{ "uniprot_canonical_ac": "Q9VN91-1", "uniprot_ac": "Q9VN91", "uniprot_id": "MORN4_DROME", "mass": { "chemical_mass": 22739.0, "monoisotopic_mass": 22739.0 }, "refseq": { "ac": "NP_649520", "name": "retinophilin", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_649520" }, "gene_names": [ { "name": "rtp", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9VN91", "id": "Q9VN91" }, { "name": "9C4; anon-83ABa; CG10233; Dmel\\CG10233; retin; uta; UTA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_649520", "id": "NP_649520" }, { "name": "CG10233", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VN91", "id": "Q9VN91" }, { "name": "morn4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VN91", "id": "Q9VN91" }, { "name": "rtp", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_649520", "id": "NP_649520" }, { "name": "uta", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VN91", "id": "Q9VN91" } ], "protein_names": [ { "name": "MORN repeat-containing protein 4 homolog", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9VN91" }, { "name": "CG10233-PA; rtp-PA; undertaker; Undertaker/Retinophilin; retitin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_649520", "id": "NP_649520" }, { "name": "Retinophilin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VN91" }, { "name": "retinophilin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_649520", "id": "NP_649520" }, { "name": "undertaker", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VN91" } ], "function": [ { "annotation": "Plays a role in promoting axonal degeneration following neuronal injury by toxic insult or trauma (PubMed:22496551). Organizes rhabdomeric components to suppress random activation of the phototransduction cascade and thus increases the signaling fidelity of dark-adapted photoreceptors (PubMed:20107052). The rtp/ninaC complex is required for stability of inad and inac and the normal termination of phototransduction in the retina (PubMed:20739554).", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91#function" }, { "database": "PubMed", "id": "20107052", "url": "https://glygen.org/publication/PubMed/20107052" }, { "database": "PubMed", "id": "22496551", "url": "https://glygen.org/publication/PubMed/22496551" }, { "database": "PubMed", "id": "20739554", "url": "https://glygen.org/publication/PubMed/20739554" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "rtp", "url": "https://www.uniprot.org/uniprot/Q9VN91", "locus": { "chromosome": "3R", "start_pos": 5236092, "end_pos": 5237315, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0087005", "url": "https://www.ensembl.org/id/FBgn0087005" } ] } } ], "crossref": [ { "id": "FBgn0087005", "url": "https://bgee.org/?page=gene&gene_id=FBgn0087005", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0087005", "url": "https://flybase.org/reports/FBgn0087005", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "40627", "url": "https://www.ncbi.nlm.nih.gov/gene/40627", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9VN91", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9VN91*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003409", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003409", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG10233", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG10233", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WFPDGAK", "url": "https://omabrowser.org/oma/group/WFPDGAK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2909023at2759", "url": "http://www.orthodb.org/?query=2909023at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46614", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46614", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46614:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46614:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02493", "url": "http://pfam.xfam.org/family/PF02493", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9VN91", "url": "http://purl.obolibrary.org/obo/PR_Q9VN91", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_649520", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_649520", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VN91-1", "url": "https://www.uniprot.org/uniprot/Q9VN91-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAMDDYDDDMSSVGVTTARIENQHQQHPHQQGQHGHHQQGQGQSQYSAGAVKVGGWRYEDASRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGIFWRADGMKYEGEFRGGKIWGLGLLTFQDFTHGFPRNEGFFQDCRFMRRRRCPEVVQRAQKCALMARSQCEHPY", "length": 198, "header": "sp|Q9VN91-1|MORN4_DROME Isoform 1 of MORN repeat-containing protein 4 homolog OS=Drosophila melanogaster OX=7227 GN=rtp PE=1 SV=1 CANONICAL=Q9VN91-1" }, "isoforms": [ { "isoform_ac": "Q9VN91-1", "url": "", "sequence": { "sequence": "MAMDDYDDDMSSVGVTTARIENQHQQHPHQQGQHGHHQQGQGQSQYSAGAVKVGGWRYEDASRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGIFWRADGMKYEGEFRGGKIWGLGLLTFQDFTHGFPRNEGFFQDCRFMRRRRCPEVVQRAQKCALMARSQCEHPY", "length": 198, "header": "sp|Q9VN91-1|MORN4_DROME Isoform 1 of MORN repeat-containing protein 4 homolog OS=Drosophila melanogaster OX=7227 GN=rtp PE=1 SV=1 CANONICAL=Q9VN91-1" }, "locus": { "chromosome": "3R", "start_pos": 5237259, "end_pos": 5236402, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0078825", "url": "https://www.ensembl.org/id/FBtr0078825" }, { "database": "Ensembl Peptide", "id": "FBpp0078467", "url": "https://www.ensembl.org/id/FBpp0078467" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "A Drosophila full-length cDNA resource.", "journal": "Genome Biol.", "date": "2002", "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "reference": [ { "type": "PubMed", "id": "12537569", "url": "https://glygen.org/publication/PubMed/12537569" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "Drosophila retinophilin contains MORN repeats and is conserved in humans.", "journal": "Mol. Genet. Genomics", "date": "2007", "authors": "Mecklenburg K.L.", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "reference": [ { "type": "PubMed", "id": "17285308", "url": "https://glygen.org/publication/PubMed/17285308" } ] }, { "title": "Retinophilin is a light-regulated phosphoprotein required to suppress photoreceptor dark noise in Drosophila.", "journal": "J. Neurosci.", "date": "2010", "authors": "Mecklenburg KL, Takemori N, Komori N, Chu B, Hardie RC, Matsumoto H, O'Tousa JE", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "reference": [ { "type": "PubMed", "id": "20107052", "url": "https://glygen.org/publication/PubMed/20107052" } ] }, { "title": "Dependence on a retinophilin/myosin complex for stability of PKC and INAD and termination of phototransduction.", "journal": "J. Neurosci.", "date": "2010", "authors": "Li R., Wang X., Li H.S., Mills E., Montell C., Elsaesser R., Venkatachalam K., Wasserman D.", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "reference": [ { "type": "PubMed", "id": "20739554", "url": "https://glygen.org/publication/PubMed/20739554" } ] }, { "title": "A model of toxic neuropathy in Drosophila reveals a role for MORN4 in promoting axonal degeneration.", "journal": "J. Neurosci.", "date": "2012", "authors": "Bhattacharya MR, Gerdts J, Naylor SA, Royse EX, Ebstein SY, Sasaki Y, Milbrandt J, DiAntonio A", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "reference": [ { "type": "PubMed", "id": "22496551", "url": "https://glygen.org/publication/PubMed/22496551" } ] }, { "title": "Invertebrate and vertebrate class III myosins interact with MORN repeat-containing adaptor proteins.", "journal": "PLoS ONE", "date": "2015", "authors": "Freed S.A., Mecklenburg K.L., O'Tousa J.E., Quintero O.A., Raval M., Yengo C.M.", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "reference": [ { "type": "PubMed", "id": "25822849", "url": "https://glygen.org/publication/PubMed/25822849" } ] } ], "pathway": [ { "id": "dme:Dmel_CG10233", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG10233", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q5BJS9-1", "protein_name": "MORN repeat-containing protein 4", "gene_name": "Morn4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFSQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGLPRNEGLFENNKLLRREKCSAVVQRAQSASKSARNLTA", "length": 146 }, "evidence": [ { "id": "Q9VN91", "url": "https://omabrowser.org/oma/group/Q9VN91/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6PGF2-1", "protein_name": "MORN repeat-containing protein 4", "gene_name": "Morn4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLVFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFSQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAVVQRAQSASKSARNLTA", "length": 146 }, "evidence": [ { "id": "Q9VN91", "url": "https://omabrowser.org/oma/group/Q9VN91/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8NDC4-1", "protein_name": "MORN repeat-containing protein 4", "gene_name": "MORN4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA", "length": 146 }, "evidence": [ { "id": "Q9VN91", "url": "https://omabrowser.org/oma/group/Q9VN91/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "visual perception", "id": "GO:0007601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007601", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "pmid": "" }, { "name": "response to axon injury", "id": "GO:0048678", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048678", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "pmid": "" }, { "name": "phototransduction", "id": "GO:0007602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007602", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cell projection", "id": "GO:0042995", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042995", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "pmid": "" }, { "name": "rhabdomere", "id": "GO:0016028", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016028", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "pmid": "" }, { "name": "rhabdomere membrane", "id": "GO:0033583", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033583", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "phosphorylated under dark conditions and is dephosphorylated by light exposure.", "evidence": [ { "database": "UniProtKB", "id": "Q9VN91", "url": "https://www.uniprot.org/uniprot/Q9VN91" }, { "database": "PubMed", "id": "20107052", "url": "https://glygen.org/publication/PubMed/20107052" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }