{ "uniprot_canonical_ac": "Q9V5P6-1", "uniprot_ac": "Q9V5P6", "uniprot_id": "NOP10_DROME", "mass": { "chemical_mass": 7634.0, "monoisotopic_mass": 7634.0 }, "refseq": { "ac": "NP_610610", "name": "uncharacterized protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610610" }, "gene_names": [ { "name": "CG7637", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610610", "id": "NP_610610" }, { "name": "CG7637", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9V5P6", "id": "Q9V5P6" }, { "name": "Dmel\\CG7637; NOP10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610610", "id": "NP_610610" } ], "protein_names": [ { "name": "H/ACA ribonucleoprotein complex subunit 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9V5P6" }, { "name": "CG7637-PA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610610", "id": "NP_610610" }, { "name": "Nucleolar protein 10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9V5P6" }, { "name": "Nucleolar protein family A member 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9V5P6" }, { "name": "snoRNP protein dNop10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9V5P6" }, { "name": "uncharacterized protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610610", "id": "NP_610610" } ], "function": [ { "annotation": "Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine ('psi') residues may serve to stabilize the conformation of rRNAs (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9V5P6", "url": "https://www.uniprot.org/uniprot/Q9V5P6#function" } ] } ], "disease": [ { "disease_id": "DOID:0070015", "recommended_name": { "id": "DOID:0070015", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070015", "name": "autosomal recessive dyskeratosis congenita 1", "description": "A dyskeratosis congenita that has_material_basis_in an autosomal recessive mutation of the NOLA3 gene on chromosome 15q14." }, "synonyms": [ { "id": "DOID:0070015", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070015", "name": "DKCB1", "description": "" }, { "id": "MONDO:0009136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009136", "name": "dyskeratosis congenita, autosomal recessive 1", "description": "A dyskeratosis congenita that has material basis in an autosomal recessive mutation of NOLA3 on chromosome 15q14." }, { "id": "MONDO:0009136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009136", "name": "DKCB1", "description": "" }, { "id": "MONDO:0009136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009136", "name": "dyskeratosis congenita, autosomal recessive 1", "description": "" }, { "id": "MONDO:0009136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009136", "name": "dyskeratosis congenita, autosomal recessive type 1", "description": "" }, { "id": "MONDO:0009136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009136", "name": "DKCB", "description": "" }, { "id": "MONDO:0009136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009136", "name": "autosomal recessive dyskeratosis congenita", "description": "" }, { "id": "MONDO:0009136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009136", "name": "autosomal recessive dyskeratosis congenita 1", "description": "" }, { "id": "MONDO:0009136", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009136", "name": "dyskeratosis congenita autosomal recessive", "description": "" }, { "id": "MIM:224230", "resource": "MIM", "url": "https://www.omim.org/entry/224230", "name": "Dyskeratosis congenita, autosomal recessive, 1", "description": "Dyskeratosis congenita, autosomal recessive, 1" } ], "evidence": [ { "id": "0070015", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0070015" } ] }, { "disease_id": "DOID:2729", "recommended_name": { "id": "DOID:2729", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2729", "name": "dyskeratosis congenita", "description": "A skin disease characterized by cutaneous pigmentation, premature graying, dystrophy of the nails, leukoplakia of the oral mucosa, continuous lacrimation due to atresia of the lacrimal ducts, often thrombocytopenia, anemia, testicular atrophy in the male carriers and predisposition to cancer." }, "synonyms": [ { "id": "DOID:2729", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2729", "name": "DKCD", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "dyskeratosis congenita, autosomal dominant 1", "description": "A dyskeratosis congenita that has material basis in an autosomal dominant mutation of TERC on chromosome 3q26.2." }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "DKCA1", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "dyskeratosis congenita, Scoggins type", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "dyskeratosis congenita, autosomal dominant 1", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "dyskeratosis congenita, autosomal dominant type 1", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "DKCA", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "autosomal dominant dyskeratosis congenita", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "autosomal dominant dyskeratosis congenita 1", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "dyskeratosis congenita Scoggins type", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "dyskeratosis congenita autosomal dominant", "description": "" } ], "evidence": [ { "id": "2729", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2729" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V5P6", "url": "https://www.uniprot.org/uniprot/Q9V5P6" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/Q9V5P6", "locus": {} } ], "crossref": [ { "id": "FBgn0033548", "url": "https://bgee.org/?page=gene&gene_id=FBgn0033548", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0033548", "url": "https://flybase.org/reports/FBgn0033548", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "36135", "url": "https://www.ncbi.nlm.nih.gov/gene/36135", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9V5P6", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9V5P6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR007264", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007264", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036756", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036756", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG7637", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG7637", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HRIIIKK", "url": "https://omabrowser.org/oma/group/HRIIIKK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5470754at2759", "url": "http://www.orthodb.org/?query=5470754at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13305", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13305", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13305:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13305:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04135", "url": "http://pfam.xfam.org/family/PF04135", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9V5P6", "url": "http://purl.obolibrary.org/obo/PR_Q9V5P6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_610610", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610610", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9V5P6", "url": "https://www.uniprot.org/uniprot/Q9V5P6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9V5P6-1", "url": "https://www.uniprot.org/uniprot/Q9V5P6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLLLTQKPEPIY", "length": 64, "header": "sp|Q9V5P6-1|NOP10_DROME Isoform 1 of H/ACA ribonucleoprotein complex subunit 3 OS=Drosophila melanogaster OX=7227 GN= PE=2 SV=1 CANONICAL=Q9V5P6-1" }, "isoforms": [ { "isoform_ac": "Q9V5P6-1", "url": "", "sequence": { "sequence": "MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLLLTQKPEPIY", "length": 64, "header": "sp|Q9V5P6-1|NOP10_DROME Isoform 1 of H/ACA ribonucleoprotein complex subunit 3 OS=Drosophila melanogaster OX=7227 GN= PE=2 SV=1 CANONICAL=Q9V5P6-1" }, "locus": { "chromosome": "2R", "start_pos": 10810876, "end_pos": 10810620, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0088252", "url": "https://www.ensembl.org/id/FBtr0088252" }, { "database": "Ensembl Peptide", "id": "FBpp0087347", "url": "https://www.ensembl.org/id/FBpp0087347" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9V5P6", "url": "https://www.uniprot.org/uniprot/Q9V5P6" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Nutrient control of gene expression in Drosophila: microarray analysis of starvation and sugar-dependent response.", "journal": "EMBO J.", "date": "2002", "authors": "Bauer M., Katzenberger J.D., Pankratz M.J., Schuetz C.S., Zinke I.", "evidence": [ { "database": "UniProtKB", "id": "Q9V5P6", "url": "https://www.uniprot.org/uniprot/Q9V5P6" } ], "reference": [ { "type": "PubMed", "id": "12426388", "url": "https://glygen.org/publication/PubMed/12426388" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9V5P6", "url": "https://www.uniprot.org/uniprot/Q9V5P6" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] } ], "pathway": [ { "id": "dme:Dmel_CG7637", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG7637", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6Q547-1", "protein_name": "H/ACA ribonucleoprotein complex subunit NOP10", "gene_name": "NOP10", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ", "length": 58 }, "evidence": [ { "id": "Q9V5P6", "url": "https://omabrowser.org/oma/group/Q9V5P6/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q9CQS2-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 3", "gene_name": "Nop10", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL", "length": 64 }, "evidence": [ { "id": "Q9V5P6", "url": "https://omabrowser.org/oma/group/Q9V5P6/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NPE3-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 3", "gene_name": "NOP10", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL", "length": 64 }, "evidence": [ { "id": "Q9V5P6", "url": "https://omabrowser.org/oma/group/Q9V5P6/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "snoRNA binding", "id": "GO:0030515", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030515", "evidence": [ { "database": "UniProtKB", "id": "Q9V5P6", "url": "https://www.uniprot.org/uniprot/Q9V5P6" } ], "pmid": "" }, { "name": "telomerase RNA binding", "id": "GO:0070034", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070034", "evidence": [ { "database": "UniProtKB", "id": "Q9V5P6", "url": "https://www.uniprot.org/uniprot/Q9V5P6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "rRNA pseudouridine synthesis", "id": "GO:0031118", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031118", "evidence": [ { "database": "UniProtKB", "id": "Q9V5P6", "url": "https://www.uniprot.org/uniprot/Q9V5P6" } ], "pmid": "" }, { "name": "snRNA pseudouridine synthesis", "id": "GO:0031120", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031120", "evidence": [ { "database": "UniProtKB", "id": "Q9V5P6", "url": "https://www.uniprot.org/uniprot/Q9V5P6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "box H/ACA snoRNP complex", "id": "GO:0031429", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031429", "evidence": [ { "database": "UniProtKB", "id": "Q9V5P6", "url": "https://www.uniprot.org/uniprot/Q9V5P6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }