{
    "uniprot_canonical_ac": "Q9V6Y3-1",
    "uniprot_ac": "Q9V6Y3",
    "uniprot_id": "RT16_DROME",
    "mass": {
        "chemical_mass": 14519.0,
        "monoisotopic_mass": 14519.0
    },
    "refseq": {
        "ac": "NP_523737",
        "name": "mitochondrial ribosomal protein S16",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_523737"
    },
    "gene_names": [
        {
            "name": "mRpS16",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9V6Y3",
            "id": "Q9V6Y3"
        },
        {
            "name": "147189_at; BcDNA:SD15809; CG8338; Dmel\\CG8338; MRP-S16",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_523737",
            "id": "NP_523737"
        },
        {
            "name": "CG8338",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9V6Y3",
            "id": "Q9V6Y3"
        },
        {
            "name": "mRpS16",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_523737",
            "id": "NP_523737"
        }
    ],
    "protein_names": [
        {
            "name": "Small ribosomal subunit protein bS16m",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q9V6Y3"
        },
        {
            "name": "28S ribosomal protein S16, mitochondrial",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9V6Y3"
        },
        {
            "name": "CG8338-PA; mRpS16-PA",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_523737",
            "id": "NP_523737"
        },
        {
            "name": "MRP-S16",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9V6Y3"
        },
        {
            "name": "S16mt",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9V6Y3"
        },
        {
            "name": "mitochondrial ribosomal protein S16",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_523737",
            "id": "NP_523737"
        }
    ],
    "function": [],
    "disease": [
        {
            "disease_id": "DOID:0111483",
            "recommended_name": {
                "id": "DOID:0111483",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0111483",
                "name": "combined oxidative phosphorylation deficiency 2",
                "description": "A combined oxidative phosphorylation deficiency that has_material_basis_in homozygous or compound heterozygous mutation in the MRPS16 gene on chromosome 10q22.2."
            },
            "synonyms": [
                {
                    "id": "DOID:0111483",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0111483",
                    "name": "COXPD2",
                    "description": ""
                },
                {
                    "id": "DOID:0111483",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0111483",
                    "name": "agenesis of corpus callosum with dysmorphism and fatal lactic acidosis",
                    "description": ""
                },
                {
                    "id": "MONDO:0012510",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012510",
                    "name": "combined oxidative phosphorylation defect type 2",
                    "description": "Combined oxidative phosphorylation defect type 2 is a rare mitochondrial disorder due to a defect in mitochondrial protein synthesis characterized by severe intrauterine growth retardation, neonatal limb edema and redundant skin on the neck (hydrops), developmental brain defects (corpus callosum agenesis, ventriculomegaly), brachydactyly, dysmorphic facial features with low set ears, severe intractable neonatal lactic acidosis with lethargy, hypotonia, absent spontaneous movements and fatal outcome. Markedly decreased activity of complex I, II + III and IV in muscle and liver have been determined."
                },
                {
                    "id": "MONDO:0012510",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012510",
                    "name": "COXPD2",
                    "description": ""
                },
                {
                    "id": "MONDO:0012510",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012510",
                    "name": "MRPS16 combined oxidative phosphorylation deficiency",
                    "description": ""
                },
                {
                    "id": "MONDO:0012510",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012510",
                    "name": "combined oxidative phosphorylation deficiency caused by mutation in MRPS16",
                    "description": ""
                },
                {
                    "id": "MONDO:0012510",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012510",
                    "name": "combined oxidative phosphorylation deficiency type 2",
                    "description": ""
                },
                {
                    "id": "MONDO:0012510",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012510",
                    "name": "combined oxidative phosphorylation deficiency 2",
                    "description": ""
                },
                {
                    "id": "MONDO:0012510",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0012510",
                    "name": "corpus callosum, agenesis of, with Dysmorphism and fatal lactic acidosis",
                    "description": ""
                },
                {
                    "id": "MIM:610498",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/610498",
                    "name": "Combined oxidative phosphorylation deficiency 2",
                    "description": "Combined oxidative phosphorylation deficiency 2"
                }
            ],
            "evidence": [
                {
                    "id": "0111483",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0111483"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Drosophila melanogaster",
            "taxid": 7227,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9V6Y3",
                    "url": "https://www.uniprot.org/uniprot/Q9V6Y3"
                }
            ],
            "common_name": "Fruit fly"
        }
    ],
    "gene": [
        {
            "name": "mRpS16",
            "url": "https://www.uniprot.org/uniprot/Q9V6Y3",
            "locus": {
                "chromosome": "2R",
                "start_pos": 14172986,
                "end_pos": 14173596,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "FBgn0033907",
                        "url": "https://www.ensembl.org/id/FBgn0033907"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "FBgn0033907",
            "url": "https://bgee.org/?page=gene&gene_id=FBgn0033907",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "FBgn0033907",
            "url": "https://flybase.org/reports/FBgn0033907",
            "database": "FlyBase",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "36570",
            "url": "https://www.ncbi.nlm.nih.gov/gene/36570",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q9V6Y3",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9V6Y3*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR000307",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000307",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR023803",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR023803",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "dme:Dmel_CG8338",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG8338",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "DPLPNDY",
            "url": "https://omabrowser.org/oma/group/DPLPNDY/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "4949030at2759",
            "url": "http://www.orthodb.org/?query=4949030at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12919",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12919",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12919:SF20",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12919:SF20",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00886",
            "url": "http://pfam.xfam.org/family/PF00886",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q9V6Y3",
            "url": "http://purl.obolibrary.org/obo/PR_Q9V6Y3",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-DME-5389840",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5389840",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DME-5419276",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5419276",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_523737",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_523737",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9V6Y3",
            "url": "https://www.uniprot.org/uniprot/Q9V6Y3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9V6Y3-1",
            "url": "https://www.uniprot.org/uniprot/Q9V6Y3-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSLSPASGIGRFYAKSAKIIRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHLSTPAAELLGIAGLLPIHPRTYMTAWRNRRTAAEAEASPEKAESTA",
        "length": 129,
        "header": "sp|Q9V6Y3-1|RT16_DROME Isoform 1 of Small ribosomal subunit protein bS16m  OS=Drosophila melanogaster OX=7227 GN=mRpS16 PE=2 SV=1 CANONICAL=Q9V6Y3-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q9V6Y3-1",
            "url": "",
            "sequence": {
                "sequence": "MSLSPASGIGRFYAKSAKIIRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHLSTPAAELLGIAGLLPIHPRTYMTAWRNRRTAAEAEASPEKAESTA",
                "length": 129,
                "header": "sp|Q9V6Y3-1|RT16_DROME Isoform 1 of Small ribosomal subunit protein bS16m  OS=Drosophila melanogaster OX=7227 GN=mRpS16 PE=2 SV=1 CANONICAL=Q9V6Y3-1"
            },
            "locus": {
                "chromosome": "2R",
                "start_pos": 14173485,
                "end_pos": 14173034,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0087578",
                        "url": "https://www.ensembl.org/id/FBtr0087578"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0086704",
                        "url": "https://www.ensembl.org/id/FBpp0086704"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "The genome sequence of Drosophila melanogaster.",
            "journal": "Science",
            "date": "2000",
            "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9V6Y3",
                    "url": "https://www.uniprot.org/uniprot/Q9V6Y3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10731132",
                    "url": "https://glygen.org/publication/PubMed/10731132"
                }
            ]
        },
        {
            "title": "A Drosophila full-length cDNA resource.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9V6Y3",
                    "url": "https://www.uniprot.org/uniprot/Q9V6Y3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537569",
                    "url": "https://glygen.org/publication/PubMed/12537569"
                }
            ]
        },
        {
            "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9V6Y3",
                    "url": "https://www.uniprot.org/uniprot/Q9V6Y3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537572",
                    "url": "https://glygen.org/publication/PubMed/12537572"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "dme:Dmel_CG8338",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG8338",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-DME-5389840",
            "name": "Mitochondrial translation elongation",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5389840",
            "resource": "Reactome",
            "description": "Mitochondrial translation elongation"
        },
        {
            "id": "R-DME-5419276",
            "name": "Mitochondrial translation termination",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5419276",
            "resource": "Reactome",
            "description": "Mitochondrial translation termination"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q9CPX7-1",
            "protein_name": "Small ribosomal subunit protein bS16m",
            "gene_name": "Mrps16",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MVQLTTIFCKAYHGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLSGFFPLHPMMITNAERLRRRRAREVLLASQKAESEAKETEAS",
                "length": 135
            },
            "evidence": [
                {
                    "id": "Q9V6Y3",
                    "url": "https://omabrowser.org/oma/group/Q9V6Y3/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "Q9Y3D3-1",
            "protein_name": "Small ribosomal subunit protein bS16m",
            "gene_name": "MRPS16",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET",
                "length": 137
            },
            "evidence": [
                {
                    "id": "Q9V6Y3",
                    "url": "https://omabrowser.org/oma/group/Q9V6Y3/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "mitochondrial small ribosomal subunit",
                        "id": "GO:0005763",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005763",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9V6Y3",
                                "url": "https://www.uniprot.org/uniprot/Q9V6Y3"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "structural constituent of ribosome",
                        "id": "GO:0003735",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003735",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9V6Y3",
                                "url": "https://www.uniprot.org/uniprot/Q9V6Y3"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 1,
                "go_terms": [
                    {
                        "name": "mitochondrial translation",
                        "id": "GO:0032543",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032543",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9V6Y3",
                                "url": "https://www.uniprot.org/uniprot/Q9V6Y3"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}