{
    "uniprot_canonical_ac": "Q9UM73-1",
    "uniprot_ac": "Q9UM73",
    "uniprot_id": "ALK_HUMAN",
    "mass": {
        "chemical_mass": 176442.0,
        "monoisotopic_mass": 176442.0
    },
    "refseq": {
        "ac": "NP_004295",
        "name": "ALK tyrosine kinase receptor isoform 1 precursor",
        "summary": "This gene encodes a receptor tyrosine kinase, which belongs to the insulin receptor superfamily. This protein comprises an extracellular domain, an hydrophobic stretch corresponding to a single pass transmembrane region, and an intracellular kinase domain. It plays an important role in the development of the brain and exerts its effects on specific neurons in the nervous system. This gene has been found to be rearranged, mutated, or amplified in a series of tumours including anaplastic large cell lymphomas, neuroblastoma, and non-small cell lung cancer. The chromosomal rearrangements are the most common genetic alterations in this gene, which result in creation of multiple fusion genes in tumourigenesis, including ALK (chromosome 2)/EML4 (chromosome 2), ALK/RANBP2 (chromosome 2), ALK/ATIC (chromosome 2), ALK/TFG (chromosome 3), ALK/NPM1 (chromosome 5), ALK/SQSTM1 (chromosome 5), ALK/KIF5B (chromosome 10), ALK/CLTC (chromosome 17), ALK/TPM4 (chromosome 19), and ALK/MSN (chromosome X).[provided by RefSeq, Jan 2011].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295"
    },
    "gene_names": [
        {
            "name": "ALK",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9UM73",
            "id": "Q9UM73"
        },
        {
            "name": "ALK1; CD246; NBLST3",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295",
            "id": "NP_004295"
        },
        {
            "name": "ALK",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295",
            "id": "NP_004295"
        }
    ],
    "protein_names": [
        {
            "name": "ALK tyrosine kinase receptor",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q9UM73"
        },
        {
            "name": "2.7.10.1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9UM73"
        },
        {
            "name": "ALK tyrosine kinase receptor isoform 1 precursor",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295",
            "id": "NP_004295"
        },
        {
            "name": "Anaplastic lymphoma kinase",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9UM73"
        },
        {
            "name": "CD246 antigen; ALK tyrosine kinase receptor; mutant anaplastic lymphoma kinase; anaplastic lymphoma receptor tyrosine kinase",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295",
            "id": "NP_004295"
        }
    ],
    "function": [
        {
            "annotation": "ALK rearrangement is an independent predictive factor of unexpected nodal metastasis after surgery in early stage, clinical node negative lung adenocarcinoma.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004295",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295"
                },
                {
                    "database": "PubMed",
                    "id": "37126920",
                    "url": "https://glygen.org/publication/PubMed/37126920"
                }
            ]
        },
        {
            "annotation": "Anaplastic Lymphoma Kinase Inhibitors for Therapy of Neuroblastoma in Adults.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004295",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295"
                },
                {
                    "database": "PubMed",
                    "id": "37561984",
                    "url": "https://glygen.org/publication/PubMed/37561984"
                }
            ]
        },
        {
            "annotation": "Anaplastic lymphoma kinase overexpression enhances aggressive phenotypic characteristics of endometrial carcinoma. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004295",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295"
                },
                {
                    "database": "PubMed",
                    "id": "37592266",
                    "url": "https://glygen.org/publication/PubMed/37592266"
                }
            ]
        },
        {
            "annotation": "Expression of Anaplastic Lymphoma Kinase (ALK) in glioma and possible clinical correlations. A retrospective institutional study.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004295",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295"
                },
                {
                    "database": "PubMed",
                    "id": "37271069",
                    "url": "https://glygen.org/publication/PubMed/37271069"
                }
            ]
        },
        {
            "annotation": "Findings suggest a novel mechanism of oncogene activation in cancer through de novo alternative transcription initiation, such as for ALK",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004295",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295"
                },
                {
                    "database": "PubMed",
                    "id": "26444240",
                    "url": "https://glygen.org/publication/PubMed/26444240"
                }
            ]
        },
        {
            "annotation": "Neuronal receptor tyrosine kinase that is essentially and transiently expressed in specific regions of the central and peripheral nervous systems and plays an important role in the genesis and differentiation of the nervous system (PubMed:11121404, PubMed:11387242, PubMed:16317043, PubMed:17274988, PubMed:30061385, PubMed:34646012, PubMed:34819673). Also acts as a key thinness protein involved in the resistance to weight gain: in hypothalamic neurons, controls energy expenditure acting as a negative regulator of white adipose tissue lipolysis and sympathetic tone to fine-tune energy homeostasis (By similarity). Following activation by ALKAL2 ligand at the cell surface, transduces an extracellular signal into an intracellular response (PubMed:30061385, PubMed:33411331, PubMed:34646012, PubMed:34819673). In contrast, ALKAL1 is not a potent physiological ligand for ALK (PubMed:34646012). Ligand-binding to the extracellular domain induces tyrosine kinase activation, leading to activation of the mitogen-activated protein kinase (MAPK) pathway (PubMed:34819673). Phosphorylates almost exclusively at the first tyrosine of the Y-x-x-x-Y-Y motif (PubMed:15226403, PubMed:16878150). Induces tyrosine phosphorylation of CBL, FRS2, IRS1 and SHC1, as well as of the MAP kinases MAPK1/ERK2 and MAPK3/ERK1 (PubMed:15226403, PubMed:16878150). ALK activation may also be regulated by pleiotrophin (PTN) and midkine (MDK) (PubMed:11278720, PubMed:11809760, PubMed:12107166, PubMed:12122009). PTN-binding induces MAPK pathway activation, which is important for the anti-apoptotic signaling of PTN and regulation of cell proliferation (PubMed:11278720, PubMed:11809760, PubMed:12107166). MDK-binding induces phosphorylation of the ALK target insulin receptor substrate (IRS1), activates mitogen-activated protein kinases (MAPKs) and PI3-kinase, resulting also in cell proliferation induction (PubMed:12122009). Drives NF-kappa-B activation, probably through IRS1 and the activation of the AKT serine/threonine kinase (PubMed:15226403, PubMed:16878150). Recruitment of IRS1 to activated ALK and the activation of NF-kappa-B are essential for the autocrine growth and survival signaling of MDK (PubMed:15226403, PubMed:16878150).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#function"
                },
                {
                    "database": "PubMed",
                    "id": "16878150",
                    "url": "https://glygen.org/publication/PubMed/16878150"
                },
                {
                    "database": "PubMed",
                    "id": "17274988",
                    "url": "https://glygen.org/publication/PubMed/17274988"
                },
                {
                    "database": "PubMed",
                    "id": "15226403",
                    "url": "https://glygen.org/publication/PubMed/15226403"
                },
                {
                    "database": "UniProtKB",
                    "id": "P97793",
                    "url": "https://www.uniprot.org/uniprot/P97793#function"
                },
                {
                    "database": "PubMed",
                    "id": "16317043",
                    "url": "https://glygen.org/publication/PubMed/16317043"
                },
                {
                    "database": "PubMed",
                    "id": "34646012",
                    "url": "https://glygen.org/publication/PubMed/34646012"
                },
                {
                    "database": "PubMed",
                    "id": "11278720",
                    "url": "https://glygen.org/publication/PubMed/11278720"
                },
                {
                    "database": "PubMed",
                    "id": "12122009",
                    "url": "https://glygen.org/publication/PubMed/12122009"
                },
                {
                    "database": "PubMed",
                    "id": "12107166",
                    "url": "https://glygen.org/publication/PubMed/12107166"
                },
                {
                    "database": "PubMed",
                    "id": "11387242",
                    "url": "https://glygen.org/publication/PubMed/11387242"
                },
                {
                    "database": "PubMed",
                    "id": "11809760",
                    "url": "https://glygen.org/publication/PubMed/11809760"
                },
                {
                    "database": "PubMed",
                    "id": "30061385",
                    "url": "https://glygen.org/publication/PubMed/30061385"
                },
                {
                    "database": "PubMed",
                    "id": "33411331",
                    "url": "https://glygen.org/publication/PubMed/33411331"
                },
                {
                    "database": "PubMed",
                    "id": "34819673",
                    "url": "https://glygen.org/publication/PubMed/34819673"
                },
                {
                    "database": "PubMed",
                    "id": "11121404",
                    "url": "https://glygen.org/publication/PubMed/11121404"
                }
            ]
        },
        {
            "annotation": "This gene encodes a receptor tyrosine kinase, which belongs to the insulin receptor superfamily. This protein comprises an extracellular domain, an hydrophobic stretch corresponding to a single pass transmembrane region, and an intracellular kinase domain. It plays an important role in the development of the brain and exerts its effects on specific neurons in the nervous system. This gene has been found to be rearranged, mutated, or amplified in a series of tumours including anaplastic large cell lymphomas, neuroblastoma, and non-small cell lung cancer. The chromosomal rearrangements are the most common genetic alterations in this gene, which result in creation of multiple fusion genes in tumourigenesis, including ALK (chromosome 2)/EML4 (chromosome 2), ALK/RANBP2 (chromosome 2), ALK/ATIC (chromosome 2), ALK/TFG (chromosome 3), ALK/NPM1 (chromosome 5), ALK/SQSTM1 (chromosome 5), ALK/KIF5B (chromosome 10), ALK/CLTC (chromosome 17), ALK/TPM4 (chromosome 19), and ALK/MSN (chromosome X).[provided by RefSeq, Jan 2011].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004295",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "MONDO:0013083",
            "recommended_name": {
                "id": "MONDO:0013083",
                "resource": "MONDO",
                "url": "https://monarchinitiative.org/disease/MONDO:0013083",
                "name": "neuroblastoma, susceptibility to, 3",
                "description": "Any neuroblastoma in which the cause of the disease is a mutation in the ALK gene."
            },
            "synonyms": [
                {
                    "id": "MONDO:0013083",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013083",
                    "name": "ALK neuroblastoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0013083",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013083",
                    "name": "neuroblastoma caused by mutation in ALK",
                    "description": ""
                },
                {
                    "id": "MONDO:0013083",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013083",
                    "name": "neuroblastoma, susceptibility to, 3",
                    "description": ""
                },
                {
                    "id": "MONDO:0013083",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013083",
                    "name": "neuroblastoma, susceptibility to, type 3",
                    "description": ""
                },
                {
                    "id": "MONDO:0013083",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013083",
                    "name": "NBLST3",
                    "description": ""
                },
                {
                    "id": "MONDO:0013083",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013083",
                    "name": "susceptibility to neuroblastoma 3",
                    "description": ""
                },
                {
                    "id": "MIM:613014",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/613014",
                    "name": "Neuroblastoma 3",
                    "description": "Neuroblastoma 3"
                }
            ],
            "evidence": [
                {
                    "id": "613014",
                    "database": "MIM",
                    "url": "https://www.omim.org/entry/613014"
                }
            ]
        }
    ],
    "snv": [
        {
            "evidence": [
                {
                    "id": "rs1160873517",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1160873517"
                },
                {
                    "id": "rs1160873517",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1160873517"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 413,
            "end_pos": 413,
            "sequence_org": "S",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SLS->NLS); n-glyco-sequon-loss (NRS->NRN).",
            "chr_id": "2",
            "chr_pos": "29383776",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S413",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1573160589",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1573160589"
                },
                {
                    "id": "rs1573160589",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1573160589"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "n-glyco-sequon-gain"
            ],
            "start_pos": 709,
            "end_pos": 709,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS); n-glyco-sequon-gain (NSN->NSS).",
            "chr_id": "2",
            "chr_pos": "29251183",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N709",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 865,
            "end_pos": 865,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "S",
            "sequence_mut": "P",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->NPS); n-glyco-sequon-loss (NNS->NNP).",
            "chr_id": "2",
            "chr_pos": "29232343",
            "ref_nt": "A",
            "alt_nt": "G",
            "minor_allelic_frequency": "",
            "site_lbl": "S865",
            "disease": [
                {
                    "disease_id": "DOID:263",
                    "recommended_name": {
                        "id": "DOID:263",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:263",
                        "name": "kidney cancer",
                        "description": "A urinary system cancer that is located_in the kidney."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "malignant neoplasm of kidney except pelvis",
                            "description": ""
                        },
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "malignant tumour of kidney",
                            "description": ""
                        },
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "renal cancer",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs778643763",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778643763"
                },
                {
                    "id": "rs778643763",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778643763"
                },
                {
                    "id": "rs778643763",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs778643763"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 1022,
            "end_pos": 1022,
            "sequence_org": "I",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IVS->NVS).",
            "chr_id": "2",
            "chr_pos": "29226924",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "I1022",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1460007760",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1460007760"
                },
                {
                    "id": "rs1460007760",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1460007760"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "o-glyco-site-loss"
            ],
            "start_pos": 1085,
            "end_pos": 1085,
            "sequence_org": "T",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TST->NST).",
            "chr_id": "2",
            "chr_pos": "29223447",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T1085",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 1142,
            "end_pos": 1142,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "P",
            "sequence_mut": "T",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NDP->NDT).",
            "chr_id": "2",
            "chr_pos": "29222543",
            "ref_nt": "G",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "P1142",
            "disease": [
                {
                    "disease_id": "DOID:4159",
                    "recommended_name": {
                        "id": "DOID:4159",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:4159",
                        "name": "skin cancer",
                        "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "CA - skin cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "malignant neoplasm of skin",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "melanoma and Non-melanoma skin cancer",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1553394197",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1553394197"
                },
                {
                    "id": "rs1553394197",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1553394197"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 1170,
            "end_pos": 1170,
            "sequence_org": "I",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IIS->NIS).",
            "chr_id": "2",
            "chr_pos": "29222350",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "I1170",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [],
            "start_pos": 1202,
            "end_pos": 1202,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "G",
            "sequence_mut": "R",
            "comment": "Somatic mutation passed 1 out of 6 filters: DB annot. (1).",
            "chr_id": "2",
            "chr_pos": "29220747",
            "ref_nt": "C",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "G1202",
            "disease": [
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs201768549",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201768549"
                },
                {
                    "id": "rs201768549",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201768549"
                },
                {
                    "id": "rs201768549",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201768549"
                },
                {
                    "id": "rs201768549",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs201768549#frequency_tab"
                },
                {
                    "id": "rs201768549",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs201768549"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 1396,
            "end_pos": 1396,
            "sequence_org": "A",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTA->NTS).",
            "chr_id": "2",
            "chr_pos": "29193901",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.0002",
            "site_lbl": "A1396",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs201768549",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201768549"
                },
                {
                    "id": "rs201768549",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201768549"
                },
                {
                    "id": "rs201768549",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201768549"
                },
                {
                    "id": "rs201768549",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs201768549#frequency_tab"
                },
                {
                    "id": "rs201768549",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs201768549"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 1396,
            "end_pos": 1396,
            "sequence_org": "A",
            "sequence_mut": "T",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTA->NTT).",
            "chr_id": "2",
            "chr_pos": "29193901",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.0002",
            "site_lbl": "A1396",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [],
            "start_pos": 1436,
            "end_pos": 1436,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "R",
            "sequence_mut": "C",
            "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
            "chr_id": "2",
            "chr_pos": "29193781",
            "ref_nt": "G",
            "alt_nt": "A",
            "minor_allelic_frequency": "",
            "site_lbl": "R1436",
            "disease": [
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:363",
                    "recommended_name": {
                        "id": "DOID:363",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:363",
                        "name": "uterine cancer",
                        "description": "A female reproductive organ cancer that is located_in the uterus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "CA - cancer of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "Tumour of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterus neoplasm",
                            "description": ""
                        }
                    ]
                },
                {
                    "disease_id": "DOID:9256",
                    "recommended_name": {
                        "id": "DOID:9256",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9256",
                        "name": "colorectal cancer",
                        "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, advanced, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer with chromosomal instability, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectum cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectum neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "CRC",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "large intestine cancer",
                            "description": ""
                        },
                        {
                            "id": "MIM:114500",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114500",
                            "name": "Colorectal cancer",
                            "description": "Colorectal cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 1479,
            "end_pos": 1479,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "A",
            "sequence_mut": "T",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NMA->NMT).",
            "chr_id": "2",
            "chr_pos": "29193652",
            "ref_nt": "C",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "A1479",
            "disease": [
                {
                    "disease_id": "DOID:10534",
                    "recommended_name": {
                        "id": "DOID:10534",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:10534",
                        "name": "stomach cancer",
                        "description": "A gastrointestinal system cancer that is located_in the stomach."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:10534",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10534",
                            "name": "gastric cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10534",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10534",
                            "name": "gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the stomach."
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "Ca lesser curvature - stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "cancer of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer risk after h. pylori infection",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant stomach neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of greater curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of greater curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "stomach cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "Ca body - stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "ca greater curvature of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer, intestinal",
                            "description": ""
                        },
                        {
                            "id": "MIM:613659",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/613659",
                            "name": "Gastric cancer",
                            "description": "Gastric cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 1521,
            "end_pos": 1521,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "P",
            "sequence_mut": "S",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NNP->NNS).",
            "chr_id": "2",
            "chr_pos": "29193526",
            "ref_nt": "G",
            "alt_nt": "A",
            "minor_allelic_frequency": "",
            "site_lbl": "P1521",
            "disease": [
                {
                    "disease_id": "DOID:363",
                    "recommended_name": {
                        "id": "DOID:363",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:363",
                        "name": "uterine cancer",
                        "description": "A female reproductive organ cancer that is located_in the uterus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "CA - cancer of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "Tumour of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterus neoplasm",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1668930591",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1668930591"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 1546,
            "end_pos": 1546,
            "sequence_org": "A",
            "sequence_mut": "T",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVA->NVT).",
            "chr_id": "2",
            "chr_pos": "29193451",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "A1546",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs751677905",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751677905"
                },
                {
                    "id": "rs751677905",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751677905"
                },
                {
                    "id": "rs751677905",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs751677905#frequency_tab"
                },
                {
                    "id": "rs751677905",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs751677905"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 1583,
            "end_pos": 1583,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVN->NVS).",
            "chr_id": "2",
            "chr_pos": "29193339",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N1583",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                },
                {
                    "id": "rs1573077410",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1573077410"
                },
                {
                    "id": "rs1573077410",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1573077410"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 1585,
            "end_pos": 1585,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "G",
            "sequence_mut": "S",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NYG->NYS).",
            "chr_id": "2",
            "chr_pos": "29193334",
            "ref_nt": "C",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "G1585",
            "disease": [
                {
                    "disease_id": "DOID:2394",
                    "recommended_name": {
                        "id": "DOID:2394",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:2394",
                        "name": "ovarian cancer",
                        "description": "A female reproductive organ cancer that is located_in the ovary."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:2394",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2394",
                            "name": "malignant Ovarian tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:2394",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2394",
                            "name": "malignant tumour of ovary",
                            "description": ""
                        },
                        {
                            "id": "DOID:2394",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2394",
                            "name": "ovarian neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:2394",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2394",
                            "name": "ovary neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:2394",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2394",
                            "name": "primary ovarian cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:2394",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2394",
                            "name": "tumor of the Ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011931",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011931",
                            "name": "ovarian cancer, susceptibility to, 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011931",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011931",
                            "name": "OVCAS1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011931",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011931",
                            "name": "ovarian cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011931",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011931",
                            "name": "ovarian cancer, susceptibility to, 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the ovary. Most primary malignant ovarian neoplasms are either carcinomas (serous, mucinous, or endometrioid adenocarcinomas) or malignant germ cell tumors. Metastatic malignant neoplasms to the ovary include carcinomas, lymphomas, and melanomas."
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovary neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "tumor of the ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "tumour of the ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "cancer of ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "cancer of the ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant neoplasm of ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant neoplasm of the ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant ovarian neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant ovarian tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant ovarian tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant ovary neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant tumor of ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant tumor of the ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant tumour of ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant tumour of the ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian malignant tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian malignant tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovary cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian cancer, epithelial",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "primary ovarian cancer",
                            "description": ""
                        },
                        {
                            "id": "MIM:167000",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/167000",
                            "name": "Ovarian cancer",
                            "description": "Ovarian cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease",
                "ebi"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs78174819",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs78174819"
                },
                {
                    "id": "rs78174819",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs78174819"
                },
                {
                    "id": "rs78174819",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs78174819"
                },
                {
                    "id": "rs78174819",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs78174819#frequency_tab"
                },
                {
                    "id": "rs78174819",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs78174819"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "o-glyco-site-loss"
            ],
            "start_pos": 1612,
            "end_pos": 1612,
            "sequence_org": "K",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KNS->NNS).",
            "chr_id": "2",
            "chr_pos": "29193251",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.002596",
            "site_lbl": "K1612",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1668918393",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1668918393"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 1615,
            "end_pos": 1615,
            "sequence_org": "M",
            "sequence_mut": "T",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSM->NST).",
            "chr_id": "2",
            "chr_pos": "29193243",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "M1615",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1668918068",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1668918068"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 1618,
            "end_pos": 1618,
            "sequence_org": "P",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQP->NQS).",
            "chr_id": "2",
            "chr_pos": "29193235",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "P1618",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs932619554",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs932619554"
                },
                {
                    "id": "rs932619554",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs932619554"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 169,
            "end_pos": 169,
            "sequence_org": "N",
            "sequence_mut": "D",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).",
            "chr_id": "2",
            "chr_pos": "29920155",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N169",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs932619554",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs932619554"
                },
                {
                    "id": "rs932619554",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs932619554"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 169,
            "end_pos": 169,
            "sequence_org": "N",
            "sequence_mut": "H",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->HLS).",
            "chr_id": "2",
            "chr_pos": "29920155",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N169",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs752129360",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752129360"
                },
                {
                    "id": "rs752129360",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752129360"
                },
                {
                    "id": "rs752129360",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs752129360#frequency_tab"
                },
                {
                    "id": "rs752129360",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs752129360"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 169,
            "end_pos": 169,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).",
            "chr_id": "2",
            "chr_pos": "29920154",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N169",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs753403262",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753403262"
                },
                {
                    "id": "rs753403262",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753403262"
                },
                {
                    "id": "rs753403262",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs753403262"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 171,
            "end_pos": 171,
            "sequence_org": "S",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->NLN).",
            "chr_id": "2",
            "chr_pos": "29920148",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S171",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs534035801",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534035801"
                },
                {
                    "id": "rs534035801",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs534035801"
                },
                {
                    "id": "rs534035801",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534035801"
                },
                {
                    "id": "rs534035801",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs534035801#frequency_tab"
                },
                {
                    "id": "rs534035801",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs534035801"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 171,
            "end_pos": 171,
            "sequence_org": "S",
            "sequence_mut": "R",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->NLR).",
            "chr_id": "2",
            "chr_pos": "29920147",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.0002",
            "site_lbl": "S171",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1060500209",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1060500209"
                },
                {
                    "id": "rs1060500209",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1060500209"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 234,
            "end_pos": 234,
            "sequence_org": "P",
            "sequence_mut": "T",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NMP->NMT).",
            "chr_id": "2",
            "chr_pos": "29717665",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "P234",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs763986679",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763986679"
                },
                {
                    "id": "rs763986679",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763986679"
                },
                {
                    "id": "rs763986679",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs763986679"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 244,
            "end_pos": 244,
            "sequence_org": "N",
            "sequence_mut": "T",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).",
            "chr_id": "2",
            "chr_pos": "29717634",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N244",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs753646573",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753646573"
                },
                {
                    "id": "rs753646573",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753646573"
                },
                {
                    "id": "rs753646573",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs753646573#frequency_tab"
                },
                {
                    "id": "rs753646573",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs753646573"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 244,
            "end_pos": 244,
            "sequence_org": "N",
            "sequence_mut": "Y",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).",
            "chr_id": "2",
            "chr_pos": "29717635",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N244",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1573580119",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1573580119"
                },
                {
                    "id": "rs1573580119",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1573580119"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 246,
            "end_pos": 246,
            "sequence_org": "T",
            "sequence_mut": "P",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLP).",
            "chr_id": "2",
            "chr_pos": "29717629",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T246",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1352529334",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1352529334"
                },
                {
                    "id": "rs1352529334",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1352529334"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 285,
            "end_pos": 285,
            "sequence_org": "N",
            "sequence_mut": "K",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->KQS).",
            "chr_id": "2",
            "chr_pos": "29197556",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N285",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [],
            "start_pos": 292,
            "end_pos": 292,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "R",
            "sequence_mut": "C",
            "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
            "chr_id": "2",
            "chr_pos": "29694928",
            "ref_nt": "G",
            "alt_nt": "A",
            "minor_allelic_frequency": "",
            "site_lbl": "R292",
            "disease": [
                {
                    "disease_id": "DOID:9256",
                    "recommended_name": {
                        "id": "DOID:9256",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9256",
                        "name": "colorectal cancer",
                        "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, advanced, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer with chromosomal instability, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectum cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectum neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "CRC",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "large intestine cancer",
                            "description": ""
                        },
                        {
                            "id": "MIM:114500",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114500",
                            "name": "Colorectal cancer",
                            "description": "Colorectal cancer"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:11054",
                    "recommended_name": {
                        "id": "DOID:11054",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:11054",
                        "name": "urinary bladder cancer",
                        "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:11054",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11054",
                            "name": "bladder cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:11054",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11054",
                            "name": "tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the bladder."
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "tumour of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "bladder cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "cancer of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm, bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm, urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor, urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant tumour",
                            "description": ""
                        },
                        {
                            "id": "MIM:109800",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/109800",
                            "name": "Bladder cancer",
                            "description": "Bladder cancer"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:1319",
                    "recommended_name": {
                        "id": "DOID:1319",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1319",
                        "name": "brain cancer",
                        "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "BT - Brain tumour",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "adult brain tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "adult malignant brain neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "brain neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "brain neoplasm, adult",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant brain tumour",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant primary brain neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant primary brain tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant tumor of Brain",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant tumor of adult brain",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "neoplasm of brain",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "primary brain neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "primary brain tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "primary malignant neoplasm of brain",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "tumor of the Brain",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs781771386",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781771386"
                },
                {
                    "id": "rs781771386",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs781771386"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 324,
            "end_pos": 324,
            "sequence_org": "N",
            "sequence_mut": "D",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).",
            "chr_id": "2",
            "chr_pos": "29532099",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N324",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1558370621",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1558370621"
                },
                {
                    "id": "rs1558370621",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1558370621"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 324,
            "end_pos": 324,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).",
            "chr_id": "2",
            "chr_pos": "29532098",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N324",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs778028653",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778028653"
                },
                {
                    "id": "rs778028653",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778028653"
                },
                {
                    "id": "rs778028653",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs778028653"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 326,
            "end_pos": 326,
            "sequence_org": "S",
            "sequence_mut": "L",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->NTL).",
            "chr_id": "2",
            "chr_pos": "29532092",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S326",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1286011012",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1286011012"
                },
                {
                    "id": "rs1286011012",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1286011012"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 344,
            "end_pos": 344,
            "sequence_org": "H",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (HCT->NCT).",
            "chr_id": "2",
            "chr_pos": "29532039",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "H344",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs149968229",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149968229"
                },
                {
                    "id": "rs149968229",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs149968229"
                },
                {
                    "id": "rs149968229",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149968229"
                },
                {
                    "id": "rs149968229",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs149968229#frequency_tab"
                },
                {
                    "id": "rs149968229",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs149968229"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 371,
            "end_pos": 371,
            "sequence_org": "A",
            "sequence_mut": "T",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEA->NET).",
            "chr_id": "2",
            "chr_pos": "29531958",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.000599",
            "site_lbl": "A371",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 411,
            "end_pos": 411,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "N",
            "sequence_mut": "H",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRS->HRS).",
            "chr_id": "2",
            "chr_pos": "29383783",
            "ref_nt": "T",
            "alt_nt": "G",
            "minor_allelic_frequency": "",
            "site_lbl": "N411",
            "disease": [
                {
                    "disease_id": "DOID:4159",
                    "recommended_name": {
                        "id": "DOID:4159",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:4159",
                        "name": "skin cancer",
                        "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "CA - skin cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "malignant neoplasm of skin",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "melanoma and Non-melanoma skin cancer",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1356575388",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1356575388"
                },
                {
                    "id": "rs1356575388",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1356575388"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 413,
            "end_pos": 413,
            "sequence_org": "S",
            "sequence_mut": "C",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->NRC).",
            "chr_id": "2",
            "chr_pos": "29193645",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S413",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1356575388",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1356575388"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 413,
            "end_pos": 413,
            "sequence_org": "S",
            "sequence_mut": "F",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->NRF).",
            "chr_id": "2",
            "chr_pos": "29193645",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S413",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1477421090",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1477421090"
                },
                {
                    "id": "rs1477421090",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs1477421090#frequency_tab"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 413,
            "end_pos": 413,
            "sequence_org": "S",
            "sequence_mut": "G",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->NRG).",
            "chr_id": "2",
            "chr_pos": "29383777",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S413",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs771340984",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771340984"
                },
                {
                    "id": "rs771340984",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771340984"
                },
                {
                    "id": "rs771340984",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs771340984#frequency_tab"
                },
                {
                    "id": "rs771340984",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs771340984"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 424,
            "end_pos": 424,
            "sequence_org": "N",
            "sequence_mut": "D",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->DCS).",
            "chr_id": "2",
            "chr_pos": "29383744",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N424",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs747832091",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747832091"
                },
                {
                    "id": "rs747832091",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747832091"
                },
                {
                    "id": "rs747832091",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs747832091"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 424,
            "end_pos": 424,
            "sequence_org": "N",
            "sequence_mut": "K",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).",
            "chr_id": "2",
            "chr_pos": "29383742",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N424",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 424,
            "end_pos": 424,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->SCS).",
            "chr_id": "2",
            "chr_pos": "29383743",
            "ref_nt": "T",
            "alt_nt": "C",
            "minor_allelic_frequency": "",
            "site_lbl": "N424",
            "disease": [
                {
                    "disease_id": "DOID:4159",
                    "recommended_name": {
                        "id": "DOID:4159",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:4159",
                        "name": "skin cancer",
                        "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "CA - skin cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "malignant neoplasm of skin",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "melanoma and Non-melanoma skin cancer",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 426,
            "end_pos": 426,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "S",
            "sequence_mut": "C",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->NCC).",
            "chr_id": "2",
            "chr_pos": "29383738",
            "ref_nt": "T",
            "alt_nt": "A",
            "minor_allelic_frequency": "",
            "site_lbl": "S426",
            "disease": [
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1558300778",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1558300778"
                },
                {
                    "id": "rs1558300778",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1558300778"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 426,
            "end_pos": 426,
            "sequence_org": "S",
            "sequence_mut": "G",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->NCG).",
            "chr_id": "2",
            "chr_pos": "29383738",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S426",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [],
            "start_pos": 452,
            "end_pos": 452,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "G",
            "sequence_mut": "W",
            "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
            "chr_id": "2",
            "chr_pos": "29328410",
            "ref_nt": "C",
            "alt_nt": "A",
            "minor_allelic_frequency": "",
            "site_lbl": "G452",
            "disease": [
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:3571",
                    "recommended_name": {
                        "id": "DOID:3571",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:3571",
                        "name": "liver cancer",
                        "description": "A hepatobiliary system cancer that is located_in the liver."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "Ca liver - primary",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "Resectable malignant neoplasm of Liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "hepatic cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "hepatic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant hepato-biliary neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver, primary",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant tumor of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "non-resectable primary hepatic malignant neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "primary liver cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "primary malignant neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "resectable malignant neoplasm of the liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver, not specified as primary or secondary",
                            "description": ""
                        }
                    ]
                },
                {
                    "disease_id": "DOID:4159",
                    "recommended_name": {
                        "id": "DOID:4159",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:4159",
                        "name": "skin cancer",
                        "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "CA - skin cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "malignant neoplasm of skin",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "melanoma and Non-melanoma skin cancer",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1667337818",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1667337818"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 466,
            "end_pos": 466,
            "sequence_org": "D",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DES->NES).",
            "chr_id": "2",
            "chr_pos": "29328368",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "D466",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1553409333",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1553409333"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "o-glyco-site-loss"
            ],
            "start_pos": 522,
            "end_pos": 522,
            "sequence_org": "S",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (STT->NTT).",
            "chr_id": "2",
            "chr_pos": "29318386",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S522",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs78174819",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs78174819"
                },
                {
                    "id": "rs78174819",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs78174819"
                },
                {
                    "id": "rs78174819",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs78174819"
                },
                {
                    "id": "rs78174819",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs78174819#frequency_tab"
                },
                {
                    "id": "rs78174819",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs78174819"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "o-glyco-site-loss"
            ],
            "start_pos": 544,
            "end_pos": 544,
            "sequence_org": "K",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KSS->NSS).",
            "chr_id": "2",
            "chr_pos": "29193251",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.002596",
            "site_lbl": "K544",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs565743321",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs565743321"
                },
                {
                    "id": "rs565743321",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs565743321"
                },
                {
                    "id": "rs565743321",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs565743321"
                },
                {
                    "id": "rs565743321",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs565743321#frequency_tab"
                },
                {
                    "id": "rs565743321",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs565743321"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 563,
            "end_pos": 563,
            "sequence_org": "N",
            "sequence_mut": "K",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).",
            "chr_id": "2",
            "chr_pos": "29297016",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.001797",
            "site_lbl": "N563",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 565,
            "end_pos": 565,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "S",
            "sequence_mut": "P",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->NVP).",
            "chr_id": "2",
            "chr_pos": "29297012",
            "ref_nt": "A",
            "alt_nt": "G",
            "minor_allelic_frequency": "",
            "site_lbl": "S565",
            "disease": [
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs902275025",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs902275025"
                },
                {
                    "id": "rs902275025",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs902275025#frequency_tab"
                },
                {
                    "id": "rs902275025",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs902275025"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 571,
            "end_pos": 571,
            "sequence_org": "N",
            "sequence_mut": "K",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).",
            "chr_id": "2",
            "chr_pos": "29296992",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N571",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1666205088",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1666205088"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 573,
            "end_pos": 573,
            "sequence_org": "T",
            "sequence_mut": "I",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->NKI).",
            "chr_id": "2",
            "chr_pos": "29296987",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T573",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1666205088",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1666205088"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 573,
            "end_pos": 573,
            "sequence_org": "T",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->NKN).",
            "chr_id": "2",
            "chr_pos": "29296987",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T573",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1165866210",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1165866210"
                },
                {
                    "id": "rs1165866210",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1165866210"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 602,
            "end_pos": 602,
            "sequence_org": "D",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DVS->NVS).",
            "chr_id": "2",
            "chr_pos": "29296901",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "D602",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1025380501",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1025380501"
                },
                {
                    "id": "rs1025380501",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1025380501"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 627,
            "end_pos": 627,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).",
            "chr_id": "2",
            "chr_pos": "29275434",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N627",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs145780832",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145780832"
                },
                {
                    "id": "rs145780832",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs145780832"
                },
                {
                    "id": "rs145780832",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145780832"
                },
                {
                    "id": "rs145780832",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs145780832#frequency_tab"
                },
                {
                    "id": "rs145780832",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs145780832"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 671,
            "end_pos": 671,
            "sequence_org": "P",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSP->NSS).",
            "chr_id": "2",
            "chr_pos": "29275129",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.002596",
            "site_lbl": "P671",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs145780832",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145780832"
                },
                {
                    "id": "rs145780832",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs145780832"
                },
                {
                    "id": "rs145780832",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145780832"
                },
                {
                    "id": "rs145780832",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs145780832#frequency_tab"
                },
                {
                    "id": "rs145780832",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs145780832"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 671,
            "end_pos": 671,
            "sequence_org": "P",
            "sequence_mut": "T",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSP->NST).",
            "chr_id": "2",
            "chr_pos": "29275129",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.002596",
            "site_lbl": "P671",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs34829159",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs34829159"
                },
                {
                    "id": "rs34829159",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs34829159"
                },
                {
                    "id": "rs34829159",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs34829159"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 704,
            "end_pos": 704,
            "sequence_org": "A",
            "sequence_mut": "T",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNA->NNT).",
            "chr_id": "2",
            "chr_pos": "29251199",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "A704",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs376175333",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376175333"
                },
                {
                    "id": "rs376175333",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs376175333"
                },
                {
                    "id": "rs376175333",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376175333"
                },
                {
                    "id": "rs376175333",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs376175333#frequency_tab"
                },
                {
                    "id": "rs376175333",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs376175333"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 709,
            "end_pos": 709,
            "sequence_org": "N",
            "sequence_mut": "K",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->KLS).",
            "chr_id": "2",
            "chr_pos": "29251182",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.003994",
            "site_lbl": "N709",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1166188112",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1166188112"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 711,
            "end_pos": 711,
            "sequence_org": "S",
            "sequence_mut": "G",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->NLG).",
            "chr_id": "2",
            "chr_pos": "29251178",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S711",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 711,
            "end_pos": 711,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "S",
            "sequence_mut": "N",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->NLN).",
            "chr_id": "2",
            "chr_pos": "29251177",
            "ref_nt": "C",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "S711",
            "disease": [
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1166188112",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1166188112"
                },
                {
                    "id": "rs1166188112",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs1166188112#frequency_tab"
                },
                {
                    "id": "rs1166188112",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1166188112"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 711,
            "end_pos": 711,
            "sequence_org": "S",
            "sequence_mut": "R",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->NLR).",
            "chr_id": "2",
            "chr_pos": "29251178",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S711",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1664804232",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1664804232"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "o-glyco-site-loss"
            ],
            "start_pos": 731,
            "end_pos": 731,
            "sequence_org": "T",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TDT->NDT).",
            "chr_id": "2",
            "chr_pos": "29251117",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T731",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 801,
            "end_pos": 801,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "I",
            "sequence_mut": "T",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NVI->NVT).",
            "chr_id": "2",
            "chr_pos": "29233650",
            "ref_nt": "A",
            "alt_nt": "G",
            "minor_allelic_frequency": "",
            "site_lbl": "I801",
            "disease": [
                {
                    "disease_id": "DOID:263",
                    "recommended_name": {
                        "id": "DOID:263",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:263",
                        "name": "kidney cancer",
                        "description": "A urinary system cancer that is located_in the kidney."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "malignant neoplasm of kidney except pelvis",
                            "description": ""
                        },
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "malignant tumour of kidney",
                            "description": ""
                        },
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "renal cancer",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 808,
            "end_pos": 808,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRS->SRS).",
            "chr_id": "2",
            "chr_pos": "29233629",
            "ref_nt": "T",
            "alt_nt": "C",
            "minor_allelic_frequency": "",
            "site_lbl": "N808",
            "disease": [
                {
                    "disease_id": "DOID:9256",
                    "recommended_name": {
                        "id": "DOID:9256",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9256",
                        "name": "colorectal cancer",
                        "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, advanced, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer with chromosomal instability, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectum cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectum neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "CRC",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "large intestine cancer",
                            "description": ""
                        },
                        {
                            "id": "MIM:114500",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114500",
                            "name": "Colorectal cancer",
                            "description": "Colorectal cancer"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:363",
                    "recommended_name": {
                        "id": "DOID:363",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:363",
                        "name": "uterine cancer",
                        "description": "A female reproductive organ cancer that is located_in the uterus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "CA - cancer of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "Tumour of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterus neoplasm",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1664283510",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1664283510"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 808,
            "end_pos": 808,
            "sequence_org": "N",
            "sequence_mut": "null",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->nullRS).",
            "chr_id": "2",
            "chr_pos": "29233632",
            "ref_nt": "p",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N808",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1339678509",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1339678509"
                },
                {
                    "id": "rs1339678509",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1339678509"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 810,
            "end_pos": 810,
            "sequence_org": "S",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->NRN).",
            "chr_id": "2",
            "chr_pos": "29233623",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S810",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs150292405",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150292405"
                },
                {
                    "id": "rs150292405",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs150292405"
                },
                {
                    "id": "rs150292405",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150292405"
                },
                {
                    "id": "rs150292405",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs150292405#frequency_tab"
                },
                {
                    "id": "rs150292405",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs150292405"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 810,
            "end_pos": 810,
            "sequence_org": "S",
            "sequence_mut": "R",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->NRR).",
            "chr_id": "2",
            "chr_pos": "29233622",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.001597",
            "site_lbl": "S810",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs528844155",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528844155"
                },
                {
                    "id": "rs528844155",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs528844155"
                },
                {
                    "id": "rs528844155",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528844155"
                },
                {
                    "id": "rs528844155",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs528844155#frequency_tab"
                },
                {
                    "id": "rs528844155",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs528844155"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 866,
            "end_pos": 866,
            "sequence_org": "S",
            "sequence_mut": "L",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NSL).",
            "chr_id": "2",
            "chr_pos": "29232339",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.0002",
            "site_lbl": "S866",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1553396171",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1553396171"
                },
                {
                    "id": "rs1553396171",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1553396171"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 866,
            "end_pos": 866,
            "sequence_org": "S",
            "sequence_mut": "P",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NSP).",
            "chr_id": "2",
            "chr_pos": "29232340",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S866",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                },
                {
                    "id": "rs925802421",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs925802421"
                },
                {
                    "id": "rs925802421",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs925802421"
                },
                {
                    "id": "rs925802421",
                    "database": "NCI-TCGA",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs925802421"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 885,
            "end_pos": 885,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "D",
            "sequence_mut": "N",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DNT->NNT).",
            "chr_id": "2",
            "chr_pos": "29229046",
            "ref_nt": "C",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "D885",
            "disease": [
                {
                    "disease_id": "DOID:11054",
                    "recommended_name": {
                        "id": "DOID:11054",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:11054",
                        "name": "urinary bladder cancer",
                        "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:11054",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11054",
                            "name": "bladder cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:11054",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11054",
                            "name": "tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the bladder."
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "tumour of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "bladder cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "cancer of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm, bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm, urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor, urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant tumour",
                            "description": ""
                        },
                        {
                            "id": "MIM:109800",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/109800",
                            "name": "Bladder cancer",
                            "description": "Bladder cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease",
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1452092742",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1452092742"
                },
                {
                    "id": "rs1452092742",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1452092742"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 886,
            "end_pos": 886,
            "sequence_org": "N",
            "sequence_mut": "I",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->ITS).",
            "chr_id": "2",
            "chr_pos": "29229042",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N886",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 888,
            "end_pos": 888,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "S",
            "sequence_mut": "Y",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTS->NTY).",
            "chr_id": "2",
            "chr_pos": "29229036",
            "ref_nt": "G",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "S888",
            "disease": [
                {
                    "disease_id": "DOID:363",
                    "recommended_name": {
                        "id": "DOID:363",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:363",
                        "name": "uterine cancer",
                        "description": "A female reproductive organ cancer that is located_in the uterus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "CA - cancer of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "Tumour of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterus neoplasm",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 943,
            "end_pos": 943,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "A",
            "sequence_mut": "T",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NAA->NAT).",
            "chr_id": "2",
            "chr_pos": "29227661",
            "ref_nt": "C",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "A943",
            "disease": [
                {
                    "disease_id": "DOID:10534",
                    "recommended_name": {
                        "id": "DOID:10534",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:10534",
                        "name": "stomach cancer",
                        "description": "A gastrointestinal system cancer that is located_in the stomach."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:10534",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10534",
                            "name": "gastric cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10534",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10534",
                            "name": "gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the stomach."
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "Ca lesser curvature - stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "cancer of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer risk after h. pylori infection",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant stomach neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of greater curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of greater curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "stomach cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "Ca body - stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "ca greater curvature of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer, intestinal",
                            "description": ""
                        },
                        {
                            "id": "MIM:613659",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/613659",
                            "name": "Gastric cancer",
                            "description": "Gastric cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs764482518",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764482518"
                },
                {
                    "id": "rs764482518",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764482518"
                },
                {
                    "id": "rs764482518",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs764482518"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 948,
            "end_pos": 948,
            "sequence_org": "P",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDP->NDS).",
            "chr_id": "2",
            "chr_pos": "29227646",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "P948",
            "keywords": [
                "ebi",
                "germline"
            ]
        }
    ],
    "mutagenesis": [
        {
            "start_pos": 1507,
            "end_pos": 1507,
            "sequence_org": "Y",
            "sequence_mut": "F",
            "comment": "Impairs interaction with SHC1.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "17274988",
                    "url": "https://glygen.org/publication/PubMed/17274988"
                }
            ]
        },
        {
            "start_pos": 48,
            "end_pos": 52,
            "sequence_org": "RLQRK",
            "sequence_mut": "ELQEE",
            "comment": "Abolished heparin-binding, leading to decreased ALK activation.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "25605972",
                    "url": "https://glygen.org/publication/PubMed/25605972"
                }
            ]
        },
        {
            "start_pos": 859,
            "end_pos": 859,
            "sequence_org": "E",
            "sequence_mut": "A",
            "comment": "Slightly decreased autophosphorylation. Decreased autophosphorylation and subsequent activation; when associated with A-974.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "34819673",
                    "url": "https://glygen.org/publication/PubMed/34819673"
                }
            ]
        },
        {
            "start_pos": 966,
            "end_pos": 966,
            "sequence_org": "Y",
            "sequence_mut": "A",
            "comment": "Slightly decreased autophosphorylation. Strongly reduced autophosphorylation and subsequent activation; when associated with A-994.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "34819673",
                    "url": "https://glygen.org/publication/PubMed/34819673"
                }
            ]
        },
        {
            "start_pos": 974,
            "end_pos": 974,
            "sequence_org": "E",
            "sequence_mut": "A",
            "comment": "Slightly decreased autophosphorylation. Decreased autophosphorylation and subsequent activation; when associated with A-859.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "34819673",
                    "url": "https://glygen.org/publication/PubMed/34819673"
                }
            ]
        },
        {
            "start_pos": 994,
            "end_pos": 994,
            "sequence_org": "E",
            "sequence_mut": "A",
            "comment": "SlStrongly reduced autophosphorylation and subsequent activation; when associated with A-966.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "34819673",
                    "url": "https://glygen.org/publication/PubMed/34819673"
                }
            ]
        }
    ],
    "expression_tissue": [
        {
            "tissue": {
                "name": "Adult mammalian kidney",
                "namespace": "UBERON",
                "id": "0000082",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000082"
            },
            "score": "50.55",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000171094",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094"
                }
            ]
        },
        {
            "tissue": {
                "name": "Oral cavity",
                "namespace": "UBERON",
                "id": "0000167",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000167"
            },
            "score": "58.55",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000171094",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094"
                }
            ]
        },
        {
            "tissue": {
                "name": "Stomach",
                "namespace": "UBERON",
                "id": "0000945",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000945"
            },
            "score": "56.73",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000171094",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094"
                }
            ]
        },
        {
            "tissue": {
                "name": "Uterus",
                "namespace": "UBERON",
                "id": "0000995",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000995"
            },
            "score": "82.4",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000171094",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094"
                }
            ]
        },
        {
            "tissue": {
                "name": "Esophagus",
                "namespace": "UBERON",
                "id": "0001043",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001043"
            },
            "score": "63.82",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000171094",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094"
                }
            ]
        },
        {
            "tissue": {
                "name": "Rectum",
                "namespace": "UBERON",
                "id": "0001052",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001052"
            },
            "score": "54.8",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000171094",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094"
                }
            ]
        },
        {
            "tissue": {
                "name": "Colon",
                "namespace": "UBERON",
                "id": "0001155",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001155"
            },
            "score": "67.92",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000171094",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094"
                }
            ]
        },
        {
            "tissue": {
                "name": "Urinary bladder",
                "namespace": "UBERON",
                "id": "0001255",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001255"
            },
            "score": "51.09",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000171094",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094"
                }
            ]
        },
        {
            "tissue": {
                "name": "Thyroid gland",
                "namespace": "UBERON",
                "id": "0002046",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002046"
            },
            "score": "51.79",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000171094",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094"
                }
            ]
        },
        {
            "tissue": {
                "name": "Lung",
                "namespace": "UBERON",
                "id": "0002048",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002048"
            },
            "score": "66.64",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000171094",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094"
                }
            ]
        },
        {
            "tissue": {
                "name": "Liver",
                "namespace": "UBERON",
                "id": "0002107",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002107"
            },
            "score": "38.66",
            "present": "LOW",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000171094",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094"
                }
            ]
        },
        {
            "tissue": {
                "name": "Prostate gland",
                "namespace": "UBERON",
                "id": "0002367",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002367"
            },
            "score": "45.51",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000171094",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094"
                }
            ]
        },
        {
            "tissue": {
                "name": "Thoracic mammary gland",
                "namespace": "UBERON",
                "id": "0005200",
                "url": "http://purl.obolibrary.org/obo/UBERON_0005200"
            },
            "score": "52.41",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000171094",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094"
                }
            ]
        }
    ],
    "expression_disease": [
        {
            "significant": "No",
            "trend": "down",
            "name": "Prostate cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:10283",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "Q9UM73",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UM73"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:10283",
                    "recommended_name": {
                        "id": "DOID:10283",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:10283",
                        "name": "prostate cancer",
                        "description": "A male reproductive organ cancer that is located_in the prostate."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "NGP - new growth of prostate",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "hereditary prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "malignant tumor of the prostate",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostate cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostate neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostatic cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostatic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "tumor of the prostate",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, type 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "HPC9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, 12",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "EHBP1 familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "familial prostate cancer caused by mutation in EHBP1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, 12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, type 12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "HPC12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, type 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "HPC5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, type 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, susceptibility to, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "HPC3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, type 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, susceptibility to, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "HPC4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, on chromosome 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, 13",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "MSMB familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "familial prostate cancer caused by mutation in MSMB",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, 13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, type 13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "HPC13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, type 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "HPC8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "predisposing for prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, type 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "HPC6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "prostate cancer, hereditary, 10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "HPC10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "prostate cancer, hereditary, 10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "familial prostate carcinoma",
                            "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "hereditary prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "hereditary prostate carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, hereditary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer, hereditary, 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "HPC7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer, hereditary, 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer aggressiveness",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, 1",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "RNASEL familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "familial prostate cancer caused by mutation in RNASEL",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, type 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "HPC1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "Prca1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "prostate cancer, hereditary, 11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "HPC11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "prostate cancer, hereditary, 11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "prostate cancer, hereditary, 14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "HPC14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "prostate cancer, hereditary, 14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "prostate cancer, hereditary, 15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "HPC15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "prostate cancer, hereditary, 15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer, hereditary, X-linked 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "HPCX1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer, hereditary, X-linked 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer susceptibility, X-linked",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "prostate cancer, hereditary, X-linked 2",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "HPCX2",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "prostate cancer, hereditary, X-linked 2",
                            "description": ""
                        },
                        {
                            "id": "MIM:611868",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611868",
                            "name": "Prostate cancer, hereditary, 12",
                            "description": "Prostate cancer, hereditary, 12"
                        },
                        {
                            "id": "MIM:611928",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611928",
                            "name": "Prostate cancer, hereditary, 13",
                            "description": "Prostate cancer, hereditary, 13"
                        },
                        {
                            "id": "MIM:176807",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/176807",
                            "name": "Prostate cancer",
                            "description": "Prostate cancer"
                        },
                        {
                            "id": "MIM:601518",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/601518",
                            "name": "Prostate cancer, hereditary, 1",
                            "description": "Prostate cancer, hereditary, 1"
                        },
                        {
                            "id": "MIM:611955",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611955",
                            "name": "Prostate cancer, hereditary, 11",
                            "description": "Prostate cancer, hereditary, 11"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Stomach cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:10534",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "Q9UM73",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UM73"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:10534",
                    "recommended_name": {
                        "id": "DOID:10534",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:10534",
                        "name": "stomach cancer",
                        "description": "A gastrointestinal system cancer that is located_in the stomach."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:10534",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10534",
                            "name": "gastric cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10534",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10534",
                            "name": "gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the stomach."
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "Ca lesser curvature - stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "cancer of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer risk after h. pylori infection",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant stomach neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of greater curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of greater curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "stomach cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "Ca body - stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "ca greater curvature of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer, intestinal",
                            "description": ""
                        },
                        {
                            "id": "MIM:613659",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/613659",
                            "name": "Gastric cancer",
                            "description": "Gastric cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "No",
            "trend": "down",
            "name": "Urinary bladder cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:11054",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "Q9UM73",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UM73"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:11054",
                    "recommended_name": {
                        "id": "DOID:11054",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:11054",
                        "name": "urinary bladder cancer",
                        "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:11054",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11054",
                            "name": "bladder cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:11054",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11054",
                            "name": "tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the bladder."
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "tumour of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "bladder cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "cancer of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm, bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm, urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor, urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant tumour",
                            "description": ""
                        },
                        {
                            "id": "MIM:109800",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/109800",
                            "name": "Bladder cancer",
                            "description": "Bladder cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Head and neck cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:11934",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "Q9UM73",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UM73"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:11934",
                    "recommended_name": {
                        "id": "DOID:11934",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:11934",
                        "name": "head and neck cancer",
                        "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head and neck neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head and neck tumours",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head/neck neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "tumor of head and neck",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Lung cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:1324",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "Q9UM73",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UM73"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Breast cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:1612",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "Q9UM73",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UM73"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:1612",
                    "recommended_name": {
                        "id": "DOID:1612",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1612",
                        "name": "breast cancer",
                        "description": "A thoracic cancer that originates in the mammary gland."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "breast tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "malignant neoplasm of breast",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "malignant tumor of the breast",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "mammary cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "mammary tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "primary breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast carcinoma",
                            "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, lobular, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial breast carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial cancer of breast",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial cancer of the breast",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, familial Male",
                            "description": ""
                        },
                        {
                            "id": "MIM:114480",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114480",
                            "name": "Breast cancer",
                            "description": "Breast cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Thyroid cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:1781",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "Q9UM73",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UM73"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:1781",
                    "recommended_name": {
                        "id": "DOID:1781",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1781",
                        "name": "thyroid cancer",
                        "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "thyroid gland cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "Thyroid gland neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "malignant neoplasm of thyroid gland",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "malignant tumour of thyroid gland",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "neoplasm of thyroid gland",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "thyroid neoplasm",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Kidney cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:263",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "Q9UM73",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UM73"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:263",
                    "recommended_name": {
                        "id": "DOID:263",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:263",
                        "name": "kidney cancer",
                        "description": "A urinary system cancer that is located_in the kidney."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "malignant neoplasm of kidney except pelvis",
                            "description": ""
                        },
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "malignant tumour of kidney",
                            "description": ""
                        },
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "renal cancer",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "No",
            "trend": "down",
            "name": "Liver cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:3571",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "Q9UM73",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UM73"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:3571",
                    "recommended_name": {
                        "id": "DOID:3571",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:3571",
                        "name": "liver cancer",
                        "description": "A hepatobiliary system cancer that is located_in the liver."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "Ca liver - primary",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "Resectable malignant neoplasm of Liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "hepatic cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "hepatic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant hepato-biliary neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver, primary",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant tumor of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "non-resectable primary hepatic malignant neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "primary liver cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "primary malignant neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "resectable malignant neoplasm of the liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver, not specified as primary or secondary",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Uterine cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:363",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "Q9UM73",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UM73"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:363",
                    "recommended_name": {
                        "id": "DOID:363",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:363",
                        "name": "uterine cancer",
                        "description": "A female reproductive organ cancer that is located_in the uterus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "CA - cancer of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "Tumour of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterus neoplasm",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Esophageal cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:5041",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "Q9UM73",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UM73"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:5041",
                    "recommended_name": {
                        "id": "DOID:5041",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:5041",
                        "name": "esophageal cancer",
                        "description": "A gastrointestinal system cancer that is located_in the esophagus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "Ca lower third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "Ca middle third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "esophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of lower third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of middle third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of upper third esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of Distal Third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of Proximal Third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of abdominal esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of the middle Third of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the esophagus."
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "cancer of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "cancer of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal carcinoma, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal squamous cell carcinoma, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophagus neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophagus tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant oesophagus neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant oesophagus tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "oesophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca lower third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca lower third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca middle third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca middle third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of distal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of lower third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of lower third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of middle third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of middle third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of proximal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of upper third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of upper third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of abdominal esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of the middle third of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of abdominal oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of distal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of proximal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of the middle third of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Aerodigestive tract cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Escc, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal squamous cell carcinoma, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "gastric cardia adenocarcinoma, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MIM:133239",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/133239",
                            "name": "Esophageal cancer",
                            "description": "Esophageal cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Colorectal cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:9256",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "Q9UM73",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UM73"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:9256",
                    "recommended_name": {
                        "id": "DOID:9256",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9256",
                        "name": "colorectal cancer",
                        "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, advanced, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer with chromosomal instability, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectum cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectum neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "CRC",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "large intestine cancer",
                            "description": ""
                        },
                        {
                            "id": "MIM:114500",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114500",
                            "name": "Colorectal cancer",
                            "description": "Colorectal cancer"
                        }
                    ]
                }
            ]
        }
    ],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "ALK",
            "url": "https://www.uniprot.org/uniprot/Q9UM73",
            "locus": {
                "chromosome": "2",
                "start_pos": 29192774,
                "end_pos": 29921586,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000171094",
                        "url": "https://www.ensembl.org/id/ENSG00000171094"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSG00000171094",
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171094",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "Q9UM73",
            "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UM73",
            "database": "BioMuta",
            "categories": [
                "Variation"
            ]
        },
        {
            "id": "2.7.10.1",
            "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.10.1&UniProtAcc=Q9UM73",
            "database": "BRENDA",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "cd00112",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00112",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd05036",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05036",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd06263",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06263",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "CHEMBL4247",
            "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4247",
            "database": "ChEMBL",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "ALK",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ALK",
            "database": "GeneCards",
            "categories": [
                "Organism-specific",
                "Gene Annotation"
            ]
        },
        {
            "id": "238",
            "url": "https://www.ncbi.nlm.nih.gov/gene/238",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "427",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=427",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "Q9UM73",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9UM73*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR000719",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000719",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR000998",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000998",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001245",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001245",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR002011",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR002011",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR002172",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR002172",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR008266",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR008266",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR011009",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR011009",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013320",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013320",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017441",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017441",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR020635",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR020635",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036055",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036055",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "hsa:238",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:238",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "105590",
            "url": "http://www.omim.org/entry/105590",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "613014",
            "url": "http://www.omim.org/entry/613014",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "NX_Q9UM73",
            "url": "https://www.nextprot.org/entry/NX_Q9UM73",
            "database": "neXtProt",
            "categories": [
                "Organism-specific",
                "Protein"
            ]
        },
        {
            "id": "Q9UM73",
            "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UM73",
            "database": "O-GlcNAc Database",
            "categories": [
                "Glycoproteomics"
            ]
        },
        {
            "id": "NTACERQ",
            "url": "https://omabrowser.org/oma/group/NTACERQ/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "1614410at2759",
            "url": "http://www.orthodb.org/?query=1614410at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR24416",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24416",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR24416:SF276",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24416:SF276",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "2KUP",
            "url": "https://www.rcsb.org/structure/2KUP",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2KUQ",
            "url": "https://www.rcsb.org/structure/2KUQ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2XB7",
            "url": "https://www.rcsb.org/structure/2XB7",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2XBA",
            "url": "https://www.rcsb.org/structure/2XBA",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2XP2",
            "url": "https://www.rcsb.org/structure/2XP2",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2YFX",
            "url": "https://www.rcsb.org/structure/2YFX",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2YHV",
            "url": "https://www.rcsb.org/structure/2YHV",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2YJR",
            "url": "https://www.rcsb.org/structure/2YJR",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2YJS",
            "url": "https://www.rcsb.org/structure/2YJS",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2YS5",
            "url": "https://www.rcsb.org/structure/2YS5",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2YT2",
            "url": "https://www.rcsb.org/structure/2YT2",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3AOX",
            "url": "https://www.rcsb.org/structure/3AOX",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3L9P",
            "url": "https://www.rcsb.org/structure/3L9P",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3LCS",
            "url": "https://www.rcsb.org/structure/3LCS",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3LCT",
            "url": "https://www.rcsb.org/structure/3LCT",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4ANL",
            "url": "https://www.rcsb.org/structure/4ANL",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4ANQ",
            "url": "https://www.rcsb.org/structure/4ANQ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4ANS",
            "url": "https://www.rcsb.org/structure/4ANS",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4CCB",
            "url": "https://www.rcsb.org/structure/4CCB",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4CCU",
            "url": "https://www.rcsb.org/structure/4CCU",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4CD0",
            "url": "https://www.rcsb.org/structure/4CD0",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4CLI",
            "url": "https://www.rcsb.org/structure/4CLI",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4CLJ",
            "url": "https://www.rcsb.org/structure/4CLJ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4CMO",
            "url": "https://www.rcsb.org/structure/4CMO",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4CMT",
            "url": "https://www.rcsb.org/structure/4CMT",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4CMU",
            "url": "https://www.rcsb.org/structure/4CMU",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4CNH",
            "url": "https://www.rcsb.org/structure/4CNH",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4CTB",
            "url": "https://www.rcsb.org/structure/4CTB",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4CTC",
            "url": "https://www.rcsb.org/structure/4CTC",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4DCE",
            "url": "https://www.rcsb.org/structure/4DCE",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4FNW",
            "url": "https://www.rcsb.org/structure/4FNW",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4FNX",
            "url": "https://www.rcsb.org/structure/4FNX",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4FNY",
            "url": "https://www.rcsb.org/structure/4FNY",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4FNZ",
            "url": "https://www.rcsb.org/structure/4FNZ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4FOB",
            "url": "https://www.rcsb.org/structure/4FOB",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4FOC",
            "url": "https://www.rcsb.org/structure/4FOC",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4FOD",
            "url": "https://www.rcsb.org/structure/4FOD",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4JOA",
            "url": "https://www.rcsb.org/structure/4JOA",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4MKC",
            "url": "https://www.rcsb.org/structure/4MKC",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4TT7",
            "url": "https://www.rcsb.org/structure/4TT7",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4Z55",
            "url": "https://www.rcsb.org/structure/4Z55",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5A9U",
            "url": "https://www.rcsb.org/structure/5A9U",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5AA8",
            "url": "https://www.rcsb.org/structure/5AA8",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5AA9",
            "url": "https://www.rcsb.org/structure/5AA9",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5AAA",
            "url": "https://www.rcsb.org/structure/5AAA",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5AAB",
            "url": "https://www.rcsb.org/structure/5AAB",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5AAC",
            "url": "https://www.rcsb.org/structure/5AAC",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5FTO",
            "url": "https://www.rcsb.org/structure/5FTO",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5FTQ",
            "url": "https://www.rcsb.org/structure/5FTQ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5IMX",
            "url": "https://www.rcsb.org/structure/5IMX",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5IUG",
            "url": "https://www.rcsb.org/structure/5IUG",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5IUH",
            "url": "https://www.rcsb.org/structure/5IUH",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5IUI",
            "url": "https://www.rcsb.org/structure/5IUI",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5KZ0",
            "url": "https://www.rcsb.org/structure/5KZ0",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5VZ5",
            "url": "https://www.rcsb.org/structure/5VZ5",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6AT9",
            "url": "https://www.rcsb.org/structure/6AT9",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6CDT",
            "url": "https://www.rcsb.org/structure/6CDT",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6E0R",
            "url": "https://www.rcsb.org/structure/6E0R",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6EBW",
            "url": "https://www.rcsb.org/structure/6EBW",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6EDL",
            "url": "https://www.rcsb.org/structure/6EDL",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6MX8",
            "url": "https://www.rcsb.org/structure/6MX8",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7BTT",
            "url": "https://www.rcsb.org/structure/7BTT",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7JY4",
            "url": "https://www.rcsb.org/structure/7JY4",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7JYR",
            "url": "https://www.rcsb.org/structure/7JYR",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7JYS",
            "url": "https://www.rcsb.org/structure/7JYS",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7JYT",
            "url": "https://www.rcsb.org/structure/7JYT",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7LRZ",
            "url": "https://www.rcsb.org/structure/7LRZ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7LS0",
            "url": "https://www.rcsb.org/structure/7LS0",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7MZW",
            "url": "https://www.rcsb.org/structure/7MZW",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7MZY",
            "url": "https://www.rcsb.org/structure/7MZY",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7N00",
            "url": "https://www.rcsb.org/structure/7N00",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7NWZ",
            "url": "https://www.rcsb.org/structure/7NWZ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7NX3",
            "url": "https://www.rcsb.org/structure/7NX3",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7NX4",
            "url": "https://www.rcsb.org/structure/7NX4",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7R7K",
            "url": "https://www.rcsb.org/structure/7R7K",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7R7R",
            "url": "https://www.rcsb.org/structure/7R7R",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "8ARJ",
            "url": "https://www.rcsb.org/structure/8ARJ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF00629",
            "url": "http://pfam.xfam.org/family/PF00629",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF07714",
            "url": "http://pfam.xfam.org/family/PF07714",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF12810",
            "url": "http://pfam.xfam.org/family/PF12810",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "Q9UM73",
            "url": "https://pharos.nih.gov/targets/Q9UM73",
            "database": "PHAROS",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "PR_Q9UM73",
            "url": "http://purl.obolibrary.org/obo/PR_Q9UM73",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-HSA-201556",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9700645",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9717264",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717264",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9717301",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717301",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9717316",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717316",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9717319",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717319",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9717323",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717323",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9717326",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717326",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9717329",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717329",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9725370",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9725371",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_004295",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "10596",
            "url": "https://www.rhea-db.org/rhea/10596",
            "database": "Rhea",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "A0A087WZL3",
            "url": "https://www.uniprot.org/uniprot/A0A087WZL3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A087WZL3-1",
            "url": "https://www.uniprot.org/uniprot/A0A087WZL3-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0K2YUJ3",
            "url": "https://www.uniprot.org/uniprot/A0A0K2YUJ3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0K2YUJ3-1",
            "url": "https://www.uniprot.org/uniprot/A0A0K2YUJ3-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "E7EPW7",
            "url": "https://www.uniprot.org/uniprot/E7EPW7",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "E7EPW7-1",
            "url": "https://www.uniprot.org/uniprot/E7EPW7-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "H7BZ33",
            "url": "https://www.uniprot.org/uniprot/H7BZ33",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "H7BZ33-1",
            "url": "https://www.uniprot.org/uniprot/H7BZ33-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9UM73",
            "url": "https://www.uniprot.org/uniprot/Q9UM73",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9UM73-1",
            "url": "https://www.uniprot.org/uniprot/Q9UM73-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARDLLLPPSSSELKAGRPEARGSLALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQGEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGRYIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYCNFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFPAPIKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPLLDVSDRFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSRNLFERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP",
        "length": 1620,
        "header": "sp|Q9UM73-1|ALK_HUMAN Isoform 1 of ALK tyrosine kinase receptor  OS=Homo sapiens OX=9606 GN=ALK PE=1 SV=3 CANONICAL=Q9UM73-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A087WZL3-1",
            "url": "",
            "sequence": {
                "sequence": "MPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYCNFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFPAPIKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPLLDVSDRFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSRNLFERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP",
                "length": 1243,
                "header": "tr|A0A087WZL3-1|A0A087WZL3_HUMAN Computationally mapped isoform of Tyrosine-protein kinase receptor  OS=Homo sapiens OX=9606 GN=ALK PE=1 SV=1 CANONICAL=Q9UM73-1"
            },
            "locus": {
                "chromosome": "2",
                "start_pos": 29531937,
                "end_pos": 29193227,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000618119.4",
                        "url": "https://www.ensembl.org/id/ENST00000618119.4"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000482733.1",
                        "url": "https://www.ensembl.org/id/ENSP00000482733.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A0K2YUJ3-1",
            "url": "",
            "sequence": {
                "sequence": "MQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP",
                "length": 552,
                "header": "tr|A0A0K2YUJ3-1|A0A0K2YUJ3_HUMAN Computationally mapped isoform of Tyrosine-protein kinase receptor  OS=Homo sapiens OX=9606 GN=ALK PE=1 SV=1 CANONICAL=Q9UM73-1"
            },
            "locus": {
                "chromosome": "2",
                "start_pos": 29223496,
                "end_pos": 29193227,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000642122.1",
                        "url": "https://www.ensembl.org/id/ENST00000642122.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000493203.1",
                        "url": "https://www.ensembl.org/id/ENSP00000493203.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "E7EPW7-1",
            "url": "",
            "sequence": {
                "sequence": "XNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIGNPNLITVGPLHRGGN",
                "length": 129,
                "header": "tr|E7EPW7-1|E7EPW7_HUMAN Computationally mapped isoform of ALK receptor tyrosine kinase  OS=Homo sapiens OX=9606 GN=ALK PE=1 SV=3 CANONICAL=Q9UM73-1"
            },
            "locus": {
                "chromosome": "2",
                "start_pos": 29227653,
                "end_pos": 29224630,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000431873.6",
                        "url": "https://www.ensembl.org/id/ENST00000431873.6"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000414027.3",
                        "url": "https://www.ensembl.org/id/ENSP00000414027.3"
                    }
                ]
            }
        },
        {
            "isoform_ac": "H7BZ33-1",
            "url": "",
            "sequence": {
                "sequence": "SSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISLSWKQLFCFTFCLRPSWEKSTMNSSTQSTHQYLRKTLSCPLRHFLTQVPEQHPHSSSHSPANGTPVEPAVVLPTCSPARFWV",
                "length": 152,
                "header": "tr|H7BZ33-1|H7BZ33_HUMAN Computationally mapped isoform of ALK receptor tyrosine kinase  OS=Homo sapiens OX=9606 GN=ALK PE=1 SV=1 CANONICAL=Q9UM73-1"
            },
            "locus": {
                "chromosome": "2",
                "start_pos": 29223394,
                "end_pos": 29220991,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000453137.1",
                        "url": "https://www.ensembl.org/id/ENST00000453137.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000387488.1",
                        "url": "https://www.ensembl.org/id/ENSP00000387488.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q9UM73-1",
            "url": "",
            "sequence": {
                "sequence": "MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARDLLLPPSSSELKAGRPEARGSLALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQGEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGRYIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYCNFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFPAPIKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPLLDVSDRFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSRNLFERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP",
                "length": 1620,
                "header": "sp|Q9UM73-1|ALK_HUMAN Isoform 1 of ALK tyrosine kinase receptor  OS=Homo sapiens OX=9606 GN=ALK PE=1 SV=3 CANONICAL=Q9UM73-1"
            },
            "locus": {
                "chromosome": "2",
                "start_pos": 29920659,
                "end_pos": 29193227,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000389048.8",
                        "url": "https://www.ensembl.org/id/ENST00000389048.8"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000373700.3",
                        "url": "https://www.ensembl.org/id/ENSP00000373700.3"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 169,
            "start_aa": "Asn",
            "end_pos": 169,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn169",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 244,
            "start_aa": "Asn",
            "end_pos": 244,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn244",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 285,
            "start_aa": "Asn",
            "end_pos": 285,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn285",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 324,
            "start_aa": "Asn",
            "end_pos": 324,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn324",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 411,
            "start_aa": "Asn",
            "end_pos": 411,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn411",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 424,
            "start_aa": "Asn",
            "end_pos": 424,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn424",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 445,
            "start_aa": "Asn",
            "end_pos": 445,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn445",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 563,
            "start_aa": "Asn",
            "end_pos": 563,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn563",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 571,
            "start_aa": "Asn",
            "end_pos": 571,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn571",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 627,
            "start_aa": "Asn",
            "end_pos": 627,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn627",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 709,
            "start_aa": "Asn",
            "end_pos": 709,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn709",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 808,
            "start_aa": "Asn",
            "end_pos": 808,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn808",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 863,
            "start_aa": "Asn",
            "end_pos": 863,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn863",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 864,
            "start_aa": "Asn",
            "end_pos": 864,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn864",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 886,
            "start_aa": "Asn",
            "end_pos": 886,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn886",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 986,
            "start_aa": "Asn",
            "end_pos": 986,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn986",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "G49108TO",
            "type": "O-linked",
            "subtype": "O-GlcNAcylation",
            "site_category": "reported_with_glycan",
            "site_seq": "",
            "relation": "attached",
            "comment": "O-GlcNAcylation",
            "evidence": [
                {
                    "id": "Q9UM73",
                    "database": "O-GlcNAc Database",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UM73"
                },
                {
                    "id": "28510447",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/28510447"
                }
            ]
        }
    ],
    "phosphorylation": [
        {
            "start_pos": 1078,
            "end_pos": 1078,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "15592455",
                    "url": "https://glygen.org/publication/PubMed/15592455"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "18083107",
                    "url": "https://glygen.org/publication/PubMed/18083107"
                },
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                }
            ],
            "site_lbl": "Tyr1078"
        },
        {
            "start_pos": 1092,
            "end_pos": 1092,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "15592455",
                    "url": "https://glygen.org/publication/PubMed/15592455"
                },
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                }
            ],
            "site_lbl": "Tyr1092"
        },
        {
            "start_pos": 1096,
            "end_pos": 1096,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "16878150",
                    "url": "https://glygen.org/publication/PubMed/16878150"
                },
                {
                    "database": "PubMed",
                    "id": "15592455",
                    "url": "https://glygen.org/publication/PubMed/15592455"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "18083107",
                    "url": "https://glygen.org/publication/PubMed/18083107"
                },
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                }
            ],
            "site_lbl": "Tyr1096"
        },
        {
            "start_pos": 1131,
            "end_pos": 1131,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "15592455",
                    "url": "https://glygen.org/publication/PubMed/15592455"
                },
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "site_lbl": "Tyr1131"
        },
        {
            "start_pos": 1278,
            "end_pos": 1278,
            "kinase_uniprot_canonical_ac": "Q9UM73-1",
            "kinase_gene_name": "ALK",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "15938644",
                    "url": "https://glygen.org/publication/PubMed/15938644"
                }
            ],
            "site_lbl": "Tyr1278"
        },
        {
            "start_pos": 1278,
            "end_pos": 1278,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "15938644",
                    "url": "https://glygen.org/publication/PubMed/15938644"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "15592455",
                    "url": "https://glygen.org/publication/PubMed/15592455"
                },
                {
                    "database": "PubMed",
                    "id": "18083107",
                    "url": "https://glygen.org/publication/PubMed/18083107"
                },
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                },
                {
                    "database": "PubMed",
                    "id": "22992069",
                    "url": "https://glygen.org/publication/PubMed/22992069"
                },
                {
                    "database": "PubMed",
                    "id": "28245558",
                    "url": "https://glygen.org/publication/PubMed/28245558"
                },
                {
                    "database": "PubMed",
                    "id": "30004444",
                    "url": "https://glygen.org/publication/PubMed/30004444"
                }
            ],
            "site_lbl": "Tyr1278"
        },
        {
            "start_pos": 1282,
            "end_pos": 1282,
            "kinase_uniprot_canonical_ac": "Q9UM73-1",
            "kinase_gene_name": "ALK",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "9174053",
                    "url": "https://glygen.org/publication/PubMed/9174053"
                },
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                }
            ],
            "site_lbl": "Tyr1282"
        },
        {
            "start_pos": 1282,
            "end_pos": 1282,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "15592455",
                    "url": "https://glygen.org/publication/PubMed/15592455"
                },
                {
                    "database": "PubMed",
                    "id": "15938644",
                    "url": "https://glygen.org/publication/PubMed/15938644"
                },
                {
                    "database": "PubMed",
                    "id": "18083107",
                    "url": "https://glygen.org/publication/PubMed/18083107"
                }
            ],
            "site_lbl": "Tyr1282"
        },
        {
            "start_pos": 1283,
            "end_pos": 1283,
            "kinase_uniprot_canonical_ac": "Q9UM73-1",
            "kinase_gene_name": "ALK",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "9174053",
                    "url": "https://glygen.org/publication/PubMed/9174053"
                },
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                },
                {
                    "database": "PubMed",
                    "id": "11110708",
                    "url": "https://glygen.org/publication/PubMed/11110708"
                },
                {
                    "database": "PubMed",
                    "id": "9819383",
                    "url": "https://glygen.org/publication/PubMed/9819383"
                }
            ],
            "site_lbl": "Tyr1283"
        },
        {
            "start_pos": 1283,
            "end_pos": 1283,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "IntAct",
                    "id": "Q9UM73",
                    "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9UM73*"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "17998938",
                    "url": "https://glygen.org/publication/PubMed/17998938"
                },
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                },
                {
                    "database": "PubMed",
                    "id": "18083107",
                    "url": "https://glygen.org/publication/PubMed/18083107"
                },
                {
                    "database": "PubMed",
                    "id": "9174053",
                    "url": "https://glygen.org/publication/PubMed/9174053"
                }
            ],
            "site_lbl": "Tyr1283"
        },
        {
            "start_pos": 1359,
            "end_pos": 1359,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "18083107",
                    "url": "https://glygen.org/publication/PubMed/18083107"
                },
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                }
            ],
            "site_lbl": "Tyr1359"
        },
        {
            "start_pos": 1507,
            "end_pos": 1507,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "17274988",
                    "url": "https://glygen.org/publication/PubMed/17274988"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "15592455",
                    "url": "https://glygen.org/publication/PubMed/15592455"
                },
                {
                    "database": "PubMed",
                    "id": "18083107",
                    "url": "https://glygen.org/publication/PubMed/18083107"
                },
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                },
                {
                    "database": "PubMed",
                    "id": "11110708",
                    "url": "https://glygen.org/publication/PubMed/11110708"
                },
                {
                    "database": "PubMed",
                    "id": "9819383",
                    "url": "https://glygen.org/publication/PubMed/9819383"
                },
                {
                    "database": "PubMed",
                    "id": "32344689",
                    "url": "https://glygen.org/publication/PubMed/32344689"
                }
            ],
            "site_lbl": "Tyr1507"
        },
        {
            "start_pos": 1584,
            "end_pos": 1584,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "15592455",
                    "url": "https://glygen.org/publication/PubMed/15592455"
                },
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                }
            ],
            "site_lbl": "Tyr1584"
        },
        {
            "start_pos": 1604,
            "end_pos": 1604,
            "kinase_uniprot_canonical_ac": "Q9UM73-1",
            "kinase_gene_name": "ALK",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "9819383",
                    "url": "https://glygen.org/publication/PubMed/9819383"
                }
            ],
            "site_lbl": "Tyr1604"
        },
        {
            "start_pos": 1604,
            "end_pos": 1604,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "15592455",
                    "url": "https://glygen.org/publication/PubMed/15592455"
                },
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "9819383",
                    "url": "https://glygen.org/publication/PubMed/9819383"
                },
                {
                    "database": "PubMed",
                    "id": "21297104",
                    "url": "https://glygen.org/publication/PubMed/21297104"
                },
                {
                    "database": "PubMed",
                    "id": "25727400",
                    "url": "https://glygen.org/publication/PubMed/25727400"
                },
                {
                    "database": "PubMed",
                    "id": "26418745",
                    "url": "https://glygen.org/publication/PubMed/26418745"
                },
                {
                    "database": "PubMed",
                    "id": "27888620",
                    "url": "https://glygen.org/publication/PubMed/27888620"
                },
                {
                    "database": "PubMed",
                    "id": "28030793",
                    "url": "https://glygen.org/publication/PubMed/28030793"
                },
                {
                    "database": "PubMed",
                    "id": "29515255",
                    "url": "https://glygen.org/publication/PubMed/29515255"
                },
                {
                    "database": "PubMed",
                    "id": "29755689",
                    "url": "https://glygen.org/publication/PubMed/29755689"
                },
                {
                    "database": "PubMed",
                    "id": "29907598",
                    "url": "https://glygen.org/publication/PubMed/29907598"
                },
                {
                    "database": "PubMed",
                    "id": "31334113",
                    "url": "https://glygen.org/publication/PubMed/31334113"
                },
                {
                    "database": "PubMed",
                    "id": "31852910",
                    "url": "https://glygen.org/publication/PubMed/31852910"
                },
                {
                    "database": "PubMed",
                    "id": "33649854",
                    "url": "https://glygen.org/publication/PubMed/33649854"
                }
            ],
            "site_lbl": "Tyr1604"
        },
        {
            "start_pos": 211,
            "end_pos": 211,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "16565220",
                    "url": "https://glygen.org/publication/PubMed/16565220"
                },
                {
                    "database": "phospho.ELM",
                    "id": "Q9UM73",
                    "url": "http://phospho.elm.eu.org/byAccession/Q9UM73.html"
                }
            ],
            "site_lbl": "Ser211"
        },
        {
            "start_pos": 47,
            "end_pos": 47,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "19664994",
                    "url": "https://glygen.org/publication/PubMed/19664994"
                }
            ],
            "site_lbl": "Ser47"
        },
        {
            "start_pos": 705,
            "end_pos": 705,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "14506160",
                    "url": "https://glygen.org/publication/PubMed/14506160"
                },
                {
                    "database": "PubMed",
                    "id": "27009859",
                    "url": "https://glygen.org/publication/PubMed/27009859"
                }
            ],
            "site_lbl": "Tyr705"
        }
    ],
    "glycation": [],
    "keywords": [
        "enzyme",
        "glycoprotein",
        "glycoprotein_predicted",
        "glycoprotein_reported_with_glycan"
    ],
    "publication": [
        {
            "title": "A receptor-like protein-tyrosine phosphatase PTPzeta/RPTPbeta binds a heparin-binding growth factor midkine. Involvement of arginine 78 of midkine in the high affinity binding to PTPzeta.",
            "journal": "The Journal of biological chemistry",
            "date": "1999",
            "authors": "Maeda N, Ichihara-Tanaka K, Kimura T, Kadomatsu K, Muramatsu T, Noda M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10212223",
                    "url": "https://glygen.org/publication/PubMed/10212223"
                }
            ]
        },
        {
            "title": "A new fusion gene TPM3-ALK in anaplastic large cell lymphoma created by a (1;2)(q25;p23) translocation.",
            "journal": "Blood",
            "date": "1999",
            "authors": "Lamant L, Dastugue N, Pulford K, Delsol G, Mariame B",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10216106",
                    "url": "https://glygen.org/publication/PubMed/10216106"
                }
            ]
        },
        {
            "title": "TRK-fused gene (TFG) is a new partner of ALK in anaplastic large cell lymphoma producing two structurally different TFG-ALK translocations.",
            "journal": "Blood",
            "date": "1999",
            "authors": "Hernandez L, Pinyol M, Hernandez S, Bea S, Pulford K, Rosenwald A, Lamant L, Falini B, Ott G, Mason DY, Delsol G, Campo E",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10556217",
                    "url": "https://glygen.org/publication/PubMed/10556217"
                }
            ]
        },
        {
            "title": "ATIC-ALK: A novel variant ALK gene fusion in anaplastic large cell lymphoma resulting from the recurrent cryptic chromosomal inversion, inv(2)(p23q35).",
            "journal": "The American journal of pathology",
            "date": "2000",
            "authors": "Colleoni GW, Bridge JA, Garicochea B, Liu J, Filippa DA, Ladanyi M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10702393",
                    "url": "https://glygen.org/publication/PubMed/10702393"
                }
            ]
        },
        {
            "title": "A new variant anaplastic lymphoma kinase (ALK)-fusion protein (ATIC-ALK) in a case of ALK-positive anaplastic large cell lymphoma.",
            "journal": "Cancer research",
            "date": "2000",
            "authors": "Trinei M, Lanfrancone L, Campo E, Pulford K, Mason DY, Pelicci PG, Falini B",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10706082",
                    "url": "https://glygen.org/publication/PubMed/10706082"
                }
            ]
        },
        {
            "title": "Inv(2)(p23q35) in anaplastic large-cell lymphoma induces constitutive anaplastic lymphoma kinase (ALK) tyrosine kinase activation by fusion to ATIC, an enzyme involved in purine nucleotide biosynthesis.",
            "journal": "Blood",
            "date": "2000",
            "authors": "Ma Z, Cools J, Marynen P, Cui X, Siebert R, Gesk S, Schlegelberger B, Peeters B, De Wolf-Peeters C, Wlodarska I, Morris SW",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10706887",
                    "url": "https://glygen.org/publication/PubMed/10706887"
                }
            ]
        },
        {
            "title": "TPM3-ALK and TPM4-ALK oncogenes in inflammatory myofibroblastic tumors.",
            "journal": "The American journal of pathology",
            "date": "2000",
            "authors": "Lawrence B, Perez-Atayde A, Hibbard MK, Rubin BP, Dal Cin P, Pinkus JL, Pinkus GS, Xiao S, Yi ES, Fletcher CD, Fletcher JA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10934142",
                    "url": "https://glygen.org/publication/PubMed/10934142"
                }
            ]
        },
        {
            "title": "Nucleophosmin-anaplastic lymphoma kinase associated with anaplastic large-cell lymphoma activates the phosphatidylinositol 3-kinase/Akt antiapoptotic signaling pathway.",
            "journal": "Blood",
            "date": "2000",
            "authors": "Bai RY, Ouyang T, Miething C, Morris SW, Peschel C, Duyster J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11110708",
                    "url": "https://glygen.org/publication/PubMed/11110708"
                }
            ]
        },
        {
            "title": "Activation of anaplastic lymphoma kinase receptor tyrosine kinase induces neuronal differentiation through the mitogen-activated protein kinase pathway.",
            "journal": "J. Biol. Chem.",
            "date": "2001",
            "authors": "Souttou B, Carvalho NB, Raulais D, Vigny M",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11121404",
                    "url": "https://glygen.org/publication/PubMed/11121404"
                }
            ]
        },
        {
            "title": "Identification of anaplastic lymphoma kinase as a receptor for the growth factor pleiotrophin.",
            "journal": "J. Biol. Chem.",
            "date": "2001",
            "authors": "Stoica GE, Kuo A, Aigner A, Sunitha I, Souttou B, Malerczyk C, Caughey DJ, Wen D, Karavanov A, Riegel AT, Wellstein A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11278720",
                    "url": "https://glygen.org/publication/PubMed/11278720"
                }
            ]
        },
        {
            "title": "Role of phosphatidylinositol 3-kinase-Akt pathway in nucleophosmin/anaplastic lymphoma kinase-mediated lymphomagenesis.",
            "journal": "Cancer research",
            "date": "2001",
            "authors": "Slupianek A, Nieborowska-Skorska M, Hoser G, Morrione A, Majewski M, Xue L, Morris SW, Wasik MA, Skorski T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11280786",
                    "url": "https://glygen.org/publication/PubMed/11280786"
                }
            ]
        },
        {
            "title": "Molecular characterization of a new ALK translocation involving moesin (MSN-ALK) in anaplastic large cell lymphoma.",
            "journal": "Laboratory investigation; a journal of technical methods and pathology",
            "date": "2001",
            "authors": "Tort F, Pinyol M, Pulford K, Roncador G, Hernandez L, Nayach I, Kluin-Nelemans HC, Kluin P, Touriol C, Delsol G, Mason D, Campo E",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11310834",
                    "url": "https://glygen.org/publication/PubMed/11310834"
                }
            ]
        },
        {
            "title": "The cytoplasmic truncated receptor tyrosine kinase ALK homodimer immortalizes and cooperates with ras in cellular transformation.",
            "journal": "FASEB J.",
            "date": "2001",
            "authors": "Cerni C., Duchek P., Fassl S., Hajek M., Krupitza G., Lamprecht A., Polgar D., Schmidt G., Simonitsch I., Skrzypek B.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11387242",
                    "url": "https://glygen.org/publication/PubMed/11387242"
                }
            ]
        },
        {
            "title": "Signaling via Shc family adapter proteins.",
            "journal": "Oncogene",
            "date": "2001",
            "authors": "Ravichandran KS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11607835",
                    "url": "https://glygen.org/publication/PubMed/11607835"
                }
            ]
        },
        {
            "title": "Multilevel dysregulation of STAT3 activation in anaplastic lymphoma kinase-positive T/null-cell lymphoma.",
            "journal": "Journal of immunology (Baltimore, Md. : 1950)",
            "date": "2002",
            "authors": "Zhang Q, Raghunath PN, Xue L, Majewski M, Carpentieri DF, Odum N, Morris S, Skorski T, Wasik MA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11751994",
                    "url": "https://glygen.org/publication/PubMed/11751994"
                }
            ]
        },
        {
            "title": "Pleiotrophin signaling through anaplastic lymphoma kinase is rate-limiting for glioblastoma growth.",
            "journal": "J. Biol. Chem.",
            "date": "2002",
            "authors": "Aigner A., McDonnell K., Powers C., Stoica G.E., Wellstein A.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11809760",
                    "url": "https://glygen.org/publication/PubMed/11809760"
                }
            ]
        },
        {
            "title": "Anaplastic lymphoma kinase (ALK) activates Stat3 and protects hematopoietic cells from cell death.",
            "journal": "Oncogene",
            "date": "2002",
            "authors": "Zamo A, Chiarle R, Piva R, Howes J, Fan Y, Chilosi M, Levy DE, Inghirami G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11850821",
                    "url": "https://glygen.org/publication/PubMed/11850821"
                }
            ]
        },
        {
            "title": "Diversity of genomic breakpoints in TFG-ALK translocations in anaplastic large cell lymphomas: identification of a new TFG-ALK(XL) chimeric gene with transforming activity.",
            "journal": "The American journal of pathology",
            "date": "2002",
            "authors": "Hernandez L, Bea S, Bellosillo B, Pinyol M, Falini B, Carbone A, Ott G, Rosenwald A, Fernandez A, Pulford K, Mason D, Morris SW, Santos E, Campo E",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11943732",
                    "url": "https://glygen.org/publication/PubMed/11943732"
                }
            ]
        },
        {
            "title": "Anti-apoptotic signaling of pleiotrophin through its receptor, anaplastic lymphoma kinase.",
            "journal": "J. Biol. Chem.",
            "date": "2002",
            "authors": "Bowden ET, Stoica GE, Wellstein A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12107166",
                    "url": "https://glygen.org/publication/PubMed/12107166"
                }
            ]
        },
        {
            "title": "Identification of novel fusion partners of ALK, the anaplastic lymphoma kinase, in anaplastic large-cell lymphoma and inflammatory myofibroblastic tumor.",
            "journal": "Genes Chromosomes Cancer",
            "date": "2002",
            "authors": "Cools J, Wlodarska I, Somers R, Mentens N, Pedeutour F, Maes B, De Wolf-Peeters C, Pauwels P, Hagemeijer A, Marynen P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12112524",
                    "url": "https://glygen.org/publication/PubMed/12112524"
                }
            ]
        },
        {
            "title": "Midkine binds to anaplastic lymphoma kinase (ALK) and acts as a growth factor for different cell types.",
            "journal": "J. Biol. Chem.",
            "date": "2002",
            "authors": "Stoica GE, Kuo A, Powers C, Bowden ET, Sale EB, Riegel AT, Wellstein A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12122009",
                    "url": "https://glygen.org/publication/PubMed/12122009"
                }
            ]
        },
        {
            "title": "Activation of anaplastic lymphoma kinase is responsible for hyperphosphorylation of ShcC in neuroblastoma cell lines.",
            "journal": "Oncogene",
            "date": "2002",
            "authors": "Miyake I, Hakomori Y, Shinohara A, Gamou T, Saito M, Iwamatsu A, Sakai R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12185581",
                    "url": "https://glygen.org/publication/PubMed/12185581"
                }
            ]
        },
        {
            "title": "NPM-ALK transgenic mice spontaneously develop T-cell lymphomas and plasma cell tumors.",
            "journal": "Blood",
            "date": "2003",
            "authors": "Chiarle R, Gong JZ, Guasparri I, Pesci A, Cai J, Liu J, Simmons WJ, Dhall G, Howes J, Piva R, Inghirami G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12424201",
                    "url": "https://glygen.org/publication/PubMed/12424201"
                }
            ]
        },
        {
            "title": "Identification and characterization of a nuclear interacting partner of anaplastic lymphoma kinase (NIPA).",
            "journal": "The Journal of biological chemistry",
            "date": "2003",
            "authors": "Ouyang T, Bai RY, Bassermann F, von Klitzing C, Klumpen S, Miething C, Morris SW, Peschel C, Duyster J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12748172",
                    "url": "https://glygen.org/publication/PubMed/12748172"
                }
            ]
        },
        {
            "title": "ALK activation by the CLTC-ALK fusion is a recurrent event in large B-cell lymphoma.",
            "journal": "Blood",
            "date": "2003",
            "authors": "De Paepe P, Baens M, van Krieken H, Verhasselt B, Stul M, Simons A, Poppe B, Laureys G, Brons P, Vandenberghe P, Speleman F, Praet M, De Wolf-Peeters C, Marynen P, Wlodarska I",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12750159",
                    "url": "https://glygen.org/publication/PubMed/12750159"
                }
            ]
        },
        {
            "title": "Non-muscle myosin heavy chain (MYH9): a new partner fused to ALK in anaplastic large cell lymphoma.",
            "journal": "Genes, chromosomes & cancer",
            "date": "2003",
            "authors": "Lamant L, Gascoyne RD, Duplantier MM, Armstrong F, Raghab A, Chhanabhai M, Rajcan-Separovic E, Raghab J, Delsol G, Espinos E",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12800156",
                    "url": "https://glygen.org/publication/PubMed/12800156"
                }
            ]
        },
        {
            "title": "ALK+, CD30-, CD20- large B-cell lymphoma containing anaplastic lymphoma kinase (ALK) fused to clathrin heavy chain gene (CLTC).",
            "journal": "Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc",
            "date": "2003",
            "authors": "Chikatsu N, Kojima H, Suzukawa K, Shinagawa A, Nagasawa T, Ozawa H, Yamashita Y, Mori N",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12920229",
                    "url": "https://glygen.org/publication/PubMed/12920229"
                }
            ]
        },
        {
            "title": "Inhibition of JAK3 induces apoptosis and decreases anaplastic lymphoma kinase activity in anaplastic large cell lymphoma.",
            "journal": "Oncogene",
            "date": "2003",
            "authors": "Amin HM, Medeiros LJ, Ma Y, Feretzaki M, Das P, Leventaki V, Rassidakis GZ, O'Connor SL, McDonnell TJ, Lai R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12934099",
                    "url": "https://glygen.org/publication/PubMed/12934099"
                }
            ]
        },
        {
            "title": "Differential expression and clinical significance of tyrosine-phosphorylated STAT3 in ALK+ and ALK- anaplastic large cell lymphoma.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2003",
            "authors": "Khoury JD, Medeiros LJ, Rassidakis GZ, Yared MA, Tsioli P, Leventaki V, Schmitt-Graeff A, Herling M, Amin HM, Lai R",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14506160",
                    "url": "https://glygen.org/publication/PubMed/14506160"
                }
            ]
        },
        {
            "title": "Nucleophosmin-anaplastic lymphoma kinase of anaplastic large-cell lymphoma recruits, activates, and uses pp60c-src to mediate its mitogenicity.",
            "journal": "Blood",
            "date": "2004",
            "authors": "Cussac D, Greenland C, Roche S, Bai RY, Duyster J, Morris SW, Delsol G, Allouche M, Payrastre B",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14563642",
                    "url": "https://glygen.org/publication/PubMed/14563642"
                }
            ]
        },
        {
            "title": "NPM-ALK fusion kinase of anaplastic large-cell lymphoma regulates survival and proliferative signaling through modulation of FOXO3a.",
            "journal": "Blood",
            "date": "2004",
            "authors": "Gu TL, Tothova Z, Scheijen B, Griffin JD, Gilliland DG, Sternberg DW",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14962911",
                    "url": "https://glygen.org/publication/PubMed/14962911"
                }
            ]
        },
        {
            "title": "Differential effects of X-ALK fusion proteins on proliferation, transformation, and invasion properties of NIH3T3 cells.",
            "journal": "Oncogene",
            "date": "2004",
            "authors": "Armstrong F, Duplantier MM, Trempat P, Hieblot C, Lamant L, Espinos E, Racaud-Sultan C, Allouche M, Campo E, Delsol G, Touriol C",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15208656",
                    "url": "https://glygen.org/publication/PubMed/15208656"
                }
            ]
        },
        {
            "title": "ALK receptor tyrosine kinase promotes cell growth and neurite outgrowth.",
            "journal": "J. Cell Sci.",
            "date": "2004",
            "authors": "Motegi A, Fujimoto J, Kotani M, Sakuraba H, Yamamoto T",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15226403",
                    "url": "https://glygen.org/publication/PubMed/15226403"
                }
            ]
        },
        {
            "title": "Methylation of SHP1 gene and loss of SHP1 protein expression are frequent in systemic anaplastic large cell lymphoma.",
            "journal": "Blood",
            "date": "2004",
            "authors": "Khoury JD, Rassidakis GZ, Medeiros LJ, Amin HM, Lai R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15317731",
                    "url": "https://glygen.org/publication/PubMed/15317731"
                }
            ]
        },
        {
            "title": "Inhibition of Akt increases p27Kip1 levels and induces cell cycle arrest in anaplastic large cell lymphoma.",
            "journal": "Blood",
            "date": "2005",
            "authors": "Rassidakis GZ, Feretzaki M, Atwell C, Grammatikakis I, Lin Q, Lai R, Claret FX, Medeiros LJ, Amin HM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15374880",
                    "url": "https://glygen.org/publication/PubMed/15374880"
                }
            ]
        },
        {
            "title": "NPM/ALK downregulates p27Kip1 in a PI-3K-dependent manner.",
            "journal": "Experimental hematology",
            "date": "2004",
            "authors": "Slupianek A, Skorski T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15588951",
                    "url": "https://glygen.org/publication/PubMed/15588951"
                }
            ]
        },
        {
            "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.",
            "journal": "Nature biotechnology",
            "date": "2005",
            "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A0K2YUJ3",
                    "url": "https://www.uniprot.org/uniprot/A0A0K2YUJ3"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A087WZL3",
                    "url": "https://www.uniprot.org/uniprot/A0A087WZL3"
                },
                {
                    "database": "UniProtKB",
                    "id": "H7BZ33",
                    "url": "https://www.uniprot.org/uniprot/H7BZ33"
                },
                {
                    "database": "UniProtKB",
                    "id": "E7EPW7",
                    "url": "https://www.uniprot.org/uniprot/E7EPW7"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15592455",
                    "url": "https://glygen.org/publication/PubMed/15592455"
                }
            ]
        },
        {
            "title": "Stat3 is required for ALK-mediated lymphomagenesis and provides a possible therapeutic target.",
            "journal": "Nature medicine",
            "date": "2005",
            "authors": "Chiarle R, Simmons WJ, Cai H, Dhall G, Zamo A, Raz R, Karras JG, Levy DE, Inghirami G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15895073",
                    "url": "https://glygen.org/publication/PubMed/15895073"
                }
            ]
        },
        {
            "title": "Differential induction of glioblastoma migration and growth by two forms of pleiotrophin.",
            "journal": "J. Biol. Chem.",
            "date": "2005",
            "authors": "Singh J., Nelson S.F., Cloughesy T.F., Dia E.Q., Jong K.A., Kim G.Y., Lu K.V., Mischel P.S., Wang M.Y., Yoshimoto K.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15908427",
                    "url": "https://glygen.org/publication/PubMed/15908427"
                }
            ]
        },
        {
            "title": "Unique substrate specificity of anaplastic lymphoma kinase (ALK): development of phosphoacceptor peptides for the assay of ALK activity.",
            "journal": "Biochemistry",
            "date": "2005",
            "authors": "Donella-Deana A, Marin O, Cesaro L, Gunby RH, Ferrarese A, Coluccia AM, Tartari CJ, Mologni L, Scapozza L, Gambacorti-Passerini C, Pinna LA",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15938644",
                    "url": "https://glygen.org/publication/PubMed/15938644"
                }
            ]
        },
        {
            "title": "NIPA defines an SCF-type mammalian E3 ligase that regulates mitotic entry.",
            "journal": "Cell",
            "date": "2005",
            "authors": "Bassermann F, von Klitzing C, Munch S, Bai RY, Kawaguchi H, Morris SW, Peschel C, Duyster J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16009132",
                    "url": "https://glygen.org/publication/PubMed/16009132"
                }
            ]
        },
        {
            "title": "Jak3 activation is significantly associated with ALK expression in anaplastic large cell lymphoma.",
            "journal": "Human pathology",
            "date": "2005",
            "authors": "Lai R, Rassidakis GZ, Lin Q, Atwell C, Medeiros LJ, Amin HM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16153455",
                    "url": "https://glygen.org/publication/PubMed/16153455"
                }
            ]
        },
        {
            "title": "Fusion of the SEC31L1 and ALK genes in an inflammatory myofibroblastic tumor.",
            "journal": "Int. J. Cancer",
            "date": "2006",
            "authors": "Panagopoulos I, Nilsson T, Domanski HA, Isaksson M, Lindblom P, Mertens F, Mandahl N",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16161041",
                    "url": "https://glygen.org/publication/PubMed/16161041"
                }
            ]
        },
        {
            "title": "Inhibition of ALK enzymatic activity in T-cell lymphoma cells induces apoptosis and suppresses proliferation and STAT3 phosphorylation independently of Jak3.",
            "journal": "Laboratory investigation; a journal of technical methods and pathology",
            "date": "2005",
            "authors": "Marzec M, Kasprzycka M, Ptasznik A, Wlodarski P, Zhang Q, Odum N, Wasik MA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16170336",
                    "url": "https://glygen.org/publication/PubMed/16170336"
                }
            ]
        },
        {
            "title": "Role of the subcellular localization of ALK tyrosine kinase domain in neuronal differentiation of PC12 cells.",
            "journal": "J. Cell Sci.",
            "date": "2005",
            "authors": "Gouzi JY, Moog-Lutz C, Vigny M, Brunet-de Carvalho N",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16317043",
                    "url": "https://glygen.org/publication/PubMed/16317043"
                }
            ]
        },
        {
            "title": "Phosphoproteome analysis of the human mitotic spindle.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2006",
            "authors": "Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16565220",
                    "url": "https://glygen.org/publication/PubMed/16565220"
                }
            ]
        },
        {
            "title": "Protein tyrosine phosphatase receptor type Z is inactivated by ligand-induced oligomerization.",
            "journal": "FEBS letters",
            "date": "2006",
            "authors": "Fukada M, Fujikawa A, Chow JP, Ikematsu S, Sakuma S, Noda M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16814777",
                    "url": "https://glygen.org/publication/PubMed/16814777"
                }
            ]
        },
        {
            "title": "Loss of SHP1 enhances JAK3/STAT3 signaling and decreases proteosome degradation of JAK3 and NPM-ALK in ALK+ anaplastic large-cell lymphoma.",
            "journal": "Blood",
            "date": "2006",
            "authors": "Han Y, Amin HM, Franko B, Frantz C, Shi X, Lai R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16825495",
                    "url": "https://glygen.org/publication/PubMed/16825495"
                }
            ]
        },
        {
            "title": "Restoration of shp1 expression by 5-AZA-2'-deoxycytidine is associated with downregulation of JAK3/STAT3 signaling in ALK-positive anaplastic large cell lymphoma.",
            "journal": "Leukemia",
            "date": "2006",
            "authors": "Han Y, Amin HM, Frantz C, Franko B, Lee J, Lin Q, Lai R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16871283",
                    "url": "https://glygen.org/publication/PubMed/16871283"
                }
            ]
        },
        {
            "title": "Recruitment of insulin receptor substrate-1 and activation of NF-kappaB essential for midkine growth signaling through anaplastic lymphoma kinase.",
            "journal": "Oncogene",
            "date": "2007",
            "authors": "Kuo AH, Stoica GE, Riegel AT, Wellstein A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16878150",
                    "url": "https://glygen.org/publication/PubMed/16878150"
                }
            ]
        },
        {
            "title": "JSI-124 (cucurbitacin I) inhibits Janus kinase-3/signal transducer and activator of transcription-3 signalling, downregulates nucleophosmin-anaplastic lymphoma kinase (ALK), and induces apoptosis in ALK-positive anaplastic large cell lymphoma cells.",
            "journal": "British journal of haematology",
            "date": "2006",
            "authors": "Shi X, Franko B, Frantz C, Amin HM, Lai R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16939498",
                    "url": "https://glygen.org/publication/PubMed/16939498"
                }
            ]
        },
        {
            "title": "Identification of multiple SNT-binding sites on NPM-ALK oncoprotein and their involvement in cell transformation.",
            "journal": "Oncogene",
            "date": "2007",
            "authors": "Chikamori M, Fujimoto J, Tokai-Nishizumi N, Yamamoto T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17086210",
                    "url": "https://glygen.org/publication/PubMed/17086210"
                }
            ]
        },
        {
            "title": "The NPM-ALK tyrosine kinase mimics TCR signalling pathways, inducing NFAT and AP-1 by RAS-dependent mechanisms.",
            "journal": "Cellular signalling",
            "date": "2007",
            "authors": "Turner SD, Yeung D, Hadfield K, Cook SJ, Alexander DR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17110082",
                    "url": "https://glygen.org/publication/PubMed/17110082"
                }
            ]
        },
        {
            "title": "Functional validation of the anaplastic lymphoma kinase signature identifies CEBPB and BCL2A1 as critical target genes.",
            "journal": "The Journal of clinical investigation",
            "date": "2006",
            "authors": "Piva R, Pellegrino E, Mattioli M, Agnelli L, Lombardi L, Boccalatte F, Costa G, Ruggeri BA, Cheng M, Chiarle R, Palestro G, Neri A, Inghirami G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17111047",
                    "url": "https://glygen.org/publication/PubMed/17111047"
                }
            ]
        },
        {
            "title": "Identification of NVP-TAE684, a potent, selective, and efficacious inhibitor of NPM-ALK.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2007",
            "authors": "Galkin AV, Melnick JS, Kim S, Hood TL, Li N, Li L, Xia G, Steensma R, Chopiuk G, Jiang J, Wan Y, Ding P, Liu Y, Sun F, Schultz PG, Gray NS, Warmuth M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17185414",
                    "url": "https://glygen.org/publication/PubMed/17185414"
                }
            ]
        },
        {
            "title": "ALK activation induces Shc and FRS2 recruitment: Signaling and phenotypic outcomes in PC12 cells differentiation.",
            "journal": "FEBS letters",
            "date": "2007",
            "authors": "Degoutin J, Vigny M, Gouzi JY",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17274988",
                    "url": "https://glygen.org/publication/PubMed/17274988"
                }
            ]
        },
        {
            "title": "Patterns of somatic mutation in human cancer genomes.",
            "journal": "Nature",
            "date": "2007",
            "authors": "Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17344846",
                    "url": "https://glygen.org/publication/PubMed/17344846"
                }
            ]
        },
        {
            "title": "Oncogenic tyrosine kinase NPM/ALK induces activation of the rapamycin-sensitive mTOR signaling pathway.",
            "journal": "Oncogene",
            "date": "2007",
            "authors": "Marzec M, Kasprzycka M, Liu X, El-Salem M, Halasa K, Raghunath PN, Bucki R, Wlodarski P, Wasik MA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17353907",
                    "url": "https://glygen.org/publication/PubMed/17353907"
                }
            ]
        },
        {
            "title": "NPM-ALK oncogenic kinase promotes cell-cycle progression through activation of JNK/cJun signaling in anaplastic large-cell lymphoma.",
            "journal": "Blood",
            "date": "2007",
            "authors": "Leventaki V, Drakos E, Medeiros LJ, Lim MS, Elenitoba-Johnson KS, Claret FX, Rassidakis GZ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17416736",
                    "url": "https://glygen.org/publication/PubMed/17416736"
                }
            ]
        },
        {
            "title": "The tyrosine phosphatase Shp2 interacts with NPM-ALK and regulates anaplastic lymphoma cell growth and migration.",
            "journal": "Cancer research",
            "date": "2007",
            "authors": "Voena C, Conte C, Ambrogio C, Boeri Erba E, Boccalatte F, Mohammed S, Jensen ON, Palestro G, Inghirami G, Chiarle R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17483340",
                    "url": "https://glygen.org/publication/PubMed/17483340"
                }
            ]
        },
        {
            "title": "Identification of the transforming EML4-ALK fusion gene in non-small-cell lung cancer.",
            "journal": "Nature",
            "date": "2007",
            "authors": "Soda M, Choi YL, Enomoto M, Takada S, Yamashita Y, Ishikawa S, Fujiwara S, Watanabe H, Kurashina K, Hatanaka H, Bando M, Ohno S, Ishikawa Y, Aburatani H, Niki T, Sohara Y, Sugiyama Y, Mano H",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17625570",
                    "url": "https://glygen.org/publication/PubMed/17625570"
                }
            ]
        },
        {
            "title": "Anaplastic lymphoma kinase is activated through the pleiotrophin/receptor protein-tyrosine phosphatase beta/zeta signaling pathway: an alternative mechanism of receptor tyrosine kinase activation.",
            "journal": "J. Biol. Chem.",
            "date": "2007",
            "authors": "Perez-Pinera P, Zhang W, Chang Y, Vega JA, Deuel TF",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17681947",
                    "url": "https://glygen.org/publication/PubMed/17681947"
                }
            ]
        },
        {
            "title": "The oncoprotein NPM-ALK of anaplastic large-cell lymphoma induces JUNB transcription via ERK1/2 and JunB translation via mTOR signaling.",
            "journal": "Blood",
            "date": "2007",
            "authors": "Staber PB, Vesely P, Haq N, Ott RG, Funato K, Bambach I, Fuchs C, Schauer S, Linkesch W, Hrzenjak A, Dirks WG, Sexl V, Bergler H, Kadin ME, Sternberg DW, Kenner L, Hoefler G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17690253",
                    "url": "https://glygen.org/publication/PubMed/17690253"
                }
            ]
        },
        {
            "title": "STAT5A is epigenetically silenced by the tyrosine kinase NPM1-ALK and acts as a tumor suppressor by reciprocally inhibiting NPM1-ALK expression.",
            "journal": "Nature medicine",
            "date": "2007",
            "authors": "Zhang Q, Wang HY, Liu X, Wasik MA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17922009",
                    "url": "https://glygen.org/publication/PubMed/17922009"
                }
            ]
        },
        {
            "title": "Activation of Rac1 and the exchange factor Vav3 are involved in NPM-ALK signaling in anaplastic large cell lymphomas.",
            "journal": "Oncogene",
            "date": "2008",
            "authors": "Colomba A, Courilleau D, Ramel D, Billadeau DD, Espinos E, Delsol G, Payrastre B, Gaits-Iacovoni F",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17998938",
                    "url": "https://glygen.org/publication/PubMed/17998938"
                }
            ]
        },
        {
            "title": "The structure and functions of NPM1/Nucleophsmin/B23, a multifunctional nucleolar acidic protein.",
            "journal": "Journal of biochemistry",
            "date": "2008",
            "authors": "Okuwaki M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18024471",
                    "url": "https://glygen.org/publication/PubMed/18024471"
                }
            ]
        },
        {
            "title": "Characterization of some molecular mechanisms governing autoactivation of the catalytic domain of the anaplastic lymphoma kinase.",
            "journal": "The Journal of biological chemistry",
            "date": "2008",
            "authors": "Tartari CJ, Gunby RH, Coluccia AM, Sottocornola R, Cimbro B, Scapozza L, Donella-Deana A, Pinna LA, Gambacorti-Passerini C",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18070884",
                    "url": "https://glygen.org/publication/PubMed/18070884"
                }
            ]
        },
        {
            "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.",
            "journal": "Cell",
            "date": "2007",
            "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18083107",
                    "url": "https://glygen.org/publication/PubMed/18083107"
                }
            ]
        },
        {
            "title": "The anaplastic lymphoma kinase in the pathogenesis of cancer.",
            "journal": "Nature reviews. Cancer",
            "date": "2008",
            "authors": "Chiarle R, Voena C, Ambrogio C, Piva R, Inghirami G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18097461",
                    "url": "https://glygen.org/publication/PubMed/18097461"
                }
            ]
        },
        {
            "title": "Regulation of growth factor signaling by FRS2 family docking/scaffold adaptor proteins.",
            "journal": "Cancer science",
            "date": "2008",
            "authors": "Gotoh N",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18452557",
                    "url": "https://glygen.org/publication/PubMed/18452557"
                }
            ]
        },
        {
            "title": "Identification of novel isoforms of the EML4-ALK transforming gene in non-small cell lung cancer.",
            "journal": "Cancer research",
            "date": "2008",
            "authors": "Choi YL, Takeuchi K, Soda M, Inamura K, Togashi Y, Hatano S, Enomoto M, Hamada T, Haruta H, Watanabe H, Kurashina K, Hatanaka H, Ueno T, Takada S, Yamashita Y, Sugiyama Y, Ishikawa Y, Mano H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18593892",
                    "url": "https://glygen.org/publication/PubMed/18593892"
                }
            ]
        },
        {
            "title": "EML4-ALK fusion gene and efficacy of an ALK kinase inhibitor in lung cancer.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2008",
            "authors": "Koivunen JP, Mermel C, Zejnullahu K, Murphy C, Lifshits E, Holmes AJ, Choi HG, Kim J, Chiang D, Thomas R, Lee J, Richards WG, Sugarbaker DJ, Ducko C, Lindeman N, Marcoux JP, Engelman JA, Gray NS, Lee C, Meyerson M, Janne PA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18594010",
                    "url": "https://glygen.org/publication/PubMed/18594010"
                }
            ]
        },
        {
            "title": "An inflammatory myofibroblastic tumor in liver with ALK and RANBP2 gene rearrangement: combination of distinct morphologic, immunohistochemical, and genetic features.",
            "journal": "Human pathology",
            "date": "2008",
            "authors": "Chen ST, Lee JC",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18701132",
                    "url": "https://glygen.org/publication/PubMed/18701132"
                }
            ]
        },
        {
            "title": "Identification of ALK as a major familial neuroblastoma predisposition gene.",
            "journal": "Nature",
            "date": "2008",
            "authors": "Mosse YP, Laudenslager M, Longo L, Cole KA, Wood A, Attiyeh EF, Laquaglia MJ, Sennett R, Lynch JE, Perri P, Laureys G, Speleman F, Kim C, Hou C, Hakonarson H, Torkamani A, Schork NJ, Brodeur GM, Tonini GP, Rappaport E, Devoto M, Maris JM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18724359",
                    "url": "https://glygen.org/publication/PubMed/18724359"
                }
            ]
        },
        {
            "title": "Somatic and germline activating mutations of the ALK kinase receptor in neuroblastoma.",
            "journal": "Nature",
            "date": "2008",
            "authors": "Janoueix-Lerosey I, Lequin D, Brugieres L, Ribeiro A, de Pontual L, Combaret V, Raynal V, Puisieux A, Schleiermacher G, Pierron G, Valteau-Couanet D, Frebourg T, Michon J, Lyonnet S, Amiel J, Delattre O",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18923523",
                    "url": "https://glygen.org/publication/PubMed/18923523"
                }
            ]
        },
        {
            "title": "Oncogenic mutations of ALK kinase in neuroblastoma.",
            "journal": "Nature",
            "date": "2008",
            "authors": "Chen Y, Takita J, Choi YL, Kato M, Ohira M, Sanada M, Wang L, Soda M, Kikuchi A, Igarashi T, Nakagawara A, Hayashi Y, Mano H, Ogawa S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18923524",
                    "url": "https://glygen.org/publication/PubMed/18923524"
                }
            ]
        },
        {
            "title": "Activating mutations in ALK provide a therapeutic target in neuroblastoma.",
            "journal": "Nature",
            "date": "2008",
            "authors": "George RE, Sanda T, Hanna M, Frohling S, Luther W 2nd, Zhang J, Ahn Y, Zhou W, London WB, McGrady P, Xue L, Zozulya S, Gregor VE, Webb TR, Gray NS, Gilliland DG, Diller L, Greulich H, Morris SW, Meyerson M, Look AT",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18923525",
                    "url": "https://glygen.org/publication/PubMed/18923525"
                }
            ]
        },
        {
            "title": "High incidence of DNA mutations and gene amplifications of the ALK gene in advanced sporadic neuroblastoma tumours.",
            "journal": "The Biochemical journal",
            "date": "2008",
            "authors": "Caren H, Abel F, Kogner P, Martinsson T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18990089",
                    "url": "https://glygen.org/publication/PubMed/18990089"
                }
            ]
        },
        {
            "title": "The FRS2 family of docking/scaffolding adaptor proteins as therapeutic targets of cancer treatment.",
            "journal": "Expert opinion on therapeutic targets",
            "date": "2009",
            "authors": "Sato T, Gotoh N",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19456272",
                    "url": "https://glygen.org/publication/PubMed/19456272"
                }
            ]
        },
        {
            "title": "Anaplastic lymphoma kinase: signalling in development and disease.",
            "journal": "Biochem. J.",
            "date": "2009",
            "authors": "Palmer RH, Vernersson E, Grabbe C, Hallberg B",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19459784",
                    "url": "https://glygen.org/publication/PubMed/19459784"
                }
            ]
        },
        {
            "title": "Phosphoproteomic analysis of human embryonic stem cells.",
            "journal": "Cell stem cell",
            "date": "2009",
            "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19664994",
                    "url": "https://glygen.org/publication/PubMed/19664994"
                }
            ]
        },
        {
            "title": "Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2.",
            "journal": "J. Struct. Funct. Genomics",
            "date": "2010",
            "authors": "Koshiba S, Li H, Motoda Y, Tomizawa T, Kasai T, Tochio N, Yabuki T, Harada T, Watanabe S, Tanaka A, Shirouzu M, Kigawa T, Yamamoto T, Yokoyama S",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20454865",
                    "url": "https://glygen.org/publication/PubMed/20454865"
                }
            ]
        },
        {
            "title": "Crystal structure of the ALK (anaplastic lymphoma kinase) catalytic domain.",
            "journal": "Biochem. J.",
            "date": "2010",
            "authors": "Lee CC, Jia Y, Li N, Sun X, Ng K, Ambing E, Gao MY, Hua S, Chen C, Kim S, Michellys PY, Lesley SA, Harris JL, Spraggon G",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20632993",
                    "url": "https://glygen.org/publication/PubMed/20632993"
                }
            ]
        },
        {
            "title": "Crystal structures of anaplastic lymphoma kinase in complex with ATP competitive inhibitors.",
            "journal": "Biochemistry",
            "date": "2010",
            "authors": "Bossi RT, Saccardo MB, Ardini E, Menichincheri M, Rusconi L, Magnaghi P, Orsini P, Avanzi N, Borgia AL, Nesi M, Bandiera T, Fogliatto G, Bertrand JA",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20695522",
                    "url": "https://glygen.org/publication/PubMed/20695522"
                }
            ]
        },
        {
            "title": "Meta-analysis of neuroblastomas reveals a skewed ALK mutation spectrum in tumors with MYCN amplification.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2010",
            "authors": "De Brouwer S, De Preter K, Kumps C, Zabrocki P, Porcu M, Westerhout EM, Lakeman A, Vandesompele J, Hoebeeck J, Van Maerken T, De Paepe A, Laureys G, Schulte JH, Schramm A, Van Den Broecke C, Vermeulen J, Van Roy N, Beiske K, Renard M, Noguera R, Delattre O, Janoueix-Lerosey I, Kogner P, Martinsson T, Nakagawara A, Ohira M, Caron H, Eggert A, Cools J, Versteeg R, Speleman F",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20719933",
                    "url": "https://glygen.org/publication/PubMed/20719933"
                }
            ]
        },
        {
            "title": "EML4-ALK mutations in lung cancer that confer resistance to ALK inhibitors.",
            "journal": "The New England journal of medicine",
            "date": "2010",
            "authors": "Choi YL, Soda M, Yamashita Y, Ueno T, Takashima J, Nakajima T, Yatabe Y, Takeuchi K, Hamada T, Haruta H, Ishikawa Y, Kimura H, Mitsudomi T, Tanio Y, Mano H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717326",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717326"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20979473",
                    "url": "https://glygen.org/publication/PubMed/20979473"
                }
            ]
        },
        {
            "title": "The neuroblastoma-associated F1174L ALK mutation causes resistance to an ALK kinase inhibitor in ALK-translocated cancers.",
            "journal": "Cancer research",
            "date": "2010",
            "authors": "Sasaki T, Okuda K, Zheng W, Butrynski J, Capelletti M, Wang L, Gray NS, Wilner K, Christensen JG, Demetri G, Shapiro GI, Rodig SJ, Eck MJ, Janne PA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717326",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717326"
                },
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21030459",
                    "url": "https://glygen.org/publication/PubMed/21030459"
                }
            ]
        },
        {
            "title": "Identification of a novel fusion, SQSTM1-ALK, in ALK-positive large B-cell lymphoma.",
            "journal": "Haematologica",
            "date": "2011",
            "authors": "Takeuchi K, Soda M, Togashi Y, Ota Y, Sekiguchi Y, Hatano S, Asaka R, Noguchi M, Mano H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21134980",
                    "url": "https://glygen.org/publication/PubMed/21134980"
                }
            ]
        },
        {
            "title": "Crizotinib, a small-molecule dual inhibitor of the c-Met and ALK receptor tyrosine kinases.",
            "journal": "Current opinion in investigational drugs (London, England : 2000)",
            "date": "2010",
            "authors": "Rodig SJ, Shapiro GI",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21154129",
                    "url": "https://glygen.org/publication/PubMed/21154129"
                }
            ]
        },
        {
            "title": "Epithelioid inflammatory myofibroblastic sarcoma: An aggressive intra-abdominal variant of inflammatory myofibroblastic tumor with nuclear membrane or perinuclear ALK.",
            "journal": "The American journal of surgical pathology",
            "date": "2011",
            "authors": "Marino-Enriquez A, Wang WL, Roy A, Lopez-Terrada D, Lazar AJ, Fletcher CD, Coffin CM, Hornick JL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21164297",
                    "url": "https://glygen.org/publication/PubMed/21164297"
                }
            ]
        },
        {
            "title": "ALK rearrangement in sickle cell trait-associated renal medullary carcinoma.",
            "journal": "Genes, chromosomes & cancer",
            "date": "2011",
            "authors": "Marino-Enriquez A, Ou WB, Weldon CB, Fletcher JA, Perez-Atayde AR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21213368",
                    "url": "https://glygen.org/publication/PubMed/21213368"
                }
            ]
        },
        {
            "title": "The constitutive activity of the ALK mutated at positions F1174 or R1275 impairs receptor trafficking.",
            "journal": "Oncogene",
            "date": "2011",
            "authors": "Mazot P, Cazes A, Boutterin MC, Figueiredo A, Raynal V, Combaret V, Hallberg B, Palmer RH, Delattre O, Janoueix-Lerosey I, Vigny M",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21242967",
                    "url": "https://glygen.org/publication/PubMed/21242967"
                }
            ]
        },
        {
            "title": "Comparison of 2 cell-based phosphoprotein assays to support screening and development of an ALK inhibitor.",
            "journal": "Journal of biomolecular screening",
            "date": "2011",
            "authors": "Drew AE, Al-Assaad S, Yu V, Andrews P, Merkel P, Szilvassy S, Emkey R, Lewis R, Brake RL",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21297104",
                    "url": "https://glygen.org/publication/PubMed/21297104"
                }
            ]
        },
        {
            "title": "Crizotinib in anaplastic large-cell lymphoma.",
            "journal": "The New England journal of medicine",
            "date": "2011",
            "authors": "Gambacorti-Passerini C, Messa C, Pogliani EM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21345110",
                    "url": "https://glygen.org/publication/PubMed/21345110"
                }
            ]
        },
        {
            "title": "Role of ERK-BIM and STAT3-survivin signaling pathways in ALK inhibitor-induced apoptosis in EML4-ALK-positive lung cancer.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2011",
            "authors": "Takezawa K, Okamoto I, Nishio K, Janne PA, Nakagawa K",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21415216",
                    "url": "https://glygen.org/publication/PubMed/21415216"
                }
            ]
        },
        {
            "title": "Inhibition of anaplastic lymphoma kinase (ALK) activity provides a therapeutic approach for CLTC-ALK-positive human diffuse large B cell lymphomas.",
            "journal": "PloS one",
            "date": "2011",
            "authors": "Cerchietti L, Damm-Welk C, Vater I, Klapper W, Harder L, Pott C, Yang SN, Reiter A, Siebert R, Melnick A, Woessmann W",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21494621",
                    "url": "https://glygen.org/publication/PubMed/21494621"
                }
            ]
        },
        {
            "title": "Therapeutic strategies to overcome crizotinib resistance in non-small cell lung cancers harboring the fusion oncogene EML4-ALK.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2011",
            "authors": "Katayama R, Khan TM, Benes C, Lifshits E, Ebi H, Rivera VM, Shakespeare WC, Iafrate AJ, Engelman JA, Shaw AT",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21502504",
                    "url": "https://glygen.org/publication/PubMed/21502504"
                }
            ]
        },
        {
            "title": "CH5424802, a selective ALK inhibitor capable of blocking the resistant gatekeeper mutant.",
            "journal": "Cancer Cell",
            "date": "2011",
            "authors": "Kobayashi T., Kodama T., Aoki Y., Sakamoto H., Ishii N., Fukami T.A., Hiroshima S., Oikawa N., Tsukaguchi T., Tsukuda T.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21575866",
                    "url": "https://glygen.org/publication/PubMed/21575866"
                }
            ]
        },
        {
            "title": "Anaplastic thyroid cancers harbor novel oncogenic mutations of the ALK gene.",
            "journal": "Cancer research",
            "date": "2011",
            "authors": "Murugan AK, Xing M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                },
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21596819",
                    "url": "https://glygen.org/publication/PubMed/21596819"
                }
            ]
        },
        {
            "title": "A novel KIF5B-ALK variant in nonsmall cell lung cancer.",
            "journal": "Cancer",
            "date": "2011",
            "authors": "Wong DW, Leung EL, Wong SK, Tin VP, Sihoe AD, Cheng LC, Au JS, Chung LP, Wong MP",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21656749",
                    "url": "https://glygen.org/publication/PubMed/21656749"
                }
            ]
        },
        {
            "title": "A novel ALK secondary mutation and EGFR signaling cause resistance to ALK kinase inhibitors.",
            "journal": "Cancer research",
            "date": "2011",
            "authors": "Sasaki T, Koivunen J, Ogino A, Yanagita M, Nikiforow S, Zheng W, Lathan C, Marcoux JP, Du J, Okuda K, Capelletti M, Shimamura T, Ercan D, Stumpfova M, Xiao Y, Weremowicz S, Butaney M, Heon S, Wilner K, Christensen JG, Eck MJ, Wong KK, Lindeman N, Gray NS, Rodig SJ, Janne PA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717301",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717301"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21791641",
                    "url": "https://glygen.org/publication/PubMed/21791641"
                }
            ]
        },
        {
            "title": "The neuroblastoma ALK(I1250T) mutation is a kinase-dead RTK in vitro and in vivo.",
            "journal": "Translational oncology",
            "date": "2011",
            "authors": "Schonherr C, Ruuth K, Eriksson T, Yamazaki Y, Ottmann C, Combaret V, Vigny M, Kamaraj S, Palmer RH, Hallberg B",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21804922",
                    "url": "https://glygen.org/publication/PubMed/21804922"
                }
            ]
        },
        {
            "title": "Activating ALK mutations found in neuroblastoma are inhibited by Crizotinib and NVP-TAE684.",
            "journal": "The Biochemical journal",
            "date": "2011",
            "authors": "Schonherr C, Ruuth K, Yamazaki Y, Eriksson T, Christensen J, Palmer RH, Hallberg B",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21838707",
                    "url": "https://glygen.org/publication/PubMed/21838707"
                }
            ]
        },
        {
            "title": "Identification of oncogenic point mutations and hyperphosphorylation of anaplastic lymphoma kinase in lung cancer.",
            "journal": "Neoplasia (New York, N.Y.)",
            "date": "2011",
            "authors": "Wang YW, Tu PH, Lin KT, Lin SC, Ko JY, Jou YS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21847362",
                    "url": "https://glygen.org/publication/PubMed/21847362"
                }
            ]
        },
        {
            "title": "ALK mutations conferring differential resistance to structurally diverse ALK inhibitors.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2011",
            "authors": "Heuckmann JM, Holzel M, Sos ML, Heynck S, Balke-Want H, Koker M, Peifer M, Weiss J, Lovly CM, Grutter C, Rauh D, Pao W, Thomas RK",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21948233",
                    "url": "https://glygen.org/publication/PubMed/21948233"
                }
            ]
        },
        {
            "title": "Copy number status and mutation analyses of anaplastic lymphoma kinase (ALK) gene in 90 sporadic neuroblastoma tumors.",
            "journal": "Cancer letters",
            "date": "2012",
            "authors": "Bagci O, Tumer S, Olgun N, Altungoz O",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22085494",
                    "url": "https://glygen.org/publication/PubMed/22085494"
                }
            ]
        },
        {
            "title": "Crizotinib: a novel and first-in-class multitargeted tyrosine kinase inhibitor for the treatment of anaplastic lymphoma kinase rearranged non-small cell lung cancer and beyond.",
            "journal": "Drug design, development and therapy",
            "date": "2011",
            "authors": "Ou SH",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22162641",
                    "url": "https://glygen.org/publication/PubMed/22162641"
                }
            ]
        },
        {
            "title": "Mechanisms of resistance to crizotinib in patients with ALK gene rearranged non-small cell lung cancer.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2012",
            "authors": "Doebele RC, Pilling AB, Aisner DL, Kutateladze TG, Le AT, Weickhardt AJ, Kondo KL, Linderman DJ, Heasley LE, Franklin WA, Varella-Garcia M, Camidge DR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717326",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717326"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22235099",
                    "url": "https://glygen.org/publication/PubMed/22235099"
                }
            ]
        },
        {
            "title": "Aberrant activation of ALK kinase by a novel truncated form ALK protein in neuroblastoma.",
            "journal": "Oncogene",
            "date": "2012",
            "authors": "Okubo J, Takita J, Chen Y, Oki K, Nishimura R, Kato M, Sanada M, Hiwatari M, Hayashi Y, Igarashi T, Ogawa S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22249260",
                    "url": "https://glygen.org/publication/PubMed/22249260"
                }
            ]
        },
        {
            "title": "Mechanisms of acquired crizotinib resistance in ALK-rearranged lung Cancers.",
            "journal": "Science translational medicine",
            "date": "2012",
            "authors": "Katayama R, Shaw AT, Khan TM, Mino-Kenudson M, Solomon BJ, Halmos B, Jessop NA, Wain JC, Yeo AT, Benes C, Drew L, Saeh JC, Crosby K, Sequist LV, Iafrate AJ, Engelman JA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717326",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717326"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22277784",
                    "url": "https://glygen.org/publication/PubMed/22277784"
                }
            ]
        },
        {
            "title": "Anaplastic Lymphoma Kinase (ALK) regulates initiation of transcription of MYCN in neuroblastoma cells.",
            "journal": "Oncogene",
            "date": "2012",
            "authors": "Schonherr C, Ruuth K, Kamaraj S, Wang CL, Yang HL, Combaret V, Djos A, Martinsson T, Christensen JG, Palmer RH, Hallberg B",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22286764",
                    "url": "https://glygen.org/publication/PubMed/22286764"
                }
            ]
        },
        {
            "title": "Identification of new ALK and RET gene fusions from colorectal and lung cancer biopsies.",
            "journal": "Nat. Med.",
            "date": "2012",
            "authors": "Lipson D, Capelletti M, Yelensky R, Otto G, Parker A, Jarosz M, Curran JA, Balasubramanian S, Bloom T, Brennan KW, Donahue A, Downing SR, Frampton GM, Garcia L, Juhn F, Mitchell KC, White E, White J, Zwirko Z, Peretz T, Nechushtan H, Soussan-Gutman L, Kim J, Sasaki H, Kim HR, Park SI, Ercan D, Sheehan CE, Ross JS, Cronin MT, Janne PA, Stephens PJ",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22327622",
                    "url": "https://glygen.org/publication/PubMed/22327622"
                }
            ]
        },
        {
            "title": "KLC1-ALK: a novel fusion in lung cancer identified using a formalin-fixed paraffin-embedded tissue only.",
            "journal": "PloS one",
            "date": "2012",
            "authors": "Togashi Y, Soda M, Sakata S, Sugawara E, Hatano S, Asaka R, Nakajima T, Mano H, Takeuchi K",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22347464",
                    "url": "https://glygen.org/publication/PubMed/22347464"
                }
            ]
        },
        {
            "title": "Activated ALK collaborates with MYCN in neuroblastoma pathogenesis.",
            "journal": "Cancer cell",
            "date": "2012",
            "authors": "Zhu S, Lee JS, Guo F, Shin J, Perez-Atayde AR, Kutok JL, Rodig SJ, Neuberg DS, Helman D, Feng H, Stewart RA, Wang W, George RE, Kanki JP, Look AT",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22439933",
                    "url": "https://glygen.org/publication/PubMed/22439933"
                }
            ]
        },
        {
            "title": "Identification of anaplastic lymphoma kinase as a potential therapeutic target in ovarian cancer.",
            "journal": "Cancer research",
            "date": "2012",
            "authors": "Ren H, Tan ZP, Zhu X, Crosby K, Haack H, Ren JM, Beausoleil S, Moritz A, Innocenti G, Rush J, Zhang Y, Zhou XM, Gu TL, Yang YF, Comb MJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22570254",
                    "url": "https://glygen.org/publication/PubMed/22570254"
                }
            ]
        },
        {
            "title": "Development of treatment strategies for advanced neuroblastoma.",
            "journal": "International journal of clinical oncology",
            "date": "2012",
            "authors": "Hara J",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22588779",
                    "url": "https://glygen.org/publication/PubMed/22588779"
                }
            ]
        },
        {
            "title": "Fusion of dynactin 1 to anaplastic lymphoma kinase in inflammatory myofibroblastic tumor.",
            "journal": "Human pathology",
            "date": "2012",
            "authors": "Wang X, Krishnan C, Nguyen EP, Meyer KJ, Oliveira JL, Yang P, Yi ES, Erickson-Johnson MR, Yaszemski MJ, Maran A, Oliveira AM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22658521",
                    "url": "https://glygen.org/publication/PubMed/22658521"
                }
            ]
        },
        {
            "title": "The R1275Q neuroblastoma mutant and certain ATP-competitive inhibitors stabilize alternative activation loop conformations of anaplastic lymphoma kinase.",
            "journal": "J. Biol. Chem.",
            "date": "2012",
            "authors": "Epstein LF, Chen H, Emkey R, Whittington DA",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22932897",
                    "url": "https://glygen.org/publication/PubMed/22932897"
                }
            ]
        },
        {
            "title": "Extracellular signal-regulated kinase 2 (ERK2) mediates phosphorylation and inactivation of nuclear interaction partner of anaplastic lymphoma kinase (NIPA) at G2/M.",
            "journal": "The Journal of biological chemistry",
            "date": "2012",
            "authors": "Illert AL, Zech M, Moll C, Albers C, Kreutmair S, Peschel C, Bassermann F, Duyster J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22955283",
                    "url": "https://glygen.org/publication/PubMed/22955283"
                }
            ]
        },
        {
            "title": "Assessing the range of kinase autoinhibition mechanisms in the insulin receptor family.",
            "journal": "The Biochemical journal",
            "date": "2012",
            "authors": "Artim SC, Mendrola JM, Lemmon MA",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22992069",
                    "url": "https://glygen.org/publication/PubMed/22992069"
                }
            ]
        },
        {
            "title": "Cell culture and Drosophila model systems define three classes of anaplastic lymphoma kinase mutations in neuroblastoma.",
            "journal": "Disease models & mechanisms",
            "date": "2013",
            "authors": "Chand D, Yamazaki Y, Ruuth K, Schonherr C, Martinsson T, Kogner P, Attiyeh EF, Maris J, Morozova O, Marra MA, Ohira M, Nakagawara A, Sandstrom PE, Palmer RH, Hallberg B",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23104988",
                    "url": "https://glygen.org/publication/PubMed/23104988"
                }
            ]
        },
        {
            "title": "Characterization of rearrangements involving the ALK gene reveals a novel truncated form associated with tumor aggressiveness in neuroblastoma.",
            "journal": "Cancer research",
            "date": "2013",
            "authors": "Cazes A, Louis-Brennetot C, Mazot P, Dingli F, Lombard B, Boeva V, Daveau R, Cappo J, Combaret V, Schleiermacher G, Jouannet S, Ferrand S, Pierron G, Barillot E, Loew D, Vigny M, Delattre O, Janoueix-Lerosey I",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23139213",
                    "url": "https://glygen.org/publication/PubMed/23139213"
                }
            ]
        },
        {
            "title": "Anaplastic lymphoma kinase (ALK): structure, oncogenic activation, and pharmacological inhibition.",
            "journal": "Pharmacological research",
            "date": "2013",
            "authors": "Roskoski R Jr",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23201355",
                    "url": "https://glygen.org/publication/PubMed/23201355"
                }
            ]
        },
        {
            "title": "Crizotinib-resistant NPM-ALK mutants confer differential sensitivity to unrelated Alk inhibitors.",
            "journal": "Molecular cancer research : MCR",
            "date": "2013",
            "authors": "Ceccon M, Mologni L, Bisson W, Scapozza L, Gambacorti-Passerini C",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23239810",
                    "url": "https://glygen.org/publication/PubMed/23239810"
                }
            ]
        },
        {
            "title": "Anaplastic lymphoma kinase status in rhabdomyosarcomas.",
            "journal": "Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc",
            "date": "2013",
            "authors": "Yoshida A, Shibata T, Wakai S, Ushiku T, Tsuta K, Fukayama M, Makimoto A, Furuta K, Tsuda H",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23307059",
                    "url": "https://glygen.org/publication/PubMed/23307059"
                }
            ]
        },
        {
            "title": "Heterogeneity of genetic changes associated with acquired crizotinib resistance in ALK-rearranged lung cancer.",
            "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer",
            "date": "2013",
            "authors": "Kim S, Kim TM, Kim DW, Go H, Keam B, Lee SH, Ku JL, Chung DH, Heo DS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717326",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717326"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23344087",
                    "url": "https://glygen.org/publication/PubMed/23344087"
                }
            ]
        },
        {
            "title": "Multiplexed deep sequencing analysis of ALK kinase domain identifies resistance mutations in relapsed patients following crizotinib treatment.",
            "journal": "Genomics",
            "date": "2013",
            "authors": "Huang D, Kim DW, Kotsakis A, Deng S, Lira P, Ho SN, Lee NV, Vizcarra P, Cao JQ, Christensen JG, Kim TM, Sun JM, Ahn JS, Ahn MJ, Park K, Mao M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717326",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717326"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23434628",
                    "url": "https://glygen.org/publication/PubMed/23434628"
                }
            ]
        },
        {
            "title": "Identification of recurrent FGFR3 fusion genes in lung cancer through kinome-centred RNA sequencing.",
            "journal": "The Journal of pathology",
            "date": "2013",
            "authors": "Majewski IJ, Mittempergher L, Davidson NM, Bosma A, Willems SM, Horlings HM, de Rink I, Greger L, Hooijer GK, Peters D, Nederlof PM, Hofland I, de Jong J, Wesseling J, Kluin RJ, Brugman W, Kerkhoven R, Nieboer F, Roepman P, Broeks A, Muley TR, Jassem J, Niklinski J, van Zandwijk N, Brazma A, Oshlack A, van den Heuvel M, Bernards R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23661334",
                    "url": "https://glygen.org/publication/PubMed/23661334"
                }
            ]
        },
        {
            "title": "Anaplastic lymphoma kinase: `Ligand Independent Activation` mediated by the PTN/RPTPbeta/zeta signaling pathway.",
            "journal": "Biochimica et biophysica acta",
            "date": "2013",
            "authors": "Deuel TF",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23777859",
                    "url": "https://glygen.org/publication/PubMed/23777859"
                }
            ]
        },
        {
            "title": "Inflammatory myofibroblastic tumour of the lung with a novel PPFIBP1-ALK fusion variant.",
            "journal": "Histopathology",
            "date": "2013",
            "authors": "Yoshida A, Shibata T, Tsuta K, Watanabe S, Tsuda H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23957430",
                    "url": "https://glygen.org/publication/PubMed/23957430"
                }
            ]
        },
        {
            "title": "Mechanistic insight into ALK receptor tyrosine kinase in human cancer biology.",
            "journal": "Nature reviews. Cancer",
            "date": "2013",
            "authors": "Hallberg B, Palmer RH",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24060861",
                    "url": "https://glygen.org/publication/PubMed/24060861"
                }
            ]
        },
        {
            "title": "ALK is a MYCN target gene and regulates cell migration and invasion in neuroblastoma.",
            "journal": "Scientific reports",
            "date": "2013",
            "authors": "Hasan MK, Nafady A, Takatori A, Kishida S, Ohira M, Suenaga Y, Hossain S, Akter J, Ogura A, Nakamura Y, Kadomatsu K, Nakagawara A",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24356251",
                    "url": "https://glygen.org/publication/PubMed/24356251"
                }
            ]
        },
        {
            "title": "Kinase fusions are frequent in Spitz tumours and spitzoid melanomas.",
            "journal": "Nature communications",
            "date": "2014",
            "authors": "Wiesner T, He J, Yelensky R, Esteve-Puig R, Botton T, Yeh I, Lipson D, Otto G, Brennan K, Murali R, Garrido M, Miller VA, Ross JS, Berger MF, Sparatta A, Palmedo G, Cerroni L, Busam KJ, Kutzner H, Cronin MT, Stephens PJ, Bastian BC",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24445538",
                    "url": "https://glygen.org/publication/PubMed/24445538"
                }
            ]
        },
        {
            "title": "Identification of a recurrent STRN/ALK fusion in thyroid carcinomas.",
            "journal": "PloS one",
            "date": "2014",
            "authors": "Perot G, Soubeyran I, Ribeiro A, Bonhomme B, Savagner F, Boutet-Bouzamondo N, Hostein I, Bonichon F, Godbert Y, Chibon F",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24475247",
                    "url": "https://glygen.org/publication/PubMed/24475247"
                }
            ]
        },
        {
            "title": "HIP1-ALK, a novel ALK fusion variant that responds to crizotinib.",
            "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer",
            "date": "2014",
            "authors": "Fang DD, Zhang B, Gu Q, Lira M, Xu Q, Sun H, Qian M, Sheng W, Ozeck M, Wang Z, Zhang C, Chen X, Chen KX, Li J, Chen SH, Christensen J, Mao M, Chan CC",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24496003",
                    "url": "https://glygen.org/publication/PubMed/24496003"
                }
            ]
        },
        {
            "title": "Activating mutations in ALK kinase domain confer resistance to structurally unrelated ALK inhibitors in NPM-ALK-positive anaplastic large-cell lymphoma.",
            "journal": "Journal of cancer research and clinical oncology",
            "date": "2014",
            "authors": "Zdzalik D, Dymek B, Grygielewicz P, Gunerka P, Bujak A, Lamparska-Przybysz M, Wieczorek M, Dzwonek K",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717316",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717316"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24509625",
                    "url": "https://glygen.org/publication/PubMed/24509625"
                }
            ]
        },
        {
            "title": "HIP1-ALK, a novel fusion protein identified in lung adenocarcinoma.",
            "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer",
            "date": "2014",
            "authors": "Hong M, Kim RN, Song JY, Choi SJ, Oh E, Lira ME, Mao M, Takeuchi K, Han J, Kim J, Choi YL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24518094",
                    "url": "https://glygen.org/publication/PubMed/24518094"
                }
            ]
        },
        {
            "title": "Identification of the transforming STRN-ALK fusion as a potential therapeutic target in the aggressive forms of thyroid cancer.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2014",
            "authors": "Kelly LM, Barila G, Liu P, Evdokimova VN, Trivedi S, Panebianco F, Gandhi M, Carty SE, Hodak SP, Luo J, Dacic S, Yu YP, Nikiforova MN, Ferris RL, Altschuler DL, Nikiforov YE",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24613930",
                    "url": "https://glygen.org/publication/PubMed/24613930"
                }
            ]
        },
        {
            "title": "Ceritinib in ALK-rearranged non-small-cell lung cancer.",
            "journal": "The New England journal of medicine",
            "date": "2014",
            "authors": "Shaw AT, Kim DW, Mehra R, Tan DS, Felip E, Chow LQ, Camidge DR, Vansteenkiste J, Sharma S, De Pas T, Riely GJ, Solomon BJ, Wolf J, Thomas M, Schuler M, Liu G, Santoro A, Lau YY, Goldwasser M, Boral AL, Engelman JA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24670165",
                    "url": "https://glygen.org/publication/PubMed/24670165"
                }
            ]
        },
        {
            "title": "The ALK inhibitor ceritinib overcomes crizotinib resistance in non-small cell lung cancer.",
            "journal": "Cancer discovery",
            "date": "2014",
            "authors": "Friboulet L, Li N, Katayama R, Lee CC, Gainor JF, Crystal AS, Michellys PY, Awad MM, Yanagitani N, Kim S, Pferdekamper AC, Li J, Kasibhatla S, Sun F, Sun X, Hua S, McNamara P, Mahmood S, Lockerman EL, Fujita N, Nishio M, Harris JL, Shaw AT, Engelman JA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24675041",
                    "url": "https://glygen.org/publication/PubMed/24675041"
                }
            ]
        },
        {
            "title": "Next-generation sequencing reveals a Novel NSCLC ALK F1174V mutation and confirms ALK G1202R mutation confers high-level resistance to alectinib (CH5424802/RO5424802) in ALK-rearranged NSCLC patients who progressed on crizotinib.",
            "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer",
            "date": "2014",
            "authors": "Ignatius Ou SH, Azada M, Hsiang DJ, Herman JM, Kain TS, Siwak-Tapp C, Casey C, He J, Ali SM, Klempner SJ, Miller VA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                },
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24736079",
                    "url": "https://glygen.org/publication/PubMed/24736079"
                }
            ]
        },
        {
            "title": "A novel fusion of TPR and ALK in lung adenocarcinoma.",
            "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer",
            "date": "2014",
            "authors": "Choi YL, Lira ME, Hong M, Kim RN, Choi SJ, Song JY, Pandy K, Mann DL, Stahl JA, Peckham HE, Zheng Z, Han J, Mao M, Kim J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24736082",
                    "url": "https://glygen.org/publication/PubMed/24736082"
                }
            ]
        },
        {
            "title": "Wild-type ALK and activating ALK-R1275Q and ALK-F1174L mutations upregulate Myc and initiate tumor formation in murine neural crest progenitor cells.",
            "journal": "Oncotarget",
            "date": "2014",
            "authors": "Montavon G, Jauquier N, Coulon A, Peuchmaur M, Flahaut M, Bourloud KB, Yan P, Delattre O, Sommer L, Joseph JM, Janoueix-Lerosey I, Gross N, Muhlethaler-Mottet A",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24947326",
                    "url": "https://glygen.org/publication/PubMed/24947326"
                }
            ]
        },
        {
            "title": "Two novel ALK mutations mediate acquired resistance to the next-generation ALK inhibitor alectinib.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2014",
            "authors": "Katayama R, Friboulet L, Koike S, Lockerman EL, Khan TM, Gainor JF, Iafrate AJ, Takeuchi K, Taiji M, Okuno Y, Fujita N, Engelman JA, Shaw AT",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25228534",
                    "url": "https://glygen.org/publication/PubMed/25228534"
                }
            ]
        },
        {
            "title": "Revisiting STAT3 signalling in cancer: new and unexpected biological functions.",
            "journal": "Nature reviews. Cancer",
            "date": "2014",
            "authors": "Yu H, Lee H, Herrmann A, Buettner R, Jove R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25342631",
                    "url": "https://glygen.org/publication/PubMed/25342631"
                }
            ]
        },
        {
            "title": "[Abnormality of anaplastic lymphoma kinase gene and its expression in pediatric neuroblastoma].",
            "journal": "Zhonghua bing li xue za zhi = Chinese journal of pathology",
            "date": "2014",
            "authors": "Chen S, Zhou C, Ma X, Gong L",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25346125",
                    "url": "https://glygen.org/publication/PubMed/25346125"
                }
            ]
        },
        {
            "title": "Identification of a novel HIP1-ALK fusion variant in Non-Small-Cell Lung Cancer (NSCLC) and discovery of ALK I1171 (I1171N/S) mutations in two ALK-rearranged NSCLC patients with resistance to Alectinib.",
            "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer",
            "date": "2014",
            "authors": "Ou SH, Klempner SJ, Greenbowe JR, Azada M, Schrock AB, Ali SM, Ross JS, Stephens PJ, Miller VA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                },
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25393796",
                    "url": "https://glygen.org/publication/PubMed/25393796"
                }
            ]
        },
        {
            "title": "Secondary mutations at I1171 in the ALK gene confer resistance to both Crizotinib and Alectinib.",
            "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer",
            "date": "2014",
            "authors": "Toyokawa G, Hirai F, Inamasu E, Yoshida T, Nosaki K, Takenaka T, Yamaguchi M, Seto T, Takenoyama M, Ichinose Y",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717316",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717316"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25393798",
                    "url": "https://glygen.org/publication/PubMed/25393798"
                }
            ]
        },
        {
            "title": "Treatment Efficacy and Resistance Mechanisms Using the Second-Generation ALK Inhibitor AP26113 in Human NPM-ALK-Positive Anaplastic Large Cell Lymphoma.",
            "journal": "Molecular cancer research : MCR",
            "date": "2015",
            "authors": "Ceccon M, Mologni L, Giudici G, Piazza R, Pirola A, Fontana D, Gambacorti-Passerini C",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25421750",
                    "url": "https://glygen.org/publication/PubMed/25421750"
                }
            ]
        },
        {
            "title": "Heparin is an activating ligand of the orphan receptor tyrosine kinase ALK.",
            "journal": "Sci. Signal.",
            "date": "2015",
            "authors": "Murray PB, Lax I, Reshetnyak A, Ligon GF, Lillquist JS, Natoli EJ Jr, Shi X, Folta-Stogniew E, Gunel M, Alvarado D, Schlessinger J",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25605972",
                    "url": "https://glygen.org/publication/PubMed/25605972"
                }
            ]
        },
        {
            "title": "Activity of second-generation ALK inhibitors against crizotinib-resistant mutants in an NPM-ALK model compared to EML4-ALK.",
            "journal": "Cancer medicine",
            "date": "2015",
            "authors": "Fontana D, Ceccon M, Gambacorti-Passerini C, Mologni L",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25727400",
                    "url": "https://glygen.org/publication/PubMed/25727400"
                }
            ]
        },
        {
            "title": "I1171 missense mutation (particularly I1171N) is a common resistance mutation in ALK-positive NSCLC patients who have progressive disease while on alectinib and is sensitive to ceritinib.",
            "journal": "Lung cancer (Amsterdam, Netherlands)",
            "date": "2015",
            "authors": "Ou SH, Greenbowe J, Khan ZU, Azada MC, Ross JS, Stevens PJ, Ali SM, Miller VA, Gitlitz B",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25736571",
                    "url": "https://glygen.org/publication/PubMed/25736571"
                }
            ]
        },
        {
            "title": "Novel ALK fusion partners in lung cancer.",
            "journal": "Cancer letters",
            "date": "2015",
            "authors": "Iyevleva AG, Raskin GA, Tiurin VI, Sokolenko AP, Mitiushkina NV, Aleksakhina SN, Garifullina AR, Strelkova TN, Merkulov VO, Ivantsov AO, Kuligina ESh, Pozharisski KM, Togo AV, Imyanitov EN",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25813404",
                    "url": "https://glygen.org/publication/PubMed/25813404"
                }
            ]
        },
        {
            "title": "GLTSCR2 is an upstream negative regulator of nucleophosmin in cervical cancer.",
            "journal": "Journal of cellular and molecular medicine",
            "date": "2015",
            "authors": "Kim JY, Cho YE, An YM, Kim SH, Lee YG, Park JH, Lee S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25818168",
                    "url": "https://glygen.org/publication/PubMed/25818168"
                }
            ]
        },
        {
            "title": "BIRC6-ALK, a Novel Fusion Gene in ALK Break-Apart FISH-Negative Lung Adenocarcinoma, Responds to Crizotinib.",
            "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer",
            "date": "2015",
            "authors": "Shan L, Jiang P, Xu F, Zhang W, Guo L, Wu J, Zeng Y, Jiao Y, Ying J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26001147",
                    "url": "https://glygen.org/publication/PubMed/26001147"
                }
            ]
        },
        {
            "title": "STUMP un`stumped`: anti-tumor response to anaplastic lymphoma kinase (ALK) inhibitor based targeted therapy in uterine inflammatory myofibroblastic tumor with myxoid features harboring DCTN1-ALK fusion.",
            "journal": "Journal of hematology & oncology",
            "date": "2015",
            "authors": "Subbiah V, McMahon C, Patel S, Zinner R, Silva EG, Elvin JA, Subbiah IM, Ohaji C, Ganeshan DM, Anand D, Levenback CF, Berry J, Brennan T, Chmielecki J, Chalmers ZR, Mayfield J, Miller VA, Stephens PJ, Ross JS, Ali SM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26062823",
                    "url": "https://glygen.org/publication/PubMed/26062823"
                }
            ]
        },
        {
            "title": "RAS-MAPK dependence underlies a rational polytherapy strategy in EML4-ALK-positive lung cancer.",
            "journal": "Nature medicine",
            "date": "2015",
            "authors": "Hrustanovic G, Olivas V, Pazarentzos E, Tulpule A, Asthana S, Blakely CM, Okimoto RA, Lin L, Neel DS, Sabnis A, Flanagan J, Chan E, Varella-Garcia M, Aisner DL, Vaishnavi A, Ou SH, Collisson EA, Ichihara E, Mack PC, Lovly CM, Karachaliou N, Rosell R, Riess JW, Doebele RC, Bivona TG",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26301689",
                    "url": "https://glygen.org/publication/PubMed/26301689"
                }
            ]
        },
        {
            "title": "FAM150A and FAM150B are activating ligands for anaplastic lymphoma kinase.",
            "journal": "eLife",
            "date": "2015",
            "authors": "Guan J, Umapathy G, Yamazaki Y, Wolfstetter G, Mendoza P, Pfeifer K, Mohammed A, Hugosson F, Zhang H, Hsu AW, Halenbeck R, Hallberg B, Palmer RH",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26418745",
                    "url": "https://glygen.org/publication/PubMed/26418745"
                }
            ]
        },
        {
            "title": "Alternative transcription initiation leads to expression of a novel ALK isoform in cancer.",
            "journal": "Nature",
            "date": "2015",
            "authors": "Wiesner T, Lee W, Obenauf AC, Ran L, Murali R, Zhang QF, Wong EW, Hu W, Scott SN, Shah RH, Landa I, Button J, Lailler N, Sboner A, Gao D, Murphy DA, Cao Z, Shukla S, Hollmann TJ, Wang L, Borsu L, Merghoub T, Schwartz GK, Postow MA, Ariyan CE, Fagin JA, Zheng D, Ladanyi M, Busam KJ, Berger MF, Chen Y, Chi P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0K2YUJ3",
                    "url": "https://www.uniprot.org/uniprot/A0A0K2YUJ3"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_004295",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26444240",
                    "url": "https://glygen.org/publication/PubMed/26444240"
                }
            ]
        },
        {
            "title": "ALK F1174V mutation confers sensitivity while ALK I1171 mutation confers resistance to alectinib. The importance of serial biopsy post progression.",
            "journal": "Lung cancer (Amsterdam, Netherlands)",
            "date": "2016",
            "authors": "Ou SH, Milliken JC, Azada MC, Miller VA, Ali SM, Klempner SJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26464158",
                    "url": "https://glygen.org/publication/PubMed/26464158"
                }
            ]
        },
        {
            "title": "Discovery of Inhibitors That Overcome the G1202R Anaplastic Lymphoma Kinase Resistance Mutation.",
            "journal": "Journal of medicinal chemistry",
            "date": "2015",
            "authors": "Hatcher JM, Bahcall M, Choi HG, Gao Y, Sim T, George R, Janne PA, Gray NS",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26568289",
                    "url": "https://glygen.org/publication/PubMed/26568289"
                }
            ]
        },
        {
            "title": "Alectinib: a novel second generation anaplastic lymphoma kinase (ALK) inhibitor for overcoming clinically-acquired resistance.",
            "journal": "Acta pharmaceutica Sinica. B",
            "date": "2015",
            "authors": "Song Z, Wang M, Zhang A",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26579422",
                    "url": "https://glygen.org/publication/PubMed/26579422"
                }
            ]
        },
        {
            "title": "ALK inhibitor resistance in ALK(F1174L)-driven neuroblastoma is associated with AXL activation and induction of EMT.",
            "journal": "Oncogene",
            "date": "2016",
            "authors": "Debruyne DN, Bhatnagar N, Sharma B, Luther W, Moore NF, Cheung NK, Gray NS, George RE",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26616860",
                    "url": "https://glygen.org/publication/PubMed/26616860"
                }
            ]
        },
        {
            "title": "Alectinib in ALK-positive, crizotinib-resistant, non-small-cell lung cancer: a single-group, multicentre, phase 2 trial.",
            "journal": "The Lancet. Oncology",
            "date": "2016",
            "authors": "Shaw AT, Gandhi L, Gadgeel S, Riely GJ, Cetnar J, West H, Camidge DR, Socinski MA, Chiappori A, Mekhail T, Chao BH, Borghaei H, Gold KA, Zeaiter A, Bordogna W, Balas B, Puig O, Henschel V, Ou SI",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26708155",
                    "url": "https://glygen.org/publication/PubMed/26708155"
                }
            ]
        },
        {
            "title": "A novel acquired ALK F1245C mutation confers resistance to crizotinib in ALK-positive NSCLC but is sensitive to ceritinib.",
            "journal": "Lung cancer (Amsterdam, Netherlands)",
            "date": "2016",
            "authors": "Kodityal S, Elvin JA, Squillace R, Agarwal N, Miller VA, Ali SM, Klempner SJ, Ou SH",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26775591",
                    "url": "https://glygen.org/publication/PubMed/26775591"
                }
            ]
        },
        {
            "title": "Structural studies reveal an important role for the pleiotrophin C-terminus in mediating interactions with chondroitin sulfate.",
            "journal": "The FEBS journal",
            "date": "2016",
            "authors": "Ryan E, Shen D, Wang X",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26896299",
                    "url": "https://glygen.org/publication/PubMed/26896299"
                }
            ]
        },
        {
            "title": "Entrectinib, a Pan-TRK, ROS1, and ALK Inhibitor with Activity in Multiple Molecularly Defined Cancer Indications.",
            "journal": "Molecular cancer therapeutics",
            "date": "2016",
            "authors": "Ardini E, Menichincheri M, Banfi P, Bosotti R, De Ponti C, Pulci R, Ballinari D, Ciomei M, Texido G, Degrassi A, Avanzi N, Amboldi N, Saccardo MB, Casero D, Orsini P, Bandiera T, Mologni L, Anderson D, Wei G, Harris J, Vernier JM, Li G, Felder E, Donati D, Isacchi A, Pesenti E, Magnaghi P, Galvani A",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26939704",
                    "url": "https://glygen.org/publication/PubMed/26939704"
                }
            ]
        },
        {
            "title": "TKI sensitivity patterns of novel kinase-domain mutations suggest therapeutic opportunities for patients with resistant ALK+ tumors.",
            "journal": "Oncotarget",
            "date": "2016",
            "authors": "Amin AD, Li L, Rajan SS, Gokhale V, Groysman MJ, Pongtornpipat P, Tapia EO, Wang M, Schatz JH",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717264",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717264"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27009859",
                    "url": "https://glygen.org/publication/PubMed/27009859"
                }
            ]
        },
        {
            "title": "Discovery of Low Micromolar Dual Inhibitors for Wild Type and L1196M Mutant of Anaplastic Lymphoma Kinase through Structure-Based Virtual Screening.",
            "journal": "Journal of chemical information and modeling",
            "date": "2016",
            "authors": "Shin S, Mah S, Hong S, Park H",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27014917",
                    "url": "https://glygen.org/publication/PubMed/27014917"
                }
            ]
        },
        {
            "title": "Genomic Aberrations in Crizotinib Resistant Lung Adenocarcinoma Samples Identified by Transcriptome Sequencing.",
            "journal": "PloS one",
            "date": "2016",
            "authors": "Saber A, van der Wekken AJ, Kok K, Terpstra MM, Bosman LJ, Mastik MF, Timens W, Schuuring E, Hiltermann TJ, Groen HJ, van den Berg A",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717326",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717326"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27045755",
                    "url": "https://glygen.org/publication/PubMed/27045755"
                }
            ]
        },
        {
            "title": "Anaplastic Lymphoma Kinase (ALK) Kinase Domain Mutation Following ALK Inhibitor(s) Failure in Advanced ALK Positive Non-Small-Cell Lung Cancer: Analysis and Literature Review.",
            "journal": "Clinical lung cancer",
            "date": "2016",
            "authors": "Lin YT, Yu CJ, Yang JC, Shih JY",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717316",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717316"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27130468",
                    "url": "https://glygen.org/publication/PubMed/27130468"
                }
            ]
        },
        {
            "title": "Identification of a novel inherited ALK variant M1199L in the WNT type of medulloblastoma.",
            "journal": "Folia neuropathologica",
            "date": "2016",
            "authors": "Trubicka J, Szperl M, Grajkowska W, Karkucinska-Wieckowska A, Tarasinska M, Falana K, Dembowska-Baginska B, Lastowska M",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27179218",
                    "url": "https://glygen.org/publication/PubMed/27179218"
                }
            ]
        },
        {
            "title": "Comprehensive Genomic Profiling Identifies a Subset of Crizotinib-Responsive ALK-Rearranged Non-Small Cell Lung Cancer Not Detected by Fluorescence In Situ Hybridization.",
            "journal": "The oncologist",
            "date": "2016",
            "authors": "Ali SM, Hensing T, Schrock AB, Allen J, Sanford E, Gowen K, Kulkarni A, He J, Suh JH, Lipson D, Elvin JA, Yelensky R, Chalmers Z, Chmielecki J, Peled N, Klempner SJ, Firozvi K, Frampton GM, Molina JR, Menon S, Brahmer JR, MacMahon H, Nowak J, Ou SH, Zauderer M, Ladanyi M, Zakowski M, Fischbach N, Ross JS, Stephens PJ, Miller VA, Wakelee H, Ganesan S, Salgia R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27245569",
                    "url": "https://glygen.org/publication/PubMed/27245569"
                }
            ]
        },
        {
            "title": "Molecular Mechanisms of Resistance to First- and Second-Generation ALK Inhibitors in ALK-Rearranged Lung Cancer.",
            "journal": "Cancer discovery",
            "date": "2016",
            "authors": "Gainor JF, Dardaei L, Yoda S, Friboulet L, Leshchiner I, Katayama R, Dagogo-Jack I, Gadgeel S, Schultz K, Singh M, Chin E, Parks M, Lee D, DiCecca RH, Lockerman E, Huynh T, Logan J, Ritterhouse LL, Le LP, Muniappan A, Digumarthy S, Channick C, Keyes C, Getz G, Dias-Santagata D, Heist RS, Lennerz J, Sequist LV, Benes CH, Iafrate AJ, Mino-Kenudson M, Engelman JA, Shaw AT",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717316",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717316"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27432227",
                    "url": "https://glygen.org/publication/PubMed/27432227"
                }
            ]
        },
        {
            "title": "Role of Chondroitin Sulfate (CS) Modification in the Regulation of Protein-tyrosine Phosphatase Receptor Type Z (PTPRZ) Activity: PLEIOTROPHIN-PTPRZ-A SIGNALING IS INVOLVED IN OLIGODENDROCYTE DIFFERENTIATION.",
            "journal": "The Journal of biological chemistry",
            "date": "2016",
            "authors": "Kuboyama K, Fujikawa A, Suzuki R, Tanga N, Noda M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27445335",
                    "url": "https://glygen.org/publication/PubMed/27445335"
                }
            ]
        },
        {
            "title": "Nucleophosmin: from structure and function to disease development.",
            "journal": "BMC molecular biology",
            "date": "2016",
            "authors": "Box JK, Paquet N, Adams MN, Boucher D, Bolderson E, O'Byrne KJ, Richard DJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27553022",
                    "url": "https://glygen.org/publication/PubMed/27553022"
                }
            ]
        },
        {
            "title": "The role of the ALK receptor in cancer biology.",
            "journal": "Annals of oncology : official journal of the European Society for Medical Oncology",
            "date": "2016",
            "authors": "Hallberg B, Palmer RH",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27573755",
                    "url": "https://glygen.org/publication/PubMed/27573755"
                }
            ]
        },
        {
            "title": "Smac mimetic LCL161 supports neuroblastoma chemotherapy in a drug class-dependent manner and synergistically interacts with ALK inhibitor TAE684 in cells with ALK mutation F1174L.",
            "journal": "Oncotarget",
            "date": "2016",
            "authors": "Najem S, Langemann D, Appl B, Trochimiuk M, Hundsdoerfer P, Reinshagen K, Eschenburg G",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27655666",
                    "url": "https://glygen.org/publication/PubMed/27655666"
                }
            ]
        },
        {
            "title": "The Potent ALK Inhibitor Brigatinib (AP26113) Overcomes Mechanisms of Resistance to First- and Second-Generation ALK Inhibitors in Preclinical Models.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2016",
            "authors": "Zhang S, Anjum R, Squillace R, Nadworny S, Zhou T, Keats J, Ning Y, Wardwell SD, Miller D, Song Y, Eichinger L, Moran L, Huang WS, Liu S, Zou D, Wang Y, Mohemmad Q, Jang HG, Ye E, Narasimhan N, Wang F, Miret J, Zhu X, Clackson T, Dalgarno D, Shakespeare WC, Rivera VM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27780853",
                    "url": "https://glygen.org/publication/PubMed/27780853"
                }
            ]
        },
        {
            "title": "ALK oncoproteins in atypical inflammatory myofibroblastic tumours: novel RRBP1-ALK fusions in epithelioid inflammatory myofibroblastic sarcoma.",
            "journal": "The Journal of pathology",
            "date": "2017",
            "authors": "Lee JC, Li CF, Huang HY, Zhu MJ, Marino-Enriquez A, Lee CT, Ou WB, Hornick JL, Fletcher JA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27874193",
                    "url": "https://glygen.org/publication/PubMed/27874193"
                }
            ]
        },
        {
            "title": "Identification of different ALK mutations in a pair of neuroblastoma cell lines established at diagnosis and relapse.",
            "journal": "Oncotarget",
            "date": "2016",
            "authors": "Chen L, Humphreys A, Turnbull L, Bellini A, Schleiermacher G, Salwen H, Cohn SL