{
"uniprot_canonical_ac": "Q9VMU0-1",
"uniprot_ac": "Q9VMU0",
"uniprot_id": "Q9VMU0_DROME",
"mass": {
"chemical_mass": 14357.0,
"monoisotopic_mass": 14357.0
},
"refseq": {
"ac": "NP_001285613",
"name": "NADH dehydrogenase (ubiquinone) 13 kDa A subunit, isoform B",
"summary": "",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001285613"
},
"gene_names": [
{
"name": "ND-13A",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/Q9VMU0",
"id": "Q9VMU0"
},
{
"name": "CG8680; Dmel\\CG8680; dNDUFS6; NUMM",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001285613",
"id": "NP_001285613"
},
{
"name": "CG8680",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/Q9VMU0",
"id": "Q9VMU0"
},
{
"name": "Dmel\\CG8680",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/Q9VMU0",
"id": "Q9VMU0"
},
{
"name": "Dmel_CG8680",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/Q9VMU0",
"id": "Q9VMU0"
},
{
"name": "ND-13A",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001285613",
"id": "NP_001285613"
},
{
"name": "NUMM",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/Q9VMU0",
"id": "Q9VMU0"
},
{
"name": "dNDUFS6",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/Q9VMU0",
"id": "Q9VMU0"
}
],
"protein_names": [
{
"name": "NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "Q9VMU0"
},
{
"name": "CG8680-PB; ND-13A-PB; NADH-ubiquinone oxidoreductase 13 kDa-A subunit; NADH ubiquinone oxidoreductase 13 kDa A; NADH:ubiquinone oxidoreductase 13 kDa A subunit",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001285613",
"id": "NP_001285613"
},
{
"name": "NADH dehydrogenase (ubiquinone) 13 kDa A subunit, isoform B",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001285613",
"id": "NP_001285613"
}
],
"function": [
{
"annotation": "Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0#function"
},
{
"database": "UniProtKB",
"id": "ARBA00003195",
"url": "https://www.uniprot.org/uniprot/ARBA00003195#function"
},
{
"database": "UniProtKB",
"id": "PIRNR016564",
"url": "https://www.uniprot.org/uniprot/PIRNR016564#function"
}
]
}
],
"disease": [
{
"disease_id": "DOID:0060536",
"recommended_name": {
"id": "DOID:0060536",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0060536",
"name": "mitochondrial complex I deficiency",
"description": "A mitochondrial metabolism disease characterized by a wide range of manifestations including marked and often fatal lactic acidosis, cardiomyopathy, leukoencephalopathy, pure myopathy and hepatopathy with tubulopathy. Among the numerous clinical phenotypes observed are Leigh syndrome, Leber hereditary optic neuropathy and MELAS syndrome. It can have material basis in mutations in multiple different genes, both nuclear-encoded and mitochondrial-encoded."
},
"synonyms": [
{
"id": "DOID:0060536",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0060536",
"name": "isolated mitochondrial respiratory chain complex I deficiency",
"description": ""
},
{
"id": "DOID:0060536",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0060536",
"name": "isolated NADH-CoQ reductase deficiency",
"description": ""
},
{
"id": "DOID:0060536",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0060536",
"name": "isolated NADH-coenzyme Q reductase deficiency",
"description": ""
},
{
"id": "DOID:0060536",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0060536",
"name": "isolated NADH-ubiquinone reductase deficiency",
"description": ""
}
],
"evidence": [
{
"id": "0060536",
"database": "Alliance of Genome Resources",
"url": "https://www.alliancegenome.org/disease/DOID:0060536"
}
]
},
{
"disease_id": "DOID:0112073",
"recommended_name": {
"id": "DOID:0112073",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0112073",
"name": "nuclear type mitochondrial complex I deficiency 9",
"description": "A nuclear type mitochondrial complex I deficiency that has_material_basis_in homozygous or compound heterozygous mutation in the NDUFS6 gene on chromosome 5p15.33."
},
"synonyms": [
{
"id": "DOID:0112073",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0112073",
"name": "MC1DN9",
"description": ""
},
{
"id": "MONDO:0032615",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0032615",
"name": "mitochondrial complex 1 deficiency, nuclear type 9",
"description": ""
},
{
"id": "MONDO:0032615",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0032615",
"name": "MC1DN9",
"description": ""
},
{
"id": "MONDO:0032615",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0032615",
"name": "MITOCHONDRIAL COMPLEX I DEFICIENCY, NUCLEAR TYPE 9",
"description": ""
},
{
"id": "MIM:618232",
"resource": "MIM",
"url": "https://www.omim.org/entry/618232",
"name": "Mitochondrial complex I deficiency, nuclear type 9",
"description": "Mitochondrial complex I deficiency, nuclear type 9"
}
],
"evidence": [
{
"id": "0112073",
"database": "Alliance of Genome Resources",
"url": "https://www.alliancegenome.org/disease/DOID:0112073"
}
]
},
{
"disease_id": "DOID:2349",
"recommended_name": {
"id": "DOID:2349",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:2349",
"name": "arteriosclerosis",
"description": "An artery disease that is characterized by a thickening and hardening of arterial walls in the arteries."
},
"synonyms": [
{
"id": "DOID:2349",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:2349",
"name": "Arteriosclerotic vascular disease",
"description": ""
}
],
"evidence": [
{
"id": "2349",
"database": "Alliance of Genome Resources",
"url": "https://www.alliancegenome.org/disease/DOID:2349"
}
]
},
{
"disease_id": "DOID:4362",
"recommended_name": {
"id": "DOID:4362",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4362",
"name": "cervical cancer",
"description": "A female reproductive organ cancer that is located_in the cervix."
},
"synonyms": [
{
"id": "DOID:4362",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4362",
"name": "cervical neoplasm",
"description": ""
},
{
"id": "DOID:4362",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4362",
"name": "cervix cancer",
"description": ""
},
{
"id": "DOID:4362",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4362",
"name": "cervix uteri cancer",
"description": ""
},
{
"id": "DOID:4362",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4362",
"name": "neoplasm of uterine cervix",
"description": ""
},
{
"id": "DOID:4362",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4362",
"name": "tumor of the Cervix Uteri",
"description": ""
},
{
"id": "DOID:4362",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4362",
"name": "uterine cervical neoplasm",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "cervical cancer",
"description": "A primary or metastatic malignant neoplasm involving the cervix."
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "cervical neoplasm",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "tumor of the cervix uteri",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "tumour of the cervix uteri",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "uterine cervical neoplasm",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "cancer of uterine cervix",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "cervical cancer, somatic",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "cervix cancer",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "cervix uteri cancer",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant cervical neoplasm",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant cervical tumor",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant cervical tumour",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant cervix neoplasm",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant cervix tumor",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant cervix tumour",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant cervix uteri neoplasm",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant cervix uteri tumor",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant cervix uteri tumour",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant neoplasm of cervix",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant neoplasm of cervix uteri",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant neoplasm of the cervix",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant neoplasm of the cervix uteri",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant neoplasm of the uterine cervix",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant neoplasm of uterine cervix",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant tumor of cervix",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant tumor of cervix uteri",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant tumor of the cervix",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant tumor of the cervix uteri",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant tumor of the uterine cervix",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant tumor of uterine cervix",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant tumour of cervix",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant tumour of cervix uteri",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant tumour of the cervix",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant tumour of the cervix uteri",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant tumour of the uterine cervix",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant tumour of uterine cervix",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant uterine cervix neoplasm",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant uterine cervix tumor",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "malignant uterine cervix tumour",
"description": ""
},
{
"id": "MONDO:0002974",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0002974",
"name": "uterine cervix cancer",
"description": ""
},
{
"id": "MIM:603956",
"resource": "MIM",
"url": "https://www.omim.org/entry/603956",
"name": "Cervical cancer",
"description": "Cervical cancer"
}
],
"evidence": [
{
"id": "4362",
"database": "Alliance of Genome Resources",
"url": "https://www.alliancegenome.org/disease/DOID:4362"
}
]
}
],
"snv": [],
"mutagenesis": [],
"expression_tissue": [],
"expression_disease": [],
"species": [
{
"name": "Drosophila melanogaster",
"taxid": 7227,
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"common_name": "Fruit fly"
}
],
"gene": [
{
"name": "ND-13A",
"url": "https://www.uniprot.org/uniprot/Q9VMU0",
"locus": {
"chromosome": "2L",
"start_pos": 5099177,
"end_pos": 5100288,
"strand": "+",
"evidence": [
{
"database": "Ensembl Gene",
"id": "FBgn0031684",
"url": "https://www.ensembl.org/id/FBgn0031684"
}
]
}
}
],
"crossref": [
{
"id": "FBgn0031684",
"url": "https://bgee.org/?page=gene&gene_id=FBgn0031684",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "FBgn0031684",
"url": "https://flybase.org/reports/FBgn0031684",
"database": "FlyBase",
"categories": [
"Organism-specific"
]
},
{
"id": "33744",
"url": "https://www.ncbi.nlm.nih.gov/gene/33744",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "Q9VMU0",
"url": "https://www.ebi.ac.uk/intact/interactors/id:Q9VMU0*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR016668",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR016668",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR019401",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR019401",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "dme:Dmel_CG8680",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG8680",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "VRFVNAK",
"url": "https://omabrowser.org/oma/group/VRFVNAK/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "6826at2759",
"url": "http://www.orthodb.org/?query=6826at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR13156",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13156",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR13156:SF0",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13156:SF0",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "8B9Z",
"url": "https://www.rcsb.org/structure/8B9Z",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8BA0",
"url": "https://www.rcsb.org/structure/8BA0",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8ESW",
"url": "https://www.rcsb.org/structure/8ESW",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8ESZ",
"url": "https://www.rcsb.org/structure/8ESZ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF10276",
"url": "http://pfam.xfam.org/family/PF10276",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "R-DME-611105",
"url": "https://www.reactome.org/PathwayBrowser/#R-DME-611105",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-DME-6799198",
"url": "https://www.reactome.org/PathwayBrowser/#R-DME-6799198",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_001285613",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001285613",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "Q9VMU0-1",
"url": "https://www.uniprot.org/uniprot/Q9VMU0-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MASKQLVNNLSKLGLPRQNWMSPLASVRHSSCRGDIEKVTHTGQVFDKEDYRNARFVNAKRYVNENWGIKLIEEVPPKECTERVVFCDGGDGPLGHPKVYINLDKPGNHICGYCGLRFVKKDDHHH",
"length": 126,
"header": "tr|Q9VMU0-1|Q9VMU0_DROME Isoform 1 of NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ND-13A PE=1 SV=1 CANONICAL=Q9VMU0-1"
},
"isoforms": [
{
"isoform_ac": "Q9VMU0-1",
"url": "",
"sequence": {
"sequence": "MASKQLVNNLSKLGLPRQNWMSPLASVRHSSCRGDIEKVTHTGQVFDKEDYRNARFVNAKRYVNENWGIKLIEEVPPKECTERVVFCDGGDGPLGHPKVYINLDKPGNHICGYCGLRFVKKDDHHH",
"length": 126,
"header": "tr|Q9VMU0-1|Q9VMU0_DROME Isoform 1 of NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ND-13A PE=1 SV=1 CANONICAL=Q9VMU0-1"
},
"locus": {
"chromosome": "2L",
"start_pos": 5100141,
"end_pos": 5099605,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "FBtr0079025",
"url": "https://www.ensembl.org/id/FBtr0079025"
},
{
"database": "Ensembl Peptide",
"id": "FBpp0078662",
"url": "https://www.ensembl.org/id/FBpp0078662"
}
]
}
}
],
"glycosylation": [],
"phosphorylation": [],
"glycation": [],
"keywords": [],
"publication": [
{
"title": "The genome sequence of Drosophila melanogaster.",
"journal": "Science",
"date": "2000",
"authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"reference": [
{
"type": "PubMed",
"id": "10731132",
"url": "https://glygen.org/publication/PubMed/10731132"
}
]
},
{
"title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.",
"journal": "Genome Biol.",
"date": "2002",
"authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"reference": [
{
"type": "PubMed",
"id": "12537568",
"url": "https://glygen.org/publication/PubMed/12537568"
}
]
},
{
"title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.",
"journal": "Genome Biol.",
"date": "2002",
"authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"reference": [
{
"type": "PubMed",
"id": "12537572",
"url": "https://glygen.org/publication/PubMed/12537572"
}
]
},
{
"title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.",
"journal": "Genome Biol.",
"date": "2002",
"authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"reference": [
{
"type": "PubMed",
"id": "12537573",
"url": "https://glygen.org/publication/PubMed/12537573"
}
]
},
{
"title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.",
"journal": "Genome Biol.",
"date": "2002",
"authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"reference": [
{
"type": "PubMed",
"id": "12537574",
"url": "https://glygen.org/publication/PubMed/12537574"
}
]
},
{
"title": "Combined evidence annotation of transposable elements in genome sequences.",
"journal": "PLoS Comput. Biol.",
"date": "2005",
"authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"reference": [
{
"type": "PubMed",
"id": "16110336",
"url": "https://glygen.org/publication/PubMed/16110336"
}
]
},
{
"title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.",
"journal": "Science",
"date": "2007",
"authors": "Smith CD, Shu S, Mungall CJ, Karpen GH",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"reference": [
{
"type": "PubMed",
"id": "17569856",
"url": "https://glygen.org/publication/PubMed/17569856"
}
]
},
{
"title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.",
"journal": "Science",
"date": "2007",
"authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"reference": [
{
"type": "PubMed",
"id": "17569867",
"url": "https://glygen.org/publication/PubMed/17569867"
}
]
},
{
"title": "The Release 6 reference sequence of the Drosophila melanogaster genome.",
"journal": "Genome Res.",
"date": "2015",
"authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"reference": [
{
"type": "PubMed",
"id": "25589440",
"url": "https://glygen.org/publication/PubMed/25589440"
}
]
},
{
"title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.",
"journal": "G3 (Bethesda)",
"date": "2015",
"authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"reference": [
{
"type": "PubMed",
"id": "26109356",
"url": "https://glygen.org/publication/PubMed/26109356"
}
]
},
{
"title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.",
"journal": "G3 (Bethesda)",
"date": "2015",
"authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"reference": [
{
"type": "PubMed",
"id": "26109357",
"url": "https://glygen.org/publication/PubMed/26109357"
}
]
},
{
"title": "Cryo-EM structures of mitochondrial respiratory complex I from Drosophila melanogaster.",
"journal": "Elife",
"date": "2023",
"authors": "Hirst J., Sanchez-Martinez A., Whitworth A.J., Chung I., Agip A.A.",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"reference": [
{
"type": "PubMed",
"id": "36622099",
"url": "https://glygen.org/publication/PubMed/36622099"
}
]
},
{
"title": "Resting mitochondrial complex I from Drosophila melanogaster adopts a helix-locked state.",
"journal": "Elife",
"date": "2023",
"authors": "Letts J.A., Owusu-Ansah E., Murari A., Padavannil A., Rhooms S.K.",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"reference": [
{
"type": "PubMed",
"id": "36952377",
"url": "https://glygen.org/publication/PubMed/36952377"
}
]
}
],
"pathway": [
{
"id": "dme:Dmel_CG8680",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG8680",
"resource": "KEGG Pathway"
},
{
"id": "R-DME-611105",
"name": "Respiratory electron transport",
"url": "https://www.reactome.org/PathwayBrowser/#R-DME-611105",
"resource": "Reactome",
"description": "Respiratory electron transport"
},
{
"id": "R-DME-6799198",
"name": "Complex I biogenesis",
"url": "https://www.reactome.org/PathwayBrowser/#R-DME-6799198",
"resource": "Reactome",
"description": "Complex I biogenesis"
}
],
"orthologs": [],
"go_annotation": {
"categories": [
{
"name": "Cellular Component",
"total": 1,
"go_terms": [
{
"name": "mitochondrial respiratory chain complex I",
"id": "GO:0005747",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005747",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 2,
"go_terms": [
{
"name": "mitochondrial electron transport, NADH to ubiquinone",
"id": "GO:0006120",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006120",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"pmid": ""
},
{
"name": "respiratory electron transport chain",
"id": "GO:0022904",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022904",
"evidence": [
{
"database": "UniProtKB",
"id": "Q9VMU0",
"url": "https://www.uniprot.org/uniprot/Q9VMU0"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 9,
"end_pos": 11,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [],
"interactions": [],
"reactions": [],
"reaction_participants": [],
"reaction_enzymes": [],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [],
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 13
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}