{
    "uniprot_canonical_ac": "Q9VPT5-1",
    "uniprot_ac": "Q9VPT5",
    "uniprot_id": "PEX12_DROME",
    "mass": {
        "chemical_mass": 34544.0,
        "monoisotopic_mass": 34544.0
    },
    "refseq": {
        "ac": "NP_001259844",
        "name": "peroxin 12, isoform B",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001259844"
    },
    "gene_names": [
        {
            "name": "Pex12",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9VPT5",
            "id": "Q9VPT5"
        },
        {
            "name": "CG3639; DmelPex12; Dmel\\CG3639; pex12; PEX12",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001259844",
            "id": "NP_001259844"
        },
        {
            "name": "CG3639",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VPT5",
            "id": "Q9VPT5"
        },
        {
            "name": "DmelPex12",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VPT5",
            "id": "Q9VPT5"
        },
        {
            "name": "Dmel\\CG3639",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VPT5",
            "id": "Q9VPT5"
        },
        {
            "name": "Dmel_CG3639",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VPT5",
            "id": "Q9VPT5"
        },
        {
            "name": "PEX12",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VPT5",
            "id": "Q9VPT5"
        },
        {
            "name": "Pex12",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001259844",
            "id": "NP_001259844"
        },
        {
            "name": "pex12",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VPT5",
            "id": "Q9VPT5"
        }
    ],
    "protein_names": [
        {
            "name": "Peroxisome assembly protein 12",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q9VPT5"
        },
        {
            "name": "CG3639-PB; Pex12-PB; peroxin 12",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001259844",
            "id": "NP_001259844"
        },
        {
            "name": "Peroxin-12",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9VPT5"
        },
        {
            "name": "peroxin 12, isoform B",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001259844",
            "id": "NP_001259844"
        }
    ],
    "function": [
        {
            "annotation": "Component of a retrotranslocation channel required for peroxisome organization by mediating export of the PEX5 receptor from peroxisomes to the cytosol, thereby promoting PEX5 recycling (PubMed:21669930). The retrotranslocation channel is composed of PEX2, PEX10 and PEX12; each subunit contributing transmembrane segments that coassemble into an open channel that specifically allows the passage of PEX5 through the peroxisomal membrane (By similarity). PEX12 also regulates PEX5 recycling by activating the E3 ubiquitin-protein ligase activity of PEX10 (By similarity). When PEX5 recycling is compromised, PEX12 stimulates PEX10-mediated polyubiquitination of PEX5, leading to its subsequent degradation (By similarity).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VPT5",
                    "url": "https://www.uniprot.org/uniprot/Q9VPT5#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q04370",
                    "url": "https://www.uniprot.org/uniprot/Q04370#function"
                },
                {
                    "database": "PubMed",
                    "id": "21669930",
                    "url": "https://glygen.org/publication/PubMed/21669930"
                },
                {
                    "database": "UniProtKB",
                    "id": "O00623",
                    "url": "https://www.uniprot.org/uniprot/O00623#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "M9PBP1",
                    "url": "https://www.uniprot.org/uniprot/M9PBP1#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "PIRNR038074",
                    "url": "https://www.uniprot.org/uniprot/PIRNR038074#function"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:0080478",
            "recommended_name": {
                "id": "DOID:0080478",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0080478",
                "name": "peroxisome biogenesis disorder 3A",
                "description": "A peroxisomal biogenesis disorder that has_material_basis_in homozygous or compound heterozygous mutation in the PEX12 gene on chromosome 17."
            },
            "synonyms": [
                {
                    "id": "DOID:0080478",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0080478",
                    "name": "peroxisome biogenesis disorder 3A (Zellweger)",
                    "description": ""
                },
                {
                    "id": "MONDO:0013927",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013927",
                    "name": "peroxisome biogenesis disorder 3A (Zellweger)",
                    "description": ""
                },
                {
                    "id": "MONDO:0013927",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013927",
                    "name": "peroxisome biogenesis disorder 3A (Zellweger)",
                    "description": ""
                },
                {
                    "id": "MONDO:0013927",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013927",
                    "name": "PBD3A",
                    "description": ""
                },
                {
                    "id": "MONDO:0013927",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013927",
                    "name": "peroxisome biogenesis disorder, complementation group 3",
                    "description": ""
                },
                {
                    "id": "MIM:614859",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/614859",
                    "name": "Peroxisome biogenesis disorder 3A",
                    "description": "Peroxisome biogenesis disorder 3A"
                }
            ],
            "evidence": [
                {
                    "id": "0080478",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0080478"
                }
            ]
        },
        {
            "disease_id": "DOID:0081241",
            "recommended_name": {
                "id": "DOID:0081241",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0081241",
                "name": "peroxisome biogenesis disorder 3B",
                "description": "A peroxisome biogenesis disorder that has_material_basis_in homozygous or compound heterozygous mutation in the PEX12 gene on chromosome 17."
            },
            "synonyms": [
                {
                    "id": "MONDO:0009959",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009959",
                    "name": "peroxisome biogenesis disorder type 3B",
                    "description": "A genetic disorder characterized by abnormalities in the breakdown of phytanic acid. It results in accumulation of phytanic acid in the blood, brain and other tissues. Signs and symptoms include retinitis pigmentosa which may lead to blindness, hearing problems and deafness, hypotonia, ataxia, nystagmus, facial deformities, and mental and growth retardation."
                },
                {
                    "id": "MONDO:0009959",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009959",
                    "name": "infantile phytanic acid storage disease",
                    "description": ""
                },
                {
                    "id": "MONDO:0009959",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009959",
                    "name": "peroxisome biogenesis disorder 3B",
                    "description": ""
                },
                {
                    "id": "MONDO:0009959",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009959",
                    "name": "peroxisome biogenesis disorder type 3B",
                    "description": ""
                },
                {
                    "id": "MONDO:0009959",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0009959",
                    "name": "PBD3B",
                    "description": ""
                },
                {
                    "id": "MIM:266510",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/266510",
                    "name": "Peroxisome biogenesis disorder 3B",
                    "description": "Peroxisome biogenesis disorder 3B"
                }
            ],
            "evidence": [
                {
                    "id": "0081241",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0081241"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Drosophila melanogaster",
            "taxid": 7227,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VPT5",
                    "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                }
            ],
            "common_name": "Fruit fly"
        }
    ],
    "gene": [
        {
            "name": "Pex12",
            "url": "https://www.uniprot.org/uniprot/Q9VPT5",
            "locus": {
                "chromosome": "2L",
                "start_pos": 818096,
                "end_pos": 815993,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "FBgn0031282",
                        "url": "https://www.ensembl.org/id/FBgn0031282"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "FBgn0031282",
            "url": "https://bgee.org/?page=gene&gene_id=FBgn0031282",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "cd16451",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16451",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "FBgn0031282",
            "url": "https://flybase.org/reports/FBgn0031282",
            "database": "FlyBase",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "33256",
            "url": "https://www.ncbi.nlm.nih.gov/gene/33256",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q9VPT5",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9VPT5*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR006845",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR006845",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013083",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017375",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017375",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "dme:Dmel_CG3639",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG3639",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "VYCWKCI",
            "url": "https://omabrowser.org/oma/group/VYCWKCI/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "65730at2759",
            "url": "http://www.orthodb.org/?query=65730at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12888",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12888",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12888:SF0",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12888:SF0",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF04757",
            "url": "http://pfam.xfam.org/family/PF04757",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q9VPT5",
            "url": "http://purl.obolibrary.org/obo/PR_Q9VPT5",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-DME-8866654",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8866654",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DME-9033241",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9033241",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DME-9603798",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9603798",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001259844",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001259844",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "M9PBP1",
            "url": "https://www.uniprot.org/uniprot/M9PBP1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "M9PBP1-1",
            "url": "https://www.uniprot.org/uniprot/M9PBP1-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9VPT5",
            "url": "https://www.uniprot.org/uniprot/Q9VPT5",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9VPT5-1",
            "url": "https://www.uniprot.org/uniprot/Q9VPT5-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MAEAANVRQNLQNVPSIFEISASETLDNLIYPALSKIFDYFGLRLDFKLWGSLRIQEELSPLLTWLLQYLYLRKRASSFGESFYGLQRTVTTTGDLLNRRQQFASATLLTFMPYVERKLRTRITRHEDTSPWEQRLLSAFHAFHAAKAAHTFFYLVKYASNHSPIFRLLGLTLRYPSEPPKEDQWTYVVLKMLEVLAFFLQFVQWWYSNDQRRKVGGTLINPEAMPRKQLPKEVQQSLPQRGECPVCLLSIQTPTACSVSGYVFCWKCIVSHMKEHGTCPVTHYPISLDDLVRIYET",
        "length": 297,
        "header": "sp|Q9VPT5-1|PEX12_DROME Isoform 1 of Peroxisome assembly protein 12  OS=Drosophila melanogaster OX=7227 GN=Pex12 PE=2 SV=1 CANONICAL=Q9VPT5-1"
    },
    "isoforms": [
        {
            "isoform_ac": "M9PBP1-1",
            "url": "",
            "sequence": {
                "sequence": "MAEAANVRQNLQNVPSIFEISASETLDNLIYPALSKIFDYFGLRLDFKLWGSLRIQEELSPLLTWLLQYLYLRKRASSFGESFYGLQRTVTTTGDLLNRRQQFASATLLTFMPYVERKLRTRITRHEDTSPWEQRLLSAFHAFHAAKAAHTFFYLVKYASNHSPIFRLLGLTLRYPSEPPKEDQWTYVVLKMLEVLAFFLQFVQWWYSNDQRRKVGGTLINPEAMPRKQLPKEVQQSLPQRGECPVCLLSIQTPTACSVSGYVFCWKCIVSHMKEHGTCPVTHYPISLDDLVRIYET",
                "length": 297,
                "header": "tr|M9PBP1-1|M9PBP1_DROME Computationally mapped isoform of Peroxisome assembly protein 12  OS=Drosophila melanogaster OX=7227 GN=Pex12 PE=3 SV=1 CANONICAL=Q9VPT5-1"
            },
            "locus": {
                "chromosome": "2L",
                "start_pos": 816973,
                "end_pos": 816083,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0332972",
                        "url": "https://www.ensembl.org/id/FBtr0332972"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0305188",
                        "url": "https://www.ensembl.org/id/FBpp0305188"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q9VPT5-1",
            "url": "",
            "sequence": {
                "sequence": "MAEAANVRQNLQNVPSIFEISASETLDNLIYPALSKIFDYFGLRLDFKLWGSLRIQEELSPLLTWLLQYLYLRKRASSFGESFYGLQRTVTTTGDLLNRRQQFASATLLTFMPYVERKLRTRITRHEDTSPWEQRLLSAFHAFHAAKAAHTFFYLVKYASNHSPIFRLLGLTLRYPSEPPKEDQWTYVVLKMLEVLAFFLQFVQWWYSNDQRRKVGGTLINPEAMPRKQLPKEVQQSLPQRGECPVCLLSIQTPTACSVSGYVFCWKCIVSHMKEHGTCPVTHYPISLDDLVRIYET",
                "length": 297,
                "header": "sp|Q9VPT5-1|PEX12_DROME Isoform 1 of Peroxisome assembly protein 12  OS=Drosophila melanogaster OX=7227 GN=Pex12 PE=2 SV=1 CANONICAL=Q9VPT5-1"
            },
            "locus": {
                "chromosome": "2L",
                "start_pos": 816973,
                "end_pos": 816083,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0332972",
                        "url": "https://www.ensembl.org/id/FBtr0332972"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0305188",
                        "url": "https://www.ensembl.org/id/FBpp0305188"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "The genome sequence of Drosophila melanogaster.",
            "journal": "Science",
            "date": "2000",
            "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VPT5",
                    "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                },
                {
                    "database": "UniProtKB",
                    "id": "M9PBP1",
                    "url": "https://www.uniprot.org/uniprot/M9PBP1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10731132",
                    "url": "https://glygen.org/publication/PubMed/10731132"
                }
            ]
        },
        {
            "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "M9PBP1",
                    "url": "https://www.uniprot.org/uniprot/M9PBP1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537568",
                    "url": "https://glygen.org/publication/PubMed/12537568"
                }
            ]
        },
        {
            "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VPT5",
                    "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                },
                {
                    "database": "UniProtKB",
                    "id": "M9PBP1",
                    "url": "https://www.uniprot.org/uniprot/M9PBP1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537572",
                    "url": "https://glygen.org/publication/PubMed/12537572"
                }
            ]
        },
        {
            "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "M9PBP1",
                    "url": "https://www.uniprot.org/uniprot/M9PBP1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537573",
                    "url": "https://glygen.org/publication/PubMed/12537573"
                }
            ]
        },
        {
            "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "M9PBP1",
                    "url": "https://www.uniprot.org/uniprot/M9PBP1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537574",
                    "url": "https://glygen.org/publication/PubMed/12537574"
                }
            ]
        },
        {
            "title": "Combined evidence annotation of transposable elements in genome sequences.",
            "journal": "PLoS Comput. Biol.",
            "date": "2005",
            "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "M9PBP1",
                    "url": "https://www.uniprot.org/uniprot/M9PBP1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16110336",
                    "url": "https://glygen.org/publication/PubMed/16110336"
                }
            ]
        },
        {
            "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.",
            "journal": "Science",
            "date": "2007",
            "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "M9PBP1",
                    "url": "https://www.uniprot.org/uniprot/M9PBP1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17569856",
                    "url": "https://glygen.org/publication/PubMed/17569856"
                }
            ]
        },
        {
            "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.",
            "journal": "Science",
            "date": "2007",
            "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "M9PBP1",
                    "url": "https://www.uniprot.org/uniprot/M9PBP1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17569867",
                    "url": "https://glygen.org/publication/PubMed/17569867"
                }
            ]
        },
        {
            "title": "A Drosophila model for the Zellweger spectrum of peroxisome biogenesis disorders.",
            "journal": "Dis. Model. Mech.",
            "date": "2011",
            "authors": "Li J., Rachubinski R.A., Hughes S.C., Mast F.D., Simmonds A.J., Virk M.K.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VPT5",
                    "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21669930",
                    "url": "https://glygen.org/publication/PubMed/21669930"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "dme:Dmel_CG3639",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG3639",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-DME-8866654",
            "name": "E3 ubiquitin ligases ubiquitinate target proteins",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8866654",
            "resource": "Reactome",
            "description": "E3 ubiquitin ligases ubiquitinate target proteins"
        },
        {
            "id": "R-DME-9033241",
            "name": "Peroxisomal protein import",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9033241",
            "resource": "Reactome",
            "description": "Peroxisomal protein import"
        },
        {
            "id": "R-DME-9603798",
            "name": "Class I peroxisomal membrane protein import",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9603798",
            "resource": "Reactome",
            "description": "Class I peroxisomal membrane protein import"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 3,
                "go_terms": [
                    {
                        "name": "peroxisomal importomer complex",
                        "id": "GO:1990429",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990429",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VPT5",
                                "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "peroxisome",
                        "id": "GO:0005777",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005777",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VPT5",
                                "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "peroxisomal membrane",
                        "id": "GO:0005778",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005778",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VPT5",
                                "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "zinc ion binding",
                        "id": "GO:0008270",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VPT5",
                                "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ubiquitin protein ligase activity",
                        "id": "GO:0061630",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VPT5",
                                "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ubiquitin-protein transferase activity",
                        "id": "GO:0004842",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004842",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VPT5",
                                "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 5,
                "go_terms": [
                    {
                        "name": "peroxisome organization",
                        "id": "GO:0007031",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007031",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VPT5",
                                "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "spermatid development",
                        "id": "GO:0007286",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007286",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VPT5",
                                "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein ubiquitination",
                        "id": "GO:0016567",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VPT5",
                                "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein import into peroxisome matrix",
                        "id": "GO:0016558",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016558",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VPT5",
                                "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "spermatocyte division",
                        "id": "GO:0048137",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048137",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VPT5",
                                "url": "https://www.uniprot.org/uniprot/Q9VPT5"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 161,
            "end_pos": 163,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 9
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}