{ "uniprot_canonical_ac": "Q9VGR2-1", "uniprot_ac": "Q9VGR2", "uniprot_id": "NDUF7_DROME", "mass": { "chemical_mass": 49068.0, "monoisotopic_mass": 49068.0 }, "refseq": { "ac": "NP_650054", "name": "uncharacterized protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_650054" }, "gene_names": [ { "name": "CG17726", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_650054", "id": "NP_650054" }, { "name": "CG17726", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9VGR2", "id": "Q9VGR2" }, { "name": "Dmel\\CG17726", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_650054", "id": "NP_650054" } ], "protein_names": [ { "name": "Protein arginine methyltransferase NDUFAF7 homolog, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9VGR2" }, { "name": "2.1.1.320", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VGR2" }, { "name": "CG17726-PA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_650054", "id": "NP_650054" }, { "name": "NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VGR2" }, { "name": "Protein midA homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9VGR2" }, { "name": "uncharacterized protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_650054", "id": "NP_650054" } ], "function": [ { "annotation": "Arginine methyltransferase involved in the assembly or stability of mitochondrial NADH:ubiquinone oxidoreductase complex (complex I).", "evidence": [ { "database": "UniProtKB", "id": "Q9VGR2", "url": "https://www.uniprot.org/uniprot/Q9VGR2#function" }, { "database": "UniProtKB", "id": "Q7L592", "url": "https://www.uniprot.org/uniprot/Q7L592#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VGR2", "url": "https://www.uniprot.org/uniprot/Q9VGR2" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/Q9VGR2", "locus": {} } ], "crossref": [ { "id": "FBgn0037880", "url": "https://bgee.org/?page=gene&gene_id=FBgn0037880", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0037880", "url": "https://flybase.org/reports/FBgn0037880", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "41349", "url": "https://www.ncbi.nlm.nih.gov/gene/41349", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9VGR2", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9VGR2*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003788", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003788", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029063", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029063", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038375", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038375", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG17726", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG17726", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YYHPQRN", "url": "https://omabrowser.org/oma/group/YYHPQRN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "166586at2759", "url": "http://www.orthodb.org/?query=166586at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12049", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12049", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12049:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12049:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02636", "url": "http://pfam.xfam.org/family/PF02636", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9VGR2", "url": "http://purl.obolibrary.org/obo/PR_Q9VGR2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DME-6799198", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6799198", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_650054", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_650054", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "48108", "url": "https://www.rhea-db.org/rhea/48108", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q9VGR2", "url": "https://www.uniprot.org/uniprot/Q9VGR2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VGR2-1", "url": "https://www.uniprot.org/uniprot/Q9VGR2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLREALRIGNRRWYSYKSVRRPNLGATGTPKMEPPKEQPEASSKAESGHGSLAKQLRAKILSTGPIPVAEYMREVLTNPQAGYYMNRDVFGREGDFITSPEISQIFGELVGIWLVSEWRKMGSPSPFQLVELGPGRGTLARDVLKVLTKFKQDAEFSMHMVEVSPFLSKAQAQRFCYSHQTLPEDAQLPHYQEGTTASGTKAFWHRRLEDVPQGFSLVLAHEFFDALPVHKLQLVDGKWQEVLIDVASSDGAQEASFRYVLSRSQTPVSSLYRPLPGETRSCLEHSLETERQVGLLAERIERDGGIALIMDYGHFGEKTDTFRAFKQHKLHDPLVEPGSADLTADVDFKLVRHIAETRGNVHCCGPVEQGLFLQRMQGEARLEQLLAHALPENQEIIRSGYEMLTDPAQMGTRFKFLAMFPGVLAAHLDKYPVVGFS", "length": 437, "header": "sp|Q9VGR2-1|NDUF7_DROME Isoform 1 of Protein arginine methyltransferase NDUFAF7 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN= PE=2 SV=1 CANONICAL=Q9VGR2-1" }, "isoforms": [ { "isoform_ac": "Q9VGR2-1", "url": "", "sequence": { "sequence": "MLREALRIGNRRWYSYKSVRRPNLGATGTPKMEPPKEQPEASSKAESGHGSLAKQLRAKILSTGPIPVAEYMREVLTNPQAGYYMNRDVFGREGDFITSPEISQIFGELVGIWLVSEWRKMGSPSPFQLVELGPGRGTLARDVLKVLTKFKQDAEFSMHMVEVSPFLSKAQAQRFCYSHQTLPEDAQLPHYQEGTTASGTKAFWHRRLEDVPQGFSLVLAHEFFDALPVHKLQLVDGKWQEVLIDVASSDGAQEASFRYVLSRSQTPVSSLYRPLPGETRSCLEHSLETERQVGLLAERIERDGGIALIMDYGHFGEKTDTFRAFKQHKLHDPLVEPGSADLTADVDFKLVRHIAETRGNVHCCGPVEQGLFLQRMQGEARLEQLLAHALPENQEIIRSGYEMLTDPAQMGTRFKFLAMFPGVLAAHLDKYPVVGFS", "length": 437, "header": "sp|Q9VGR2-1|NDUF7_DROME Isoform 1 of Protein arginine methyltransferase NDUFAF7 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN= PE=2 SV=1 CANONICAL=Q9VGR2-1" }, "locus": { "chromosome": "3R", "start_pos": 11228167, "end_pos": 11226800, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0082352", "url": "https://www.ensembl.org/id/FBtr0082352" }, { "database": "Ensembl Peptide", "id": "FBpp0081828", "url": "https://www.ensembl.org/id/FBpp0081828" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9VGR2", "url": "https://www.uniprot.org/uniprot/Q9VGR2" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "A Drosophila full-length cDNA resource.", "journal": "Genome Biol.", "date": "2002", "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VGR2", "url": "https://www.uniprot.org/uniprot/Q9VGR2" } ], "reference": [ { "type": "PubMed", "id": "12537569", "url": "https://glygen.org/publication/PubMed/12537569" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VGR2", "url": "https://www.uniprot.org/uniprot/Q9VGR2" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] } ], "pathway": [ { "id": "dme:Dmel_CG17726", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG17726", "resource": "KEGG Pathway" }, { "id": "R-DME-6799198", "name": "Complex I biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6799198", "resource": "Reactome", "description": "Complex I biogenesis" } ], "orthologs": [ { "uniprot_canonical_ac": "Q7L592-1", "protein_name": "Protein arginine methyltransferase NDUFAF7, mitochondrial", "gene_name": "NDUFAF7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSVLLRSGLGPLCAVARAAIPFIWRGKYFSSGNEPAENPVTPMLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGEKGDFITSPEISQIFGELLGIWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEVSQKLSEIQALTLTKEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLPVHKFQKTPQGWREVFVDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHVEVCPDAGVIIEELSQRIALTGGAALVADYGHDGTKTDTFRGFCDHKLHDVLIAPGTADLTADVDFSYLRRMAQGKVASLGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLMNPKKMGERFNFFALLPHQRLQGGRYQRNARQSKPFASVVAGFSELAWQ", "length": 441 }, "evidence": [ { "id": "Q9VGR2", "url": "https://omabrowser.org/oma/group/Q9VGR2/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9CWG8-1", "protein_name": "Protein arginine methyltransferase NDUFAF7, mitochondrial", "gene_name": "Ndufaf7", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNALVRRCVARAGLPCIWRGKCYSSGNEPAESNQVTPMLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVHQDMLGEKGDFITSPEISQIFGELLGVWFVSEWIASGKSPAFQLVELGPGRGTLTADILRVFSQLGSVLKTCAISIHLVEVSQKLSEIQALTLAEEKVPLERDAESLVYMKGVTKSGIPVSWYRDLKDVPEGYSLYLAHEFFDVLPVHKFQKTPRGWREVFVDVDPQASDKLRFVLAPCATPAEAFIQRDERREHVEVCPDAGVIIQELSQRIASTGGAALIADYGHDGTKTDTLRGFYGHQLHDVLIAPGTADLTADVDFSYLRRMAQGKVASLGPVEQRTFLKNMGIDVRLKVLLDKAGEPSAKQQLLGGYDMLMNPQKMGERFHFFALLPHQRLHGGSQERNACQSKTPSSSVAGFDELVWQ", "length": 436 }, "evidence": [ { "id": "Q9VGR2", "url": "https://omabrowser.org/oma/group/Q9VGR2/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q9VGR2", "url": "https://www.uniprot.org/uniprot/Q9VGR2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "mitochondrial respiratory chain complex I assembly", "id": "GO:0032981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032981", "evidence": [ { "database": "UniProtKB", "id": "Q9VGR2", "url": "https://www.uniprot.org/uniprot/Q9VGR2" } ], "pmid": "" }, { "name": "methylation", "id": "GO:0032259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032259", "evidence": [ { "database": "UniProtKB", "id": "Q9VGR2", "url": "https://www.uniprot.org/uniprot/Q9VGR2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "protein-arginine omega-N symmetric methyltransferase activity", "id": "GO:0035243", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035243", "evidence": [ { "database": "UniProtKB", "id": "Q9VGR2", "url": "https://www.uniprot.org/uniprot/Q9VGR2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "48108", "name": "", "equation": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5XI79-1", "D4A0E8-1", "A0A8I6AKW7-1", "O14744-1", "Q6P2P2-1", "Q7L592-1", "Q8CIG8-1", "Q3U3W5-1", "Q9CWG8-1", "P38274-1", "P36052-1", "Q54XU0-1", "Q54KI3-1", "Q54S83-1", "Q9VGR2-1" ], "evidence": [ { "id": "48108", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/48108" } ] }, { "id": "R-DME-6799178", "name": "Intermediate 1 binds HP subcomplex to form Intermediate 2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial inner membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9VF27-1", "Q9VZU4-1", "Q9VGR2-1" ], "evidence": [ { "id": "R-DME-6799178", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6799178" } ] }, { "id": "R-DME-6799191", "name": "Intermediate 2 binds MT-ND1:NDUFAF5:NDUFAF6 to form a 315kDa subcomplex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial inner membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9VF27-1", "Q9VZU4-1", "Q9VGR2-1", "Q7K1S1-1", "P18929-1" ], "evidence": [ { "id": "R-DME-6799191", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6799191" } ] }, { "id": "R-DME-6799196", "name": "The MCIA complex, NDUFAF2-7 all dissociate from the 980kDa complex, resulting in Complex I", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial inner membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P18930-1", "P18931-1", "P18932-1", "Q94511-1", "Q9VF27-1", "Q9VZU4-1", "Q9VGR2-1", "Q7K1S1-1", "Q9VMI3-1", "P03896-1", "P18929-1", "P18933-1" ], "evidence": [ { "id": "R-DME-6799196", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6799196" } ] }, { "id": "R-DME-6799197", "name": "ND4, ND5 bind the 550kDa complex to form the 815kDa complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial inner membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P18930-1", "P18931-1", "P18932-1", "Q9VF27-1", "Q9VZU4-1", "Q9VGR2-1", "Q7K1S1-1", "P03896-1", "P18929-1", "P18933-1" ], "evidence": [ { "id": "R-DME-6799197", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6799197" } ] }, { "id": "R-DME-6799202", "name": "The 315kDa subcomplex binds the 370kDa subcomplex to form the 550kDa complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial inner membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P18930-1", "Q9VF27-1", "Q9VZU4-1", "Q9VGR2-1", "Q7K1S1-1", "P03896-1", "P18929-1", "P18933-1" ], "evidence": [ { "id": "R-DME-6799202", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6799202" } ] }, { "id": "R-DME-6799203", "name": "IP subcomplex binds NDUFAF3, NDUFAF4, TIMMDC1 to form Intermediate 1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial inner membrane, mitochondrial matrix", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9VF27-1", "Q9VZU4-1", "Q9VGR2-1" ], "evidence": [ { "id": "R-DME-6799203", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6799203" } ] }, { "id": "R-DME-6800868", "name": "NDUF subunits bind to form the IP subcomplex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial matrix", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9VF27-1", "Q9VZU4-1", "Q9VGR2-1" ], "evidence": [ { "id": "R-DME-6800868", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6800868" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A8I6AKW7", "gene_name": "AABR07025743.1", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "A0A8I6AKW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AKW7" } ] }, { "ec_number": "2.1.1.320", "activity": "", "evidence": [ { "id": "A0A8I6AKW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AKW7" } ] } ] }, { "uniprot_ac": "D4A0E8", "gene_name": "Prmt5", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "D4A0E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A0E8" } ] }, { "ec_number": "2.1.1.320", "activity": "", "evidence": [ { "id": "D4A0E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A0E8" } ] } ] }, { "uniprot_ac": "O14744", "gene_name": "PRMT5", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "O14744", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14744" } ] }, { "ec_number": "2.1.1.320", "activity": "", "evidence": [ { "id": "O14744", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14744" } ] } ] }, { "uniprot_ac": "P03896", "gene_name": "mt:ND2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03896", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03896" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03896", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03896" } ] } ] }, { "uniprot_ac": "P18929", "gene_name": "mt:ND1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18929", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18929" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18929", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18929" } ] } ] }, { "uniprot_ac": "P18930", "gene_name": "mt:ND3", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18930", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18930" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18930", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18930" } ] } ] }, { "uniprot_ac": "P18931", "gene_name": "mt:ND4", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18931", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18931" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18931", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18931" } ] } ] }, { "uniprot_ac": "P18932", "gene_name": "mt:ND5", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18932", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18932" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18932", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18932" } ] } ] }, { "uniprot_ac": "P18933", "gene_name": "mt:ND6", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18933", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18933" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18933", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18933" } ] } ] }, { "uniprot_ac": "P36052", "gene_name": "", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P36052", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36052" } ] }, { "ec_number": "2.1.1.320", "activity": "", "evidence": [ { "id": "P36052", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36052" } ] } ] }, { "uniprot_ac": "P38274", "gene_name": "HSL7", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P38274", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38274" } ] }, { "ec_number": "2.1.1.320", "activity": "", "evidence": [ { "id": "P38274", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38274" } ] } ] }, { "uniprot_ac": "Q3U3W5", "gene_name": "Prmt9", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q3U3W5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U3W5" } ] } ] }, { "uniprot_ac": "Q54KI3", "gene_name": "prmt5", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q54KI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54KI3" } ] }, { "ec_number": "2.1.1.320", "activity": "", "evidence": [ { "id": "Q54KI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54KI3" } ] } ] }, { "uniprot_ac": "Q54S83", "gene_name": "midA", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q54S83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54S83" } ] }, { "ec_number": "2.1.1.320", "activity": "", "evidence": [ { "id": "Q54S83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54S83" } ] } ] }, { "uniprot_ac": "Q54XU0", "gene_name": "", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q54XU0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XU0" } ] }, { "ec_number": "2.1.1.320", "activity": "", "evidence": [ { "id": "Q54XU0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XU0" } ] } ] }, { "uniprot_ac": "Q5XI79", "gene_name": "Ndufaf7", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q5XI79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI79" } ] }, { "ec_number": "2.1.1.320", "activity": "", "evidence": [ { "id": "Q5XI79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI79" } ] } ] }, { "uniprot_ac": "Q6P2P2", "gene_name": "PRMT9", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q6P2P2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P2P2" } ] } ] }, { "uniprot_ac": "Q7K1S1", "gene_name": "Dmel\\CG8067", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q7K1S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K1S1" } ] } ] }, { "uniprot_ac": "Q7L592", "gene_name": "NDUFAF7", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q7L592", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7L592" } ] }, { "ec_number": "2.1.1.320", "activity": "", "evidence": [ { "id": "Q7L592", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7L592" } ] } ] }, { "uniprot_ac": "Q8CIG8", "gene_name": "Prmt5", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q8CIG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIG8" } ] }, { "ec_number": "2.1.1.320", "activity": "", "evidence": [ { "id": "Q8CIG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIG8" } ] } ] }, { "uniprot_ac": "Q94511", "gene_name": "ND-75", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q94511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94511" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q94511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94511" } ] } ] }, { "uniprot_ac": "Q9CWG8", "gene_name": "Ndufaf7", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9CWG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CWG8" } ] }, { "ec_number": "2.1.1.320", "activity": "", "evidence": [ { "id": "Q9CWG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CWG8" } ] } ] }, { "uniprot_ac": "Q9VF27", "gene_name": "ND-23", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q9VF27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VF27" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q9VF27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VF27" } ] } ] }, { "uniprot_ac": "Q9VGR2", "gene_name": "", "activity": [ { "ec_number": "2.1.1.320", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9VGR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGR2" } ] }, { "ec_number": "2.1.1.320", "activity": "", "evidence": [ { "id": "Q9VGR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGR2" } ] } ] }, { "uniprot_ac": "Q9VMI3", "gene_name": "ND-51", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q9VMI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMI3" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q9VMI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMI3" } ] } ] }, { "uniprot_ac": "Q9VZU4", "gene_name": "ND-30", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q9VZU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VZU4" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q9VZU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VZU4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }