{ "uniprot_canonical_ac": "Q9VPP5-1", "uniprot_ac": "Q9VPP5", "uniprot_id": "RNH2A_DROME", "mass": { "chemical_mass": 38750.0, "monoisotopic_mass": 38750.0 }, "refseq": { "ac": "NP_608521", "name": "uncharacterized protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_608521" }, "gene_names": [ { "name": "CG13690", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_608521", "id": "NP_608521" }, { "name": "CG13690", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VPP5", "id": "Q9VPP5" }, { "name": "Dmel\\CG13690", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_608521", "id": "NP_608521" } ], "protein_names": [ { "name": "Ribonuclease H2 subunit A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9VPP5" }, { "name": "3.1.26.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VPP5" }, { "name": "CG13690-PA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_608521", "id": "NP_608521" }, { "name": "RNase H2 subunit A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VPP5" }, { "name": "RNase HI large subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VPP5" }, { "name": "Ribonuclease HI large subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VPP5" }, { "name": "Ribonuclease HI subunit A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VPP5" }, { "name": "uncharacterized protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_608521", "id": "NP_608521" } ], "function": [ { "annotation": "Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9VPP5", "url": "https://www.uniprot.org/uniprot/Q9VPP5#function" } ] } ], "disease": [ { "disease_id": "DOID:0050629", "recommended_name": { "id": "DOID:0050629", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050629", "name": "Aicardi-Goutieres syndrome", "description": "A syndrome that is a genetically heterogeneous encephalopathy characterized in its most severe form by cerebral atrophy, leukodystrophy, intracranial calcifications, chronic cerebrospinal fluid lymphocytosis, increased CSF alpha-interferon, and negative serologic investigations for common prenatal infections." }, "synonyms": [ { "id": "DOID:0050629", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050629", "name": "Cree encephalitis", "description": "" }, { "id": "MONDO:0013059", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013059", "name": "Aicardi-Goutieres syndrome 5", "description": "Any Aicardi-Goutieres syndrome in which the cause of the disease is a mutation in the SAMHD1 gene." }, { "id": "MONDO:0013059", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013059", "name": "Aicardi-Goutieres syndrome 5", "description": "" }, { "id": "MONDO:0013059", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013059", "name": "Aicardi-Goutieres syndrome caused by mutation in SAMHD1", "description": "" }, { "id": "MONDO:0013059", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013059", "name": "Aicardi-Goutieres syndrome type 5", "description": "" }, { "id": "MONDO:0013059", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013059", "name": "SAMHD1 Aicardi-Goutieres syndrome", "description": "" }, { "id": "MONDO:0013059", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013059", "name": "AGS5", "description": "" }, { "id": "MONDO:0013059", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013059", "name": "SAMHD1-related Aicardi-Goutieres syndrome", "description": "" }, { "id": "MONDO:0014367", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014367", "name": "Aicardi-Goutieres syndrome 7", "description": "Any Aicardi-Goutieres syndrome in which the cause of the disease is a mutation in the IFIH1 gene." }, { "id": "MONDO:0014367", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014367", "name": "Aicardi-Goutieres syndrome 7", "description": "" }, { "id": "MONDO:0014367", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014367", "name": "Aicardi-Goutieres syndrome caused by mutation in IFIH1", "description": "" }, { "id": "MONDO:0014367", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014367", "name": "Aicardi-Goutieres syndrome type 7", "description": "" }, { "id": "MONDO:0014367", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014367", "name": "IFIH1 Aicardi-Goutieres syndrome", "description": "" }, { "id": "MONDO:0014367", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014367", "name": "AGS7", "description": "" }, { "id": "MONDO:0012472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012472", "name": "Aicardi-Goutieres syndrome 4", "description": "Any Aicardi-Goutieres syndrome in which the cause of the disease is a mutation in the RNASEH2A gene." }, { "id": "MONDO:0012472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012472", "name": "Aicardi-Goutieres syndrome 4", "description": "" }, { "id": "MONDO:0012472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012472", "name": "Aicardi-Goutieres syndrome caused by mutation in RNASEH2A", "description": "" }, { "id": "MONDO:0012472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012472", "name": "Aicardi-Goutieres syndrome type 4", "description": "" }, { "id": "MONDO:0012472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012472", "name": "RNASEH2A Aicardi-Goutieres syndrome", "description": "" }, { "id": "MONDO:0012472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012472", "name": "AGS4", "description": "" }, { "id": "MONDO:0012472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012472", "name": "RNASEH2A-related Aicardi-Goutieres syndrome", "description": "" }, { "id": "MONDO:0009165", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009165", "name": "Aicardi-Goutieres syndrome 1", "description": "Any Aicardi-Goutieres syndrome in which the cause of the disease is a mutation in the TREX1 gene." }, { "id": "MONDO:0009165", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009165", "name": "Aicardi-Goutieres syndrome 1", "description": "" }, { "id": "MONDO:0009165", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009165", "name": "Aicardi-Goutieres syndrome 1, dominant and recessive", "description": "" }, { "id": "MONDO:0009165", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009165", "name": "Aicardi-Goutieres syndrome caused by mutation in TREX1", "description": "" }, { "id": "MONDO:0009165", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009165", "name": "Aicardi-Goutieres syndrome type 1", "description": "" }, { "id": "MONDO:0009165", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009165", "name": "TREX1 Aicardi-Goutieres syndrome", "description": "" }, { "id": "MONDO:0009165", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009165", "name": "AGS1", "description": "" }, { "id": "MONDO:0009165", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009165", "name": "Ags", "description": "" }, { "id": "MONDO:0009165", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009165", "name": "Aicardi-Goutieres syndrome 1, autosomal dominant", "description": "" }, { "id": "MONDO:0009165", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009165", "name": "Cree encephalitis", "description": "" }, { "id": "MONDO:0009165", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009165", "name": "Pseudotoxoplasmosis syndrome", "description": "" }, { "id": "MONDO:0009165", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009165", "name": "encephalopathy, familial infantile, with intracranial calcification and chronic cerebrospinal fluid lymphocytosis", "description": "" }, { "id": "MONDO:0012471", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012471", "name": "Aicardi-Goutieres syndrome 3", "description": "Any Aicardi-Goutieres syndrome in which the cause of the disease is a mutation in the RNASEH2C gene." }, { "id": "MONDO:0012471", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012471", "name": "Aicardi-Goutieres syndrome 3", "description": "" }, { "id": "MONDO:0012471", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012471", "name": "Aicardi-Goutieres syndrome caused by mutation in RNASEH2C", "description": "" }, { "id": "MONDO:0012471", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012471", "name": "Aicardi-Goutieres syndrome type 3", "description": "" }, { "id": "MONDO:0012471", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012471", "name": "RNASEH2C Aicardi-Goutieres syndrome", "description": "" }, { "id": "MONDO:0012471", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012471", "name": "AGS3", "description": "" }, { "id": "MONDO:0012471", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012471", "name": "RNASEH2C -related Aicardi-Goutieres syndrome", "description": "" }, { "id": "MONDO:0014007", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014007", "name": "Aicardi-Goutieres syndrome 6", "description": "Any Aicardi-Goutieres syndrome in which the cause of the disease is a mutation in the ADAR gene." }, { "id": "MONDO:0014007", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014007", "name": "ADAR Aicardi-Goutieres syndrome", "description": "" }, { "id": "MONDO:0014007", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014007", "name": "Adar Aicardi-Goutieres syndrome", "description": "" }, { "id": "MONDO:0014007", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014007", "name": "Aicardi-Goutieres syndrome 6", "description": "" }, { "id": "MONDO:0014007", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014007", "name": "Aicardi-Goutieres syndrome caused by mutation in ADAR", "description": "" }, { "id": "MONDO:0014007", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014007", "name": "Aicardi-Goutieres syndrome caused by mutation in Adar", "description": "" }, { "id": "MONDO:0014007", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014007", "name": "Aicardi-Goutieres syndrome type 6", "description": "" }, { "id": "MONDO:0014007", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014007", "name": "AGS6", "description": "" }, { "id": "MONDO:0012429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012429", "name": "Aicardi-Goutieres syndrome 2", "description": "Any Aicardi-Goutieres syndrome in which the cause of the disease is a mutation in the RNASEH2B gene." }, { "id": "MONDO:0012429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012429", "name": "Aicardi-Goutieres syndrome 2", "description": "" }, { "id": "MONDO:0012429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012429", "name": "Aicardi-Goutieres syndrome caused by mutation in RNASEH2B", "description": "" }, { "id": "MONDO:0012429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012429", "name": "Aicardi-Goutieres syndrome type 2", "description": "" }, { "id": "MONDO:0012429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012429", "name": "RNASEH2B Aicardi-Goutieres syndrome", "description": "" }, { "id": "MONDO:0012429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012429", "name": "AGS2", "description": "" }, { "id": "MONDO:0012429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012429", "name": "RNASEH2B-related Aicardi-Goutieres syndrome", "description": "" }, { "id": "MIM:612952", "resource": "MIM", "url": "https://www.omim.org/entry/612952", "name": "Aicardi-Goutieres syndrome 5", "description": "Aicardi-Goutieres syndrome 5" }, { "id": "MIM:615846", "resource": "MIM", "url": "https://www.omim.org/entry/615846", "name": "Aicardi-Goutieres syndrome 7", "description": "Aicardi-Goutieres syndrome 7" }, { "id": "MIM:610333", "resource": "MIM", "url": "https://www.omim.org/entry/610333", "name": "Aicardi-Goutieres syndrome 4", "description": "Aicardi-Goutieres syndrome 4" }, { "id": "MIM:225750", "resource": "MIM", "url": "https://www.omim.org/entry/225750", "name": "Aicardi-Goutieres syndrome 1", "description": "Aicardi-Goutieres syndrome 1" }, { "id": "MIM:610329", "resource": "MIM", "url": "https://www.omim.org/entry/610329", "name": "Aicardi-Goutieres syndrome 3", "description": "Aicardi-Goutieres syndrome 3" }, { "id": "MIM:615010", "resource": "MIM", "url": "https://www.omim.org/entry/615010", "name": "Aicardi-Goutieres syndrome 6", "description": "Aicardi-Goutieres syndrome 6" }, { "id": "MIM:610181", "resource": "MIM", "url": "https://www.omim.org/entry/610181", "name": "Aicardi-Goutieres syndrome 2", "description": "Aicardi-Goutieres syndrome 2" } ], "evidence": [ { "id": "0050629", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050629" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VPP5", "url": "https://www.uniprot.org/uniprot/Q9VPP5" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/Q9VPP5", "locus": {} } ], "crossref": [ { "id": "FBgn0031252", "url": "https://bgee.org/?page=gene&gene_id=FBgn0031252", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd07181", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07181", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0031252", "url": "https://flybase.org/reports/FBgn0031252", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "33213", "url": "https://www.ncbi.nlm.nih.gov/gene/33213", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001352", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001352", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004649", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004649", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012337", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012337", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023160", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023160", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024567", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024567", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036397", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036397", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG13690", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG13690", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "REECRFF", "url": "https://omabrowser.org/oma/group/REECRFF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "117476at2759", "url": "http://www.orthodb.org/?query=117476at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10954", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10954", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10954:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10954:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01351", "url": "http://pfam.xfam.org/family/PF01351", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9VPP5", "url": "http://purl.obolibrary.org/obo/PR_Q9VPP5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_608521", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_608521", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9VPP5", "url": "https://www.uniprot.org/uniprot/Q9VPP5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VPP5-1", "url": "https://www.uniprot.org/uniprot/Q9VPP5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSDQEDVVVKKEKKCIENIDENDEEPDDVDFKDSGKISSLKALGPFIAGKENSRNTVYLSDVPDICKDKPCMLGVDEAGRGPVLGPMVYGISYCPLESNKALEDLGCADSKQLTEGKRDIIFNDINTKEYATSCVGWAVEIISPNTISTSMYRRSKCSLNEVSMDSAMGLIQQAIDAGVNIAEVYVDTVGPPEKYQEKLLKRFPSFKITVAKKADSTYPIVSAASICAKVTRDHALKVWSFPEGLVIKDNEFGSGYPGDPVTRRFLTEYIDLVFGFPRLVRFSWSTAENALADKAYDMEFDEPDSEKPKYAGTKLTKFFKGTTKSGEIIREECRFFKQRHLESVMEF", "length": 347, "header": "sp|Q9VPP5-1|RNH2A_DROME Isoform 1 of Ribonuclease H2 subunit A OS=Drosophila melanogaster OX=7227 GN= PE=2 SV=1 CANONICAL=Q9VPP5-1" }, "isoforms": [ { "isoform_ac": "Q9VPP5-1", "url": "", "sequence": { "sequence": "MSDQEDVVVKKEKKCIENIDENDEEPDDVDFKDSGKISSLKALGPFIAGKENSRNTVYLSDVPDICKDKPCMLGVDEAGRGPVLGPMVYGISYCPLESNKALEDLGCADSKQLTEGKRDIIFNDINTKEYATSCVGWAVEIISPNTISTSMYRRSKCSLNEVSMDSAMGLIQQAIDAGVNIAEVYVDTVGPPEKYQEKLLKRFPSFKITVAKKADSTYPIVSAASICAKVTRDHALKVWSFPEGLVIKDNEFGSGYPGDPVTRRFLTEYIDLVFGFPRLVRFSWSTAENALADKAYDMEFDEPDSEKPKYAGTKLTKFFKGTTKSGEIIREECRFFKQRHLESVMEF", "length": 347, "header": "sp|Q9VPP5-1|RNH2A_DROME Isoform 1 of Ribonuclease H2 subunit A OS=Drosophila melanogaster OX=7227 GN= PE=2 SV=1 CANONICAL=Q9VPP5-1" }, "locus": { "chromosome": "2L", "start_pos": 419600, "end_pos": 418560, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0078090", "url": "https://www.ensembl.org/id/FBtr0078090" }, { "database": "Ensembl Peptide", "id": "FBpp0077750", "url": "https://www.ensembl.org/id/FBpp0077750" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9VPP5", "url": "https://www.uniprot.org/uniprot/Q9VPP5" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VPP5", "url": "https://www.uniprot.org/uniprot/Q9VPP5" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] } ], "pathway": [ { "id": "dme:Dmel_CG13690", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG13690", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O75792-1", "protein_name": "Ribonuclease H2 subunit A", "gene_name": "RNASEH2A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDLSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKTLLESERERLFAKMEDTDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFVDTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGYPNDPKTKAWLKEHVEPVFGFPQFVRFSWRTAQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLESATSL", "length": 299 }, "evidence": [ { "id": "Q9VPP5", "url": "https://omabrowser.org/oma/group/Q9VPP5/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P53942-1", "protein_name": "Ribonuclease H2 subunit A", "gene_name": "RNH201", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MVPPTVEASLESPYTKSYFSPVPSALLEQNDSPIIMGIDEAGRGPVLGPMVYAVAYSTQKYQDETIIPNYEFDDSKKLTDPIRRMLFSKIYQDNEELTQIGYATTCITPLDISRGMSKFPPTRNYNLNEQAHDVTMALIDGVIKQNVKLSHVYVDTVGPPASYQKKLEQRFPGVKFTVAKKADSLYCMVSVASVVAKVTRDILVESLKRDPDEILGSGYPSDPKTVAWLKRNQTSLMGWPANMVRFSWQTCQTLLDDASKNSIPIKWEEQYMDSRKNAAQKTKQLQLQMVAKPVRRKRLRTLDNWYR", "length": 307 }, "evidence": [ { "id": "Q9VPP5", "url": "https://omabrowser.org/oma/group/Q9VPP5/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q5U209-1", "protein_name": "Ribonuclease H2 subunit A", "gene_name": "Rnaseh2a", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDLSELERDNTGRCRLSSPVPAVCLKEPCVLGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENERERLFAKMEEDGDFVGWALDILSPNLISTSMLGRVKYNLNSMSHDTAAGLIQHAMDQNVKVTQVFVDTVGMPETYQARLQQRFPGIEVTVKAKADSLFPVVSAASIIAKVARDQAVKNWQFVESLQGLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWSTAQAILEKEAESVTWEDSAAEEDPEGPGRITSYFSQGPQACRPQVSHKYFQERGLETATSL", "length": 301 }, "evidence": [ { "id": "Q9VPP5", "url": "https://omabrowser.org/oma/group/Q9VPP5/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9CWY8-1", "protein_name": "Ribonuclease H2 subunit A", "gene_name": "Rnaseh2a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDLSELERDNTGRCRLSSPVPAVCLKEPCVLGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENERERLFAKMEEDGDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTAAGLIQYALDQNVNVTQVFVDTVGMPETYQARLQQHFPGIEVTVKAKADSLFPVVSAASIFAKVARDKAVKNWQFVENLQDLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWSTAQAILEKEAEDVIWEDSEAEEDPERPGKITSYFSQGPQTCRPQAPHRYFQERGLEAASSL", "length": 301 }, "evidence": [ { "id": "Q9VPP5", "url": "https://omabrowser.org/oma/group/Q9VPP5/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "Q9VPP5", "url": "https://www.uniprot.org/uniprot/Q9VPP5" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q9VPP5", "url": "https://www.uniprot.org/uniprot/Q9VPP5" } ], "pmid": "" }, { "name": "RNA-DNA hybrid ribonuclease activity", "id": "GO:0004523", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004523", "evidence": [ { "database": "UniProtKB", "id": "Q9VPP5", "url": "https://www.uniprot.org/uniprot/Q9VPP5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "mismatch repair", "id": "GO:0006298", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006298", "evidence": [ { "database": "UniProtKB", "id": "Q9VPP5", "url": "https://www.uniprot.org/uniprot/Q9VPP5" } ], "pmid": "" }, { "name": "DNA replication, removal of RNA primer", "id": "GO:0043137", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043137", "evidence": [ { "database": "UniProtKB", "id": "Q9VPP5", "url": "https://www.uniprot.org/uniprot/Q9VPP5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "ribonuclease H2 complex", "id": "GO:0032299", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032299", "evidence": [ { "database": "UniProtKB", "id": "Q9VPP5", "url": "https://www.uniprot.org/uniprot/Q9VPP5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }