{ "uniprot_canonical_ac": "Q9VND8-1", "uniprot_ac": "Q9VND8", "uniprot_id": "RHEB_DROME", "mass": { "chemical_mass": 20731.0, "monoisotopic_mass": 20731.0 }, "refseq": { "ac": "NP_730950", "name": "Ras homolog enriched in brain, isoform A", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_730950" }, "gene_names": [ { "name": "Rheb", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9VND8", "id": "Q9VND8" }, { "name": "CG1081; Dm Rheb; Dmel\\CG1081; DmRheb; DReb; dRheb; Q9VND8; rheb; RheB; RHEB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_730950", "id": "NP_730950" }, { "name": "CG1081", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VND8", "id": "Q9VND8" }, { "name": "Rheb", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_730950", "id": "NP_730950" } ], "protein_names": [ { "name": "GTP-binding protein Rheb homolog", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9VND8" }, { "name": "CG1081-PA; Rheb-PA; Ras homolog enriched in brain ortholog; Ras homology enriched in brain; RAS homolog enriched in brain; Ras homologue enriched in brain", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_730950", "id": "NP_730950" }, { "name": "Ras homolog enriched in brain, isoform A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_730950", "id": "NP_730950" } ], "function": [ { "annotation": "Binds GTP and exhibits intrinsic GTPase activity (By similarity). Activates the protein kinase activity of TORC1, and thereby plays a role in the regulation of apoptosis (PubMed:22493059). Stimulates the phosphorylation of S6K through activation of TORC1 signaling (PubMed:22493059). May also have a role in activating TORC2 signaling (PubMed:22493059).", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8#function" }, { "database": "UniProtKB", "id": "Q15382", "url": "https://www.uniprot.org/uniprot/Q15382#function" }, { "database": "PubMed", "id": "22493059", "url": "https://glygen.org/publication/PubMed/22493059" } ] } ], "disease": [ { "disease_id": "DOID:0014667", "recommended_name": { "id": "DOID:0014667", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0014667", "name": "disease of metabolism", "description": "A disease that involving errors in metabolic processes of building or degradation of molecules." }, "synonyms": [ { "id": "DOID:0014667", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0014667", "name": "metabolic disease", "description": "" } ], "evidence": [ { "id": "0014667", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0014667" } ] }, { "disease_id": "DOID:13515", "recommended_name": { "id": "DOID:13515", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13515", "name": "tuberous sclerosis", "description": "A syndrome that is characterized by the growth of numerous noncancerous tumors in many parts of the body." }, "synonyms": [ { "id": "DOID:13515", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13515", "name": "Bourneville's disease", "description": "" }, { "id": "DOID:13515", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13515", "name": "Epiloia", "description": "" }, { "id": "DOID:13515", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13515", "name": "Tuberose sclerosis", "description": "" }, { "id": "DOID:13515", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13515", "name": "Tuberous sclerosis syndrome", "description": "" }, { "id": "DOID:13515", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13515", "name": "cerebral sclerosis", "description": "" }, { "id": "MONDO:0008612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008612", "name": "tuberous sclerosis 1", "description": "Tuberous sclerosis mapped to chromosome 9q34 (TSC1 gene)." }, { "id": "MONDO:0008612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008612", "name": "TSC1 tuberous sclerosis", "description": "" }, { "id": "MONDO:0008612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008612", "name": "tuberous sclerosis 1", "description": "" }, { "id": "MONDO:0008612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008612", "name": "tuberous sclerosis caused by mutation in TSC1", "description": "" }, { "id": "MONDO:0008612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008612", "name": "tuberous sclerosis type 1", "description": "" }, { "id": "MONDO:0008612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008612", "name": "tuberous sclerosis-1", "description": "" }, { "id": "MONDO:0008612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008612", "name": "TSC1", "description": "" }, { "id": "MONDO:0008612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008612", "name": "tuberose sclerosis", "description": "" }, { "id": "MONDO:0008612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008612", "name": "tuberous sclerosis Complex", "description": "" }, { "id": "MONDO:0008612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008612", "name": "tuberous sclerosis, type 1", "description": "" }, { "id": "MIM:191100", "resource": "MIM", "url": "https://www.omim.org/entry/191100", "name": "Tuberous sclerosis 1", "description": "Tuberous sclerosis 1" } ], "evidence": [ { "id": "13515", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:13515" } ] }, { "disease_id": "DOID:9352", "recommended_name": { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes mellitus", "description": "A diabetes mellitus that is characterized by high blood sugar, insulin resistance, and relative lack of insulin." }, "synonyms": [ { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "NIDDM", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type II diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "insulin resistance", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, type 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "Niddm4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "noninsulin-dependent diabetes mellitus 4", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "A type of diabetes mellitus that is characterized by insulin resistance or desensitization and increased blood glucose levels. This is a chronic disease that can develop gradually over the life of a patient and can be linked to both environmental factors and heredity." }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "NIDDM", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "T2DM - type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, association with", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, late onset", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, severe, digenic", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus non-insulin dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, non-insulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, protection against", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "hypertension, insulin resistance-related, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "maturity-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus, susceptibility to", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, type 