{ "uniprot_canonical_ac": "Q9V4N3-1", "uniprot_ac": "Q9V4N3", "uniprot_id": "CYB5_DROME", "mass": { "chemical_mass": 15206.0, "monoisotopic_mass": 15206.0 }, "refseq": { "ac": "NP_610294", "name": "cytochrome b5, isoform B", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610294" }, "gene_names": [ { "name": "Cyt-b5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9V4N3", "id": "Q9V4N3" }, { "name": "1857; BcDNA:GH02503; BcDNA:RE66521; CG2140; CYT-B5; CYTB5; Dmel\\CG2140; dpld; l(2)01857; l(2)k00107", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610294", "id": "NP_610294" }, { "name": "CG2140", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9V4N3", "id": "Q9V4N3" }, { "name": "Cyt-b5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610294", "id": "NP_610294" } ], "protein_names": [ { "name": "Cytochrome b5", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9V4N3" }, { "name": "CG2140-PB; Cyt-b5-PB; lethal (2) k00107; dappled", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610294", "id": "NP_610294" }, { "name": "CYTB5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9V4N3" }, { "name": "cytochrome b5, isoform B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610294", "id": "NP_610294" } ], "function": [ { "annotation": "Cytochrome b5 is a membrane-bound hemoprotein which functions as an electron carrier for several membrane-bound oxygenases.", "evidence": [ { "database": "UniProtKB", "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3#function" } ] } ], "disease": [ { "disease_id": "DOID:0112316", "recommended_name": { "id": "DOID:0112316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112316", "name": "methemoglobinemia and ambiguous genitalia", "description": "A disorder of sexual development characterized by severely reduced 17,20-lyase activity of CYP17A1, sex steroid deficiency with no deficiency in glucocorticoid and mineralocorticoid reserves, absent or disturbed pubertal development, and mild to severe methemoglobinemia that has_material_basis_in homozygous or compound heterozygous mutation in the CYB5A gene on chromosome 18q22.3." }, "synonyms": [ { "id": "DOID:0112316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112316", "name": "METAG", "description": "" }, { "id": "DOID:0112316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112316", "name": "methemoglobinemia type IV", "description": "" }, { "id": "DOID:0112316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112316", "name": "pure isolated 17,20-lyase deficiency", "description": "" }, { "id": "DOID:0112316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112316", "name": "methemoglobinemia due to deficiency of cytochrome b5", "description": "" }, { "id": "MONDO:0009605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009605", "name": "methemoglobinemia type 4", "description": "Any methemoglobinemia in which the cause of the disease is a mutation in the CYB5A gene." }, { "id": "MONDO:0009605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009605", "name": "CYB5A methemoglobinemia", "description": "" }, { "id": "MONDO:0009605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009605", "name": "methemoglobinemia caused by mutation in CYB5A", "description": "" }, { "id": "MONDO:0009605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009605", "name": "methemoglobinemia type 4", "description": "" }, { "id": "MONDO:0009605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009605", "name": "METAG", "description": "" }, { "id": "MONDO:0009605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009605", "name": "isolated 17,20-lyase deficiency, Pure", "description": "" }, { "id": "MONDO:0009605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009605", "name": "methemoglobinemia and ambiguous genitalia", "description": "" }, { "id": "MONDO:0009605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009605", "name": "methemoglobinemia due to deficiency of cytochrome B5", "description": "" }, { "id": "MONDO:0009605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009605", "name": "methemoglobinemia due to deficiency of cytochrome B5, formerly", "description": "" }, { "id": "MONDO:0009605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009605", "name": "methemoglobinemia type IV", "description": "" }, { "id": "MONDO:0009605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009605", "name": "methemoglobinemia type IV, formerly", "description": "" }, { "id": "MIM:250790", "resource": "MIM", "url": "https://www.omim.org/entry/250790", "name": "Methemoglobinemia and ambiguous genitalia", "description": "Methemoglobinemia and ambiguous genitalia" } ], "evidence": [ { "id": "0112316", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0112316" } ] }, { "disease_id": "DOID:10783", "recommended_name": { "id": "DOID:10783", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10783", "name": "methemoglobinemia", "description": "" }, "synonyms": [], "evidence": [ { "id": "10783", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10783" } ] }, { "disease_id": "DOID:11400", "recommended_name": { "id": "DOID:11400", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11400", "name": "pyelonephritis", "description": "" }, "synonyms": [], "evidence": [ { "id": "11400", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11400" } ] }, { "disease_id": "DOID:9637", "recommended_name": { "id": "DOID:9637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9637", "name": "stomatitis", "description": "A mouth disease that is characterized by inflammation of the mouth and lips." }, "synonyms": [], "evidence": [ { "id": "9637", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9637" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Cyt-b5", "url": "https://www.uniprot.org/uniprot/Q9V4N3", "locus": { "chromosome": "2R", "start_pos": 7535936, "end_pos": 7533506, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0264294", "url": "https://www.ensembl.org/id/FBgn0264294" } ] } } ], "crossref": [ { "id": "FBgn0264294", "url": "https://bgee.org/?page=gene&gene_id=FBgn0264294", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0264294", "url": "https://flybase.org/reports/FBgn0264294", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "35688", "url": "https://www.ncbi.nlm.nih.gov/gene/35688", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9V4N3", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9V4N3*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001199", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001199", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018506", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018506", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036400", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036400", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG2140", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG2140", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WTNFLIP", "url": "https://omabrowser.org/oma/group/WTNFLIP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2712490at2759", "url": "http://www.orthodb.org/?query=2712490at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR19359", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19359", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19359:SF14", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19359:SF14", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00173", "url": "http://pfam.xfam.org/family/PF00173", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9V4N3", "url": "http://purl.obolibrary.org/obo/PR_Q9V4N3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DME-196836", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-196836", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-211945", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9609523", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_610294", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610294", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9V4N3-1", "url": "https://www.uniprot.org/uniprot/Q9V4N3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9V4N3-2", "url": "https://www.uniprot.org/uniprot/Q9V4N3-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSEETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLVATLFYKFFFGGAKQ", "length": 134, "header": "sp|Q9V4N3-1|CYB5_DROME Isoform 1 of Cytochrome b5 OS=Drosophila melanogaster OX=7227 GN=Cyt-b5 PE=2 SV=1 CANONICAL=Q9V4N3-1" }, "isoforms": [ { "isoform_ac": "Q9V4N3-1", "url": "", "sequence": { "sequence": "MSSEETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLVATLFYKFFFGGAKQ", "length": 134, "header": "sp|Q9V4N3-1|CYB5_DROME Isoform 1 of Cytochrome b5 OS=Drosophila melanogaster OX=7227 GN=Cyt-b5 PE=2 SV=1 CANONICAL=Q9V4N3-1" }, "locus": { "chromosome": "2R", "start_pos": 7535613, "end_pos": 7533611, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0088905", "url": "https://www.ensembl.org/id/FBtr0088905" }, { "database": "Ensembl Peptide", "id": "FBpp0087979", "url": "https://www.ensembl.org/id/FBpp0087979" } ] } }, { "isoform_ac": "Q9V4N3-2", "url": "", "sequence": { "sequence": "MVQSKRNFARVLRIKVSVTLLAYKCQIKSHPGGEEVLIEQAGKDATENFEDVGHSNDARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLVATLFYKFFFGGAKQ", "length": 123, "header": "sp|Q9V4N3-2|CYB5_DROME Isoform 2 of Cytochrome b5 OS=Drosophila melanogaster OX=7227 GN=Cyt-b5 PE=2 SV=1 CANONICAL=Q9V4N3-1" }, "locus": { "chromosome": "2R", "start_pos": 7535613, "end_pos": 7535009, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0088906", "url": "https://www.ensembl.org/id/FBtr0088906" }, { "database": "Ensembl Peptide", "id": "FBpp0087980", "url": "https://www.ensembl.org/id/FBpp0087980" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "A Drosophila full-length cDNA resource.", "journal": "Genome Biol.", "date": "2002", "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3" } ], "reference": [ { "type": "PubMed", "id": "12537569", "url": "https://glygen.org/publication/PubMed/12537569" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] } ], "pathway": [ { "id": "dme:Dmel_CG2140", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG2140", "resource": "KEGG Pathway" }, { "id": "R-DME-196836", "name": "Vitamin C (ascorbate) metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-196836", "resource": "Reactome", "description": "Vitamin C (ascorbate) metabolism" }, { "id": "R-DME-211945", "name": "Phase I - Functionalization of compounds", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-211945", "resource": "Reactome", "description": "Phase I - Functionalization of compounds" }, { "id": "R-DME-9609523", "name": "Insertion of tail-anchored proteins into the endoplasmic reticulum membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9609523", "resource": "Reactome", "description": "Insertion of tail-anchored proteins into the endoplasmic reticulum membrane" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "response to oxidative stress", "id": "GO:0006979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006979", "evidence": [ { "database": "UniProtKB", "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3" } ], "pmid": "" }, { "name": "xenobiotic metabolic process", "id": "GO:0006805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805", "evidence": [ { "database": "UniProtKB", "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3" } ], "pmid": "" }, { "name": "endomembrane system", "id": "GO:0012505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012505", "evidence": [ { "database": "UniProtKB", "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3" } ], "pmid": "" }, { "name": "heme binding", "id": "GO:0020037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037", "evidence": [ { "database": "UniProtKB", "id": "Q9V4N3", "url": "https://www.uniprot.org/uniprot/Q9V4N3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }