{
    "uniprot_canonical_ac": "Q9VHR2-1",
    "uniprot_ac": "Q9VHR2",
    "uniprot_id": "Q9VHR2_DROME",
    "mass": {
        "chemical_mass": 206681.0,
        "monoisotopic_mass": 206681.0
    },
    "refseq": {
        "ac": "NP_001303497",
        "name": "uncharacterized protein, isoform F",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001303497"
    },
    "gene_names": [
        {
            "name": "CG11729",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CG42286",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CT32186",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "GS3056",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "MRE1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "anon-EST:Posey178",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "43462; anon-EST:Posey178; BcDNA:AT05815; BcDNA:GH22170; CG11718; CG11729; CG11730; CG11731; CG11733; CG31264; CG31369; CG31462; CG42285; CG42286; CG43462; CT32186; Dmel\\CG45263; GH22170; GS3056; MRE1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001246988",
            "id": "NP_001246988"
        },
        {
            "name": "43462",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "BcDNA:AT05815",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "BcDNA:GH22170",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CG11718",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CG11729",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CG11730",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CG11731",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CG11733",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CG31264",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CG31369",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CG31462",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CG42285",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CG42286",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CG43462",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CG45263",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001246988",
            "id": "NP_001246988"
        },
        {
            "name": "CG45263",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "CT32186",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "Dmel\\CG45263",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "Dmel_CG45263",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "GH22170",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "GS3056",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "MRE1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        },
        {
            "name": "anon-EST:Posey178",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "id": "Q9VHR2"
        }
    ],
    "protein_names": [
        {
            "name": "CG45263-PB; mRNA-like ncRNA in embryogenesis 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_731247",
            "id": "NP_731247"
        },
        {
            "name": "CG45263-PC; mRNA-like ncRNA in embryogenesis 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001246988",
            "id": "NP_001246988"
        },
        {
            "name": "CG45263-PD; mRNA-like ncRNA in embryogenesis 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001246989",
            "id": "NP_001246989"
        },
        {
            "name": "CG45263-PE; mRNA-like ncRNA in embryogenesis 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_731246",
            "id": "NP_731246"
        },
        {
            "name": "CG45263-PF; mRNA-like ncRNA in embryogenesis 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001303497",
            "id": "NP_001303497"
        },
        {
            "name": "CG45263-PG; mRNA-like ncRNA in embryogenesis 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001303498",
            "id": "NP_001303498"
        },
        {
            "name": "Uncharacterized protein, isoform E",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9VHR2"
        },
        {
            "name": "uncharacterized protein, isoform B",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_731247",
            "id": "NP_731247"
        },
        {
            "name": "uncharacterized protein, isoform C",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001246988",
            "id": "NP_001246988"
        },
        {
            "name": "uncharacterized protein, isoform D",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001246989",
            "id": "NP_001246989"
        },
        {
            "name": "uncharacterized protein, isoform E",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_731246",
            "id": "NP_731246"
        },
        {
            "name": "uncharacterized protein, isoform F",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001303497",
            "id": "NP_001303497"
        },
        {
            "name": "uncharacterized protein, isoform G",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001303498",
            "id": "NP_001303498"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Drosophila melanogaster",
            "taxid": 7227,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9VHR2",
                    "url": "https://www.uniprot.org/uniprot/Q9VHR2"
                }
            ],
            "common_name": "Fruit fly"
        }
    ],
    "gene": [
        {
            "name": "CG42286",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "locus": {
                "chromosome": "3R",
                "start_pos": 8364328,
                "end_pos": 8477617,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "FBgn0266801",
                        "url": "https://www.ensembl.org/id/FBgn0266801"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "FBgn0266801",
            "url": "https://bgee.org/?page=gene&gene_id=FBgn0266801",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "cd00096",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00096",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "FBgn0266801",
            "url": "https://flybase.org/reports/FBgn0266801",
            "database": "FlyBase",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "50003",
            "url": "https://www.ncbi.nlm.nih.gov/gene/50003",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q9VHR2",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9VHR2*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR003598",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR003599",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR007110",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013162",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013162",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013783",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036179",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "dme:Dmel_CG45263",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG45263",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "HHIAXRE",
            "url": "https://omabrowser.org/oma/group/HHIAXRE/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "2875566at2759",
            "url": "http://www.orthodb.org/?query=2875566at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11640",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11640",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11640:SF154",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11640:SF154",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF08205",
            "url": "http://pfam.xfam.org/family/PF08205",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF13927",
            "url": "http://pfam.xfam.org/family/PF13927",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DME-373753",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DME-373753",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_731246",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_731246",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0B4K609",
            "url": "https://www.uniprot.org/uniprot/A0A0B4K609",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0B4K609-1",
            "url": "https://www.uniprot.org/uniprot/A0A0B4K609-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0B4K642",
            "url": "https://www.uniprot.org/uniprot/A0A0B4K642",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0B4K642-1",
            "url": "https://www.uniprot.org/uniprot/A0A0B4K642-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A126GUR3",
            "url": "https://www.uniprot.org/uniprot/A0A126GUR3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A126GUR3-1",
            "url": "https://www.uniprot.org/uniprot/A0A126GUR3-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A126GUS1",
            "url": "https://www.uniprot.org/uniprot/A0A126GUS1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A126GUS1-1",
            "url": "https://www.uniprot.org/uniprot/A0A126GUS1-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9VHQ8",
            "url": "https://www.uniprot.org/uniprot/Q9VHQ8",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9VHQ8-1",
            "url": "https://www.uniprot.org/uniprot/Q9VHQ8-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9VHR2",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9VHR2-1",
            "url": "https://www.uniprot.org/uniprot/Q9VHR2-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSSQNRSKRSSRSRSSISTSISSSGSSTKIAQLLLLIGIAVASCLPGSEGFQRFSEQPKYTEVNPAEDTLLTCKVIDKRGTCSWQKDNKPVGIYTKKYEWASRMPTSDNGNVLHLDLHPPPVQLGGDCSLWIRSATLDFDDGLWECQVTASDFTTQDALTSQPVRLVVRVAPQRPRLEYEAVHVPPGHNITADAGALATVKCISHYGNPPATLKWFLGDQEISPIHPQMNATEPDNPRTWSATSVVQVSAMRERHGDILRCAAYHESYTAKSVVVEARLDVKYAPSIRLIGSPEIDLEEDKDALVLRCVADANPPASIVWRRAGRSEIASLQETLQLRPVGRRDAGLYTCQAQNSVGTSEQLSVQLDVKYPPKIISAGPDRLTTAPLFSPAAFECLADGNPLPSFKWVQRMAHGSKYVERGSESRLVIDNVTYEYQGEYECRATSYINGQERVAISDPVSLQVVGAPQVLRLHPSLHTVSVKRGEAASLTMVVCADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQPDTREDCYLSTLHILHADEHDSRPYYLVVENERGTDRHAIHLIVEGTFAEPYEMSYLMGVAGGCMAAILLLVCLCIYAIKSKRCCFKGSTGYKSSDKDSEKADLKSRSDSTSGPQGDSIYTTPAGFHHHQQQQQQQQQQQHAAAAAAAALHAASQHPQQQYPGHGSPEAMKVRMAAMILQPPTRVXQAIDTTSESNEQLTQQQQQDDNKNKNKNENEHQNELTDQHTTSNEQRLDDSSVSHNNNNNHKISSTSTTVLTNSDNNNTSEVAKASDSSNSEGGSSLTSSKTSSSKRDLENNMNRDIKPATAPKLLHLNVTSGEQQEHQQPGPVDPLPVGPLTPEETQVLLQKLSINNPFYRFRKQSNSLKELRRKTGSDAPSVRSRSETDLGQVRGQQLMPHQQHSEAKVVVVLDSKQKEVAISRPRSSVSLKTRSVSSLSPSTNQMGDSSTVITNPFSIFHDDEILTLSVNTRLRSAANARSSRPQRQGRGLRRLFESNRSQNPPSEHHYLHGVPVRRFERQDFDNDSGDLLGRRTNTSSGKPKRSRAIFKQLSLRKLHNRAAAEEPPSLPKLKLSYPNRTHSIQSMRASGGGGYDIQHTTAYHPRLNHSTSPVTKANYFERLQAKTRQGIQKIRDKCRNFKTTTGEGGSLGGSEFSGFHTLAKDESFRFISDRANISSYESRCKQATIYKSYKSEIDLSKNLHYLDAYLEQNFDHQLSTTKQSAHSVGRVSGAQRKALAKQHDPTPETPRPPRHKRSQSQAANYGANYENLGTLPIASKSKVRNTALNSDSMSSSDYASVFSGPTTNRQEPEEDPKDFKLRYEHPDKMCEYYFDNLTSYALALEESEDLLLAESAKSARFFYDDDEEDDDGDEAGLAVDGLSAEDEAAGGRPDYMARDIRIRVKVNECEDADWHQPASATSYNENLAESTFYQSLNQHLQRQEVGDEVGLEDQNLLVGERGVGENYLEHFQRHRGRNYDRTTNSAHYRRAEFYGFGRSAGEGGEQPDVDRQRRADLMEAHYARSYQSGSRAKGRTRAHALEMERQHAAIPTAAATAMPAATGSVINLALPGQSSDVLYATSSKQQITMPMPTAGPQFHQPKPEPAALAAVGAVAATAMAAGTATAVTPAGGATTLVAVSSAGNANNRYMLENLRKYYANQHQHPPAHSVNSSSLSNSSSSNSSMSQQQQQQHLKLNLNLQPTAPKVQQQHLGNRRNSSTSNASSTADNFDTFIALRNATANTSTDYMAKQQQHRRGTQQQQQQQQSVPLTSALNYYGHGATPTLNPALAYNGKLTATAMLSQVNLSRATVQPTAAATSSVAAATTVPLLLPHQQHSRSTSKGEGFILEYEC",
        "length": 1876,
        "header": "tr|Q9VHR2-1|Q9VHR2_DROME Isoform 1 of Uncharacterized protein, isoform E  OS=Drosophila melanogaster OX=7227 GN=CG42286 PE=1 SV=4 CANONICAL=Q9VHR2-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A0B4K609-1",
            "url": "",
            "sequence": {
                "sequence": "MSSQNRSKRSSRSRSSISTSISSSGSSTKIAQLLLLIGIAVASCLPGSEGFQRFSEQPKYTEVNPAEDTLLTCKVIDKRGTCSWQKDNKPVGIYTKKYEWASRMPTSDNGNVLHLDLHPPPVQLGGDCSLWIRSATLDFDDGLWECQVTASDFTTQDALTSQPVRLVVRVAPQRPRLEYEAVHVPPGHNITADAGALATVKCISHYGNPPATLKWFLGDQEISPIHPQMNATEPDNPRTWSATSVVQVSAMRERHGDILRCAAYHESYTAKSVVVEARLDVKYAPSIRLIGSPEIDLEEDKDALVLRCVADANPPASIVWRRAGRSEIASLQETLQLRPVGRRDAGLYTCQAQNSVGTSEQLSVQLDVKYPPKIISAGPDRLTTAPLFSPAAFECLADGNPLPSFKWVQRMAHGSKYVERGSESRLVIDNVTYEYQGEYECRATSYINGQERVAISDPVSLQVVGAPQVLRLHPSLHTVSVKRGEAASLTMVVCADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQPDTREDCYLSTLHILHADEHDSRPYYLVVENERGTDRHAIHLIVEGTFAEPYEMSYLMGVAGGCMAAILLLVCLCIYAIKSKRCCFKGSTGYKSSDKDSEKADLKSRSDSTSGPQGDSIYTTPAGFHHHQQQQQQQQQQQHAAAAAAAALHAASQHPQQQYPGHGSPEAMKSSSQARSSGHDELGNLLWQQDSCEFHEHYPSDSSCPVPPLRHCHAPGHGHATKTLTRRNADLFSGDLGIPEINTHVGSVVHTFETLALQRRLAEEEDRHPERELSKYEANGGTTTQSKYSQLKRRSQEMRQRLVQQLHRQRLQQQQLQQQHEPHLQHQQIARSRTQSQPQKQPTMHEGVLTNSCSTQTLATGFWPFQPSQRVDDSRQQLQQSTFEDYRKNLFGTLRRHGSLEDNEELQDESFIVNAAFDEIFSCYDDDNEDDKGTQTQTNTDDLFEDEHMLVSLSELDDEVFASRAQTASTTPTASAGMGAGRTPKHSTPQLNHNKYTAPSPPRSRTLTNLFERLKSQDNKTLQKYAANGALNKTEDFNRGSTVSKSFVQHLRKPSHKQKRAPRPPPKPQSRSQVAIAHVTPLRKALIFPKRSKSSSELLLDDLSVQARKYQRRIEQGSAL",
                "length": 1148,
                "header": "tr|A0A0B4K609-1|Q9VHR2_DROME Computationally mapped isoform of Uncharacterized protein, isoform E  OS=Drosophila melanogaster OX=7227 GN=CG42286 PE=1 SV=1 CANONICAL=Q9VHR2-1"
            },
            "locus": {
                "chromosome": "3R",
                "start_pos": 8443531,
                "end_pos": 8365094,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0345458",
                        "url": "https://www.ensembl.org/id/FBtr0345458"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0311576",
                        "url": "https://www.ensembl.org/id/FBpp0311576"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A0B4K642-1",
            "url": "",
            "sequence": {
                "sequence": "MSSQNRSKRSSRSRSSISTSISSSGSSTKIAQLLLLIGIAVASCLPGSEGFQRFSEQPKYTEVNPAEDTLLTCKVIDKRGTCSWQKDNKPVGIYTKKYEWASRMPTSDNGNVLHLDLHPPPVQLGGDCSLWIRSATLDFDDGLWECQVTASDFTTQDALTSQPVRLVVRVAPQRPRLEYEAVHVPPGHNITADAGALATVKCISHYGNPPATLKWFLGDQEISPIHPQMNATEPDNPRTWSATSVVQVSAMRERHGDILRCAAYHESYTAKSVVVEARLDVKYAPSIRLIGSPEIDLEEDKDALVLRCVADANPPASIVWRRAGRSEIASLQETLQLRPVGRRDAGLYTCQAQNSVGTSEQLSVQLDVKYPPKIISAGPDRLTTAPLFSPAAFECLADGNPLPSFKWVQRMAHGSKYVERGSESRLVIDNVTYEYQGEYECRATSYINGQERVAISDPVSLQVVGAPQVLRLHPSLHTVSVKRGEAASLTMVVCADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQPDTREDCYLSTLHILHADEHDSRPYYLVVENERGTDRHAIHLIVEGTFAEPYEMSYLMGVAGGCMAAILLLVCLCIYAIKSKRCCFKGSTGYKSSDKDSEKADLKSRSDSTSGPQGDSIYTTPAGFHHHQQQQQQQQQQQHAAAAAAAALHAASQHPQQQYPGHGSPEAMKSVPVLRTFGGHHIAXREREREVGGASSPSTTIATPTGTPPLLPPLPNTFVAIKTKSDCSSSNHSNSNNSNSNNSLTLHSGNNSFKSSGHRKSPQPPPLPMKNGAKQQQQQQESHYQHLNYQQHPGSNARNTLDRKQQSNTGGDYCTQINPHYLQTFDSLDHYSVATMQQQPLRSQSKSQIYSYGSSGTTSDNSNHNQQHLPHQHYHSSSNIAHIEHHHHPQNGSDRYSHPHMQQAHLQHQQQHQQQHQLQQQQHHSLKHTKHGKGHKNGKHGSKGSSSKSQDDFKVLHKQQMQPPKCSGNSKSAKRNGCGNQVLPLPPQQQHYSSSSDSLPFDNNYY",
                "length": 1034,
                "header": "tr|A0A0B4K642-1|A0A0B4K642_DROME Computationally mapped isoform of Uncharacterized protein, isoform D  OS=Drosophila melanogaster OX=7227 GN=CG11729 PE=1 SV=1 CANONICAL=Q9VHR2-1"
            },
            "locus": {
                "chromosome": "3R",
                "start_pos": 8443531,
                "end_pos": 8367621,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0345459",
                        "url": "https://www.ensembl.org/id/FBtr0345459"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0311577",
                        "url": "https://www.ensembl.org/id/FBpp0311577"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A126GUR3-1",
            "url": "",
            "sequence": {
                "sequence": "MSSQNRSKRSSRSRSSISTSISSSGSSTKIAQLLLLIGIAVASCLPGSEGFQRFSEQPKYTEVNPAEDTLLTCKVIDKRGTCSWQKDNKPVGIYTKKYEWASRMPTSDNGNVLHLDLHPPPVQLGGDCSLWIRSATLDFDDGLWECQVTASDFTTQDALTSQPVRLVVRVAPQRPRLEYEAVHVPPGHNITADAGALATVKCISHYGNPPATLKWFLGDQEISPIHPQMNATEPDNPRTWSATSVVQVSAMRERHGDILRCAAYHESYTAKSVVVEARLDVKYAPSIRLIGSPEIDLEEDKDALVLRCVADANPPASIVWRRAGRSEIASLQETLQLRPVGRRDAGLYTCQAQNSVGTSEQLSVQLDVKYPPKIISAGPDRLTTAPLFSPAAFECLADGNPLPSFKWVQRMAHGSKYVERGSESRLVIDNVTYEYQGEYECRATSYINGQERVAISDPVSLQVVGAPQVLRLHPSLHTVSVKRGEAASLTMVVCADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQPDTREDCYLSTLHILHADEHDSRPYYLVVENERGTDRHAIHLIVEGTFAEPYEMSYLMGVAGGCMAAILLLVCLCIYAIKSKRCCFKGSTGYKSSDKDSEKADLKSRSDSTSGPQGDSIYTTPAGFHHHQQQQQQQQQQQHAAAAAAAALHAASQHPQQQYPGHGSPEAMKSVPVLRTFGGHHIA",
                "length": 711,
                "header": "tr|A0A126GUR3-1|A0A126GUR3_DROME Computationally mapped isoform of Uncharacterized protein, isoform F  OS=Drosophila melanogaster OX=7227 GN=GS3056 PE=1 SV=1 CANONICAL=Q9VHR2-1"
            },
            "locus": {
                "chromosome": "3R",
                "start_pos": 8443531,
                "end_pos": 8368590,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0346728",
                        "url": "https://www.ensembl.org/id/FBtr0346728"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0312337",
                        "url": "https://www.ensembl.org/id/FBpp0312337"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A126GUS1-1",
            "url": "",
            "sequence": {
                "sequence": "MSSQNRSKRSSRSRSSISTSISSSGSSTKIAQLLLLIGIAVASCLPGSEGFQRFSEQPKYTEVNPAEDTLLTCKVIDKRGTCSWQKDNKPVGIYTKKYEWASRMPTSDNGNVLHLDLHPPPVQLGGDCSLWIRSATLDFDDGLWECQVTASDFTTQDALTSQPVRLVVRVAPQRPRLEYEAVHVPPGHNITADAGALATVKCISHYGNPPATLKWFLGDQEISPIHPQMNATEPDNPRTWSATSVVQVSAMRERHGDILRCAAYHESYTAKSVVVEARLDVKYAPSIRLIGSPEIDLEEDKDALVLRCVADANPPASIVWRRAGRSEIASLQETLQLRPVGRRDAGLYTCQAQNSVGTSEQLSVQLDVKYPPKIISAGPDRLTTAPLFSPAAFECLADGNPLPSFKWVQRMAHGSKYVERGSESRLVIDNVTYEYQGEYECRATSYINGQERVAISDPVSLQVVGAPQVLRLHPSLHTVSVKRGEAASLTMVVCADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQPDTREDCYLSTLHILHADEHDSRPYYLVVENERGTDRHAIHLIVEGTFAEPYEMSYLMGVAGGCMAAILLLVCLCIYAIKSKRCCFKGSTGYKSSDKDSEKADLKSRSDSTSGPQGDSIYTTPAGFHHHQQQQQQQQQQQHAAAAAAAALHAASQHPQQQYPGHGSPEAMKVRMAAMILQPPTRV",
                "length": 711,
                "header": "tr|A0A126GUS1-1|A0A126GUS1_DROME Computationally mapped isoform of Uncharacterized protein, isoform G  OS=Drosophila melanogaster OX=7227 GN=CT32186 PE=1 SV=1 CANONICAL=Q9VHR2-1"
            },
            "locus": {
                "chromosome": "3R",
                "start_pos": 8443531,
                "end_pos": 8388542,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0346729",
                        "url": "https://www.ensembl.org/id/FBtr0346729"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0312338",
                        "url": "https://www.ensembl.org/id/FBpp0312338"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q9VHQ8-1",
            "url": "",
            "sequence": {
                "sequence": "MSSQNRSKRSSRSRSSISTSISSSGSSTKIAQLLLLIGIAVASCLPGSEGFQRFSEQPKYTEVNPAEDTLLTCKVIDKRGTCSWQKDNKPVGIYTKKYEWASRMPTSDNGNVLHLDLHPPPVQLGGDCSLWIRSATLDFDDGLWECQVTASDFTTQDALTSQPVRLVVRVAPQRPRLEYEAVHVPPGHNITADAGALATVKCISHYGNPPATLKWFLGDQEISPIHPQMNATEPDNPRTWSATSVVQVSAMRERHGDILRCAAYHESYTAKSVVVEARLDVKYAPSIRLIGSPEIDLEEDKDALVLRCVADANPPASIVWRRAGRSEIASLQETLQLRPVGRRDAGLYTCQAQNSVGTSEQLSVQLDVKYPPKIISAGPDRLTTAPLFSPAAFECLADGNPLPSFKWVQRMAHGSKYVERGSESRLVIDNVTYEYQGEYECRATSYINGQERVAISDPVSLQVVGAPQVLRLHPSLHTVSVKRGEAASLTMVVCADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQPDTREDCYLSTLHILHADEHDSRPYYLVVENERGTDRHAIHLIVEGTFAEPYEMSYLMGVAGGCMAAILLLVCLCIYAIKSKRCCFKGSTGYKSSDKDSEKADLKSRSDSTSGPQGDSIYTTPAGFHHHQQQQQQQQQQQHAAAAAAAALHAASQHPQQQYPGHGSPEAMKLKVRIYETERLQTPIRIQISKSSQDLAGSEDEDDS",
                "length": 732,
                "header": "tr|Q9VHQ8-1|Q9VHQ8_DROME Computationally mapped isoform of Uncharacterized protein, isoform B  OS=Drosophila melanogaster OX=7227 GN=anon-EST:Posey178 PE=1 SV=4 CANONICAL=Q9VHR2-1"
            },
            "locus": {
                "chromosome": "3R",
                "start_pos": 8443531,
                "end_pos": 8379278,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0345457",
                        "url": "https://www.ensembl.org/id/FBtr0345457"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0311575",
                        "url": "https://www.ensembl.org/id/FBpp0311575"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q9VHR2-1",
            "url": "",
            "sequence": {
                "sequence": "MSSQNRSKRSSRSRSSISTSISSSGSSTKIAQLLLLIGIAVASCLPGSEGFQRFSEQPKYTEVNPAEDTLLTCKVIDKRGTCSWQKDNKPVGIYTKKYEWASRMPTSDNGNVLHLDLHPPPVQLGGDCSLWIRSATLDFDDGLWECQVTASDFTTQDALTSQPVRLVVRVAPQRPRLEYEAVHVPPGHNITADAGALATVKCISHYGNPPATLKWFLGDQEISPIHPQMNATEPDNPRTWSATSVVQVSAMRERHGDILRCAAYHESYTAKSVVVEARLDVKYAPSIRLIGSPEIDLEEDKDALVLRCVADANPPASIVWRRAGRSEIASLQETLQLRPVGRRDAGLYTCQAQNSVGTSEQLSVQLDVKYPPKIISAGPDRLTTAPLFSPAAFECLADGNPLPSFKWVQRMAHGSKYVERGSESRLVIDNVTYEYQGEYECRATSYINGQERVAISDPVSLQVVGAPQVLRLHPSLHTVSVKRGEAASLTMVVCADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQPDTREDCYLSTLHILHADEHDSRPYYLVVENERGTDRHAIHLIVEGTFAEPYEMSYLMGVAGGCMAAILLLVCLCIYAIKSKRCCFKGSTGYKSSDKDSEKADLKSRSDSTSGPQGDSIYTTPAGFHHHQQQQQQQQQQQHAAAAAAAALHAASQHPQQQYPGHGSPEAMKVRMAAMILQPPTRVXQAIDTTSESNEQLTQQQQQDDNKNKNKNENEHQNELTDQHTTSNEQRLDDSSVSHNNNNNHKISSTSTTVLTNSDNNNTSEVAKASDSSNSEGGSSLTSSKTSSSKRDLENNMNRDIKPATAPKLLHLNVTSGEQQEHQQPGPVDPLPVGPLTPEETQVLLQKLSINNPFYRFRKQSNSLKELRRKTGSDAPSVRSRSETDLGQVRGQQLMPHQQHSEAKVVVVLDSKQKEVAISRPRSSVSLKTRSVSSLSPSTNQMGDSSTVITNPFSIFHDDEILTLSVNTRLRSAANARSSRPQRQGRGLRRLFESNRSQNPPSEHHYLHGVPVRRFERQDFDNDSGDLLGRRTNTSSGKPKRSRAIFKQLSLRKLHNRAAAEEPPSLPKLKLSYPNRTHSIQSMRASGGGGYDIQHTTAYHPRLNHSTSPVTKANYFERLQAKTRQGIQKIRDKCRNFKTTTGEGGSLGGSEFSGFHTLAKDESFRFISDRANISSYESRCKQATIYKSYKSEIDLSKNLHYLDAYLEQNFDHQLSTTKQSAHSVGRVSGAQRKALAKQHDPTPETPRPPRHKRSQSQAANYGANYENLGTLPIASKSKVRNTALNSDSMSSSDYASVFSGPTTNRQEPEEDPKDFKLRYEHPDKMCEYYFDNLTSYALALEESEDLLLAESAKSARFFYDDDEEDDDGDEAGLAVDGLSAEDEAAGGRPDYMARDIRIRVKVNECEDADWHQPASATSYNENLAESTFYQSLNQHLQRQEVGDEVGLEDQNLLVGERGVGENYLEHFQRHRGRNYDRTTNSAHYRRAEFYGFGRSAGEGGEQPDVDRQRRADLMEAHYARSYQSGSRAKGRTRAHALEMERQHAAIPTAAATAMPAATGSVINLALPGQSSDVLYATSSKQQITMPMPTAGPQFHQPKPEPAALAAVGAVAATAMAAGTATAVTPAGGATTLVAVSSAGNANNRYMLENLRKYYANQHQHPPAHSVNSSSLSNSSSSNSSMSQQQQQQHLKLNLNLQPTAPKVQQQHLGNRRNSSTSNASSTADNFDTFIALRNATANTSTDYMAKQQQHRRGTQQQQQQQQSVPLTSALNYYGHGATPTLNPALAYNGKLTATAMLSQVNLSRATVQPTAAATSSVAAATTVPLLLPHQQHSRSTSKGEGFILEYEC",
                "length": 1876,
                "header": "tr|Q9VHR2-1|Q9VHR2_DROME Isoform 1 of Uncharacterized protein, isoform E  OS=Drosophila melanogaster OX=7227 GN=CG42286 PE=1 SV=4 CANONICAL=Q9VHR2-1"
            },
            "locus": {
                "chromosome": "3R",
                "start_pos": 8443531,
                "end_pos": 8385047,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0345460",
                        "url": "https://www.ensembl.org/id/FBtr0345460"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0311578",
                        "url": "https://www.ensembl.org/id/FBpp0311578"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "The genome sequence of Drosophila melanogaster.",
            "journal": "Science",
            "date": "2000",
            "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K609",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K609"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHR2",
                    "url": "https://www.uniprot.org/uniprot/Q9VHR2"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUR3",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUR3"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K642",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K642"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHQ8",
                    "url": "https://www.uniprot.org/uniprot/Q9VHQ8"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUS1",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUS1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10731132",
                    "url": "https://glygen.org/publication/PubMed/10731132"
                }
            ]
        },
        {
            "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K609",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K609"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHR2",
                    "url": "https://www.uniprot.org/uniprot/Q9VHR2"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUR3",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUR3"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K642",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K642"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHQ8",
                    "url": "https://www.uniprot.org/uniprot/Q9VHQ8"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUS1",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUS1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537568",
                    "url": "https://glygen.org/publication/PubMed/12537568"
                }
            ]
        },
        {
            "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K609",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K609"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHR2",
                    "url": "https://www.uniprot.org/uniprot/Q9VHR2"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUR3",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUR3"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K642",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K642"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHQ8",
                    "url": "https://www.uniprot.org/uniprot/Q9VHQ8"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUS1",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUS1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537572",
                    "url": "https://glygen.org/publication/PubMed/12537572"
                }
            ]
        },
        {
            "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K609",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K609"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHR2",
                    "url": "https://www.uniprot.org/uniprot/Q9VHR2"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUR3",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUR3"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K642",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K642"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHQ8",
                    "url": "https://www.uniprot.org/uniprot/Q9VHQ8"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUS1",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUS1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537573",
                    "url": "https://glygen.org/publication/PubMed/12537573"
                }
            ]
        },
        {
            "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K609",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K609"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHR2",
                    "url": "https://www.uniprot.org/uniprot/Q9VHR2"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUR3",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUR3"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K642",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K642"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHQ8",
                    "url": "https://www.uniprot.org/uniprot/Q9VHQ8"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUS1",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUS1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537574",
                    "url": "https://glygen.org/publication/PubMed/12537574"
                }
            ]
        },
        {
            "title": "Combined evidence annotation of transposable elements in genome sequences.",
            "journal": "PLoS Comput. Biol.",
            "date": "2005",
            "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K609",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K609"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHR2",
                    "url": "https://www.uniprot.org/uniprot/Q9VHR2"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUR3",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUR3"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K642",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K642"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHQ8",
                    "url": "https://www.uniprot.org/uniprot/Q9VHQ8"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUS1",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUS1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16110336",
                    "url": "https://glygen.org/publication/PubMed/16110336"
                }
            ]
        },
        {
            "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.",
            "journal": "Science",
            "date": "2007",
            "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K609",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K609"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHR2",
                    "url": "https://www.uniprot.org/uniprot/Q9VHR2"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUR3",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUR3"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K642",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K642"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHQ8",
                    "url": "https://www.uniprot.org/uniprot/Q9VHQ8"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUS1",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUS1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17569856",
                    "url": "https://glygen.org/publication/PubMed/17569856"
                }
            ]
        },
        {
            "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.",
            "journal": "Science",
            "date": "2007",
            "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K609",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K609"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHR2",
                    "url": "https://www.uniprot.org/uniprot/Q9VHR2"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUR3",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUR3"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4K642",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4K642"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9VHQ8",
                    "url": "https://www.uniprot.org/uniprot/Q9VHQ8"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A126GUS1",
                    "url": "https://www.uniprot.org/uniprot/A0A126GUS1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17569867",
                    "url": "https://glygen.org/publication/PubMed/17569867"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "dme:Dmel_CG45263",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG45263",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-DME-373753",
            "name": "Nephrin family interactions",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DME-373753",
            "resource": "Reactome",
            "description": "Nephrin family interactions"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "cell-cell junction",
                        "id": "GO:0005911",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005911",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VHR2",
                                "url": "https://www.uniprot.org/uniprot/Q9VHR2"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VHR2",
                                "url": "https://www.uniprot.org/uniprot/Q9VHR2"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "cell adhesion molecule binding",
                        "id": "GO:0050839",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050839",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VHR2",
                                "url": "https://www.uniprot.org/uniprot/Q9VHR2"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 1,
                "go_terms": [
                    {
                        "name": "cell-cell adhesion",
                        "id": "GO:0098609",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098609",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9VHR2",
                                "url": "https://www.uniprot.org/uniprot/Q9VHR2"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 1023,
            "end_pos": 1025,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1050,
            "end_pos": 1052,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1061,
            "end_pos": 1063,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1103,
            "end_pos": 1105,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1132,
            "end_pos": 1134,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1200,
            "end_pos": 1202,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1360,
            "end_pos": 1362,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1695,
            "end_pos": 1697,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1701,
            "end_pos": 1703,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1706,
            "end_pos": 1708,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1741,
            "end_pos": 1743,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1746,
            "end_pos": 1748,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1762,
            "end_pos": 1764,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1766,
            "end_pos": 1768,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 1829,
            "end_pos": 1831,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 189,
            "end_pos": 191,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 230,
            "end_pos": 232,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 430,
            "end_pos": 432,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 5,
            "end_pos": 7,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 789,
            "end_pos": 791,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 790,
            "end_pos": 792,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 841,
            "end_pos": 843,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 8
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}