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "NIDDM1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "noninsulin-dependent diabetes mellitus 1", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "NIDDM2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "noninsulin-dependent diabetes mellitus 2", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, type 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "type 2 diabetes mellitus 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "NIDDM3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "noninsulin-dependent diabetes mellitus 3", "description": "" }, { "id": "MIM:125853", "resource": "MIM", "url": "https://www.omim.org/entry/125853", "name": "Type 2 diabetes mellitus", "description": "Type 2 diabetes mellitus" }, { "id": "MIM:601283", "resource": "MIM", "url": "https://www.omim.org/entry/601283", "name": "Type 2 diabetes mellitus 1", "description": "Type 2 diabetes mellitus 1" } ], "evidence": [ { "id": "9352", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9352" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Rheb", "url": "https://www.uniprot.org/uniprot/Q9VND8", "locus": { "chromosome": "3R", "start_pos": 5570491, "end_pos": 5568921, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0041191", "url": "https://www.ensembl.org/id/FBgn0041191" } ] } } ], "crossref": [ { "id": "FBgn0041191", "url": "https://bgee.org/?page=gene&gene_id=FBgn0041191", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd04137", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04137", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0041191", "url": "https://flybase.org/reports/FBgn0041191", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "117332", "url": "https://www.ncbi.nlm.nih.gov/gene/117332", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9VND8", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9VND8*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001806", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001806", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020849", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020849", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG1081", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG1081", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SARHNEN", "url": "https://omabrowser.org/oma/group/SARHNEN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "8685at2759", "url": "http://www.orthodb.org/?query=8685at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24070", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24070", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24070:SF226", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24070:SF226", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00071", "url": "http://pfam.xfam.org/family/PF00071", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9VND8", "url": "http://purl.obolibrary.org/obo/PR_Q9VND8", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DME-110523", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110523", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-1632852", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-165159", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-166208", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-166208", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-380972", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-380972", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5628897", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8943724", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9639288", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_730950", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_730950", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VND8-1", "url": "https://www.uniprot.org/uniprot/Q9VND8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQEKSGCLVS", "length": 182, "header": "sp|Q9VND8-1|RHEB_DROME Isoform 1 of GTP-binding protein Rheb homolog OS=Drosophila melanogaster OX=7227 GN=Rheb PE=1 SV=1 CANONICAL=Q9VND8-1" }, "isoforms": [ { "isoform_ac": "Q9VND8-1", "url": "", "sequence": { "sequence": "MPTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQEKSGCLVS", "length": 182, "header": "sp|Q9VND8-1|RHEB_DROME Isoform 1 of GTP-binding protein Rheb homolog OS=Drosophila melanogaster OX=7227 GN=Rheb PE=1 SV=1 CANONICAL=Q9VND8-1" }, "locus": { "chromosome": "3R", "start_pos": 5570114, "end_pos": 5569223, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0078693", "url": "https://www.ensembl.org/id/FBtr0078693" }, { "database": "Ensembl Peptide", "id": "FBpp0078342", "url": "https://www.ensembl.org/id/FBpp0078342" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "The translational inhibitor 4E-BP is an effector of PI(3)K/Akt signalling and cell growth in Drosophila.", "journal": "Nature cell biology", "date": "2001", "authors": "Miron M, Verdu J, Lachance PE, Birnbaum MJ, Lasko PF, Sonenberg N", "evidence": [ { "database": "Reactome", "id": "R-DME-110523", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110523" } ], "reference": [ { "type": "PubMed", "id": "11389445", "url": "https://glygen.org/publication/PubMed/11389445" } ] }, { "title": "PDK1 regulates growth through Akt and S6K in Drosophila.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Rintelen F, Stocker H, Thomas G, Hafen E", "evidence": [ { "database": "Reactome", "id": "R-DME-110523", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110523" } ], "reference": [ { "type": "PubMed", "id": "11752451", "url": "https://glygen.org/publication/PubMed/11752451" } ] }, { "title": "Akt regulates growth by directly phosphorylating Tsc2.", "journal": "Nature cell biology", "date": "2002", "authors": "Potter CJ, Pedraza LG, Xu T", "evidence": [ { "database": "Reactome", "id": "R-DME-110523", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110523" } ], "reference": [ { "type": "PubMed", "id": "12172554", "url": "https://glygen.org/publication/PubMed/12172554" } ] }, { "title": "A Drosophila full-length cDNA resource.", "journal": "Genome Biol.", "date": "2002", "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "reference": [ { "type": "PubMed", "id": "12537569", "url": "https://glygen.org/publication/PubMed/12537569" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "Rheb is a direct target of the tuberous sclerosis tumour suppressor proteins.", "journal": "Nature cell biology", "date": "2003", "authors": "Zhang Y, Gao X, Saucedo LJ, Ru B, Edgar BA, Pan D", "evidence": [ { "database": "Reactome", "id": "R-DME-110523", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110523" } ], "reference": [ { "type": "PubMed", "id": "12771962", "url": "https://glygen.org/publication/PubMed/12771962" } ] }, { "title": "LST8 regulates cell growth via target-of-rapamycin complex 2 (TORC2).", "journal": "Mol. Cell. Biol.", "date": "2012", "authors": "Wang T, Blumhagen R, Lao U, Kuo Y, Edgar BA", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "reference": [ { "type": "PubMed", "id": "22493059", "url": "https://glygen.org/publication/PubMed/22493059" } ] } ], "pathway": [ { "id": "dme:Dmel_CG1081", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG1081", "resource": "KEGG Pathway" }, { "id": "R-DME-110523", "name": "TOR signaling pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-110523", "resource": "Reactome", "description": "TOR signaling pathway" }, { "id": "R-DME-1632852", "name": "Macroautophagy", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-1632852", "resource": "Reactome", "description": "Macroautophagy" }, { "id": "R-DME-165159", "name": "MTOR signalling", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-165159", "resource": "Reactome", "description": "MTOR signalling" }, { "id": "R-DME-166208", "name": "mTORC1-mediated signalling", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-166208", "resource": "Reactome", "description": "mTORC1-mediated signalling" }, { "id": "R-DME-380972", "name": "Energy dependent regulation of mTOR by LKB1-AMPK", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-380972", "resource": "Reactome", "description": "Energy dependent regulation of mTOR by LKB1-AMPK" }, { "id": "R-DME-5628897", "name": "TP53 Regulates Metabolic Genes", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5628897", "resource": "Reactome", "description": "TP53 Regulates Metabolic Genes" }, { "id": "R-DME-8943724", "name": "Regulation of PTEN gene transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8943724", "resource": "Reactome", "description": "Regulation of PTEN gene transcription" }, { "id": "R-DME-9639288", "name": "Amino acids regulate mTORC1", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9639288", "resource": "Reactome", "description": "Amino acids regulate mTORC1" } ], "orthologs": [ { "uniprot_canonical_ac": "P25378-1", "protein_name": "Rheb-like protein RHB1", "gene_name": "RHB1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MEYATMSSSNSTHNFQRKIALIGARNVGKTTLTVRFVESRFVESYYPTIENEFTRIIPYKSHDCTLEILDTAGQDEVSLLNIKSLTGVRGIILCYSIINRASFDLIPILWDKLVDQLGKDNLPVILVGTKADLGRSTKGVKRCVTKAEGEKLASTIGSQDKRNQAAFIECSAELDYNVEETFMLLLKQMERVEGTLGLDAENNNKCSIM", "length": 209 }, "evidence": [ { "id": "Q9VND8", "url": "https://omabrowser.org/oma/group/Q9VND8/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q15382-1", "protein_name": "GTP-binding protein Rheb", "gene_name": "RHEB", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSSCSVM", "length": 184 }, "evidence": [ { "id": "Q9VND8", "url": "https://omabrowser.org/oma/group/Q9VND8/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q921J2-1", "protein_name": "GTP-binding protein Rheb", "gene_name": "Rheb", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFKRIILEAEKIDGAASQGKSSCSVM", "length": 184 }, "evidence": [ { "id": "Q9VND8", "url": "https://omabrowser.org/oma/group/Q9VND8/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 22, "go_terms": [ { "name": "positive regulation of TORC1 signaling", "id": "GO:1904263", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904263", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "carbohydrate homeostasis", "id": "GO:0033500", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033500", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "regulation of autophagy", "id": "GO:0010506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010506", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "positive regulation of cell growth", "id": "GO:0030307", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030307", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "response to starvation", "id": "GO:0042594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042594", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "lipid homeostasis", "id": "GO:0055088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055088", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "multicellular organism growth", "id": "GO:0035264", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035264", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "cholesterol homeostasis", "id": "GO:0042632", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042632", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "small GTPase mediated signal transduction", "id": "GO:0007264", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007264", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "negative regulation of autophagy", "id": "GO:0010507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010507", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "G1/S transition of mitotic cell cycle", "id": "GO:0000082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000082", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "insulin receptor signaling pathway", "id": "GO:0008286", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008286", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "positive regulation of translation", "id": "GO:0045727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045727", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "positive regulation of cell size", "id": "GO:0045793", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045793", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "positive regulation of synaptic assembly at neuromuscular junction", "id": "GO:0045887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045887", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "positive regulation of neuroblast proliferation", "id": "GO:0002052", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002052", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "apical protein localization", "id": "GO:0045176", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045176", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "positive regulation of axon guidance", "id": "GO:1902669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902669", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "negative regulation of TORC2 signaling", "id": "GO:1903940", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903940", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "terminal branching, open tracheal system", "id": "GO:0007430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007430", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "positive regulation of ribosome biogenesis", "id": "GO:0090070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090070", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "negative regulation of lipophagy", "id": "GO:1904503", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904503", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" }, { "name": "GDP binding", "id": "GO:0019003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019003", "evidence": [ { "database": "UniProtKB", "id": "Q9VND8", "url": "https://www.uniprot.org/uniprot/Q9VND8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 152, "end_pos": 154, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }