1.5.4.1", "activity": "2-amino-6-acetyl-3,7,8,9-tetrahydro-3H-pyrimido[4,5-b][1,4]diazepin-4-one + glutathione disulfide + H2O = 6-pyruvoyl-5,6,7,8-tetrahydropterin + 2 glutathione.", "evidence": [ { "id": "Q9VSL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VSL3" } ] }, { "ec_number": "1.5.4.1", "activity": "", "evidence": [ { "id": "Q9VSL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VSL3" } ] } ] }, { "uniprot_ac": "Q9VSL5", "gene_name": "GstO2", "activity": [ { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q9VSL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VSL5" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VSL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VSL5" } ] } ] }, { "uniprot_ac": "Q9VSL6", "gene_name": "GstO1", "activity": [ { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q9VSL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VSL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VSL6" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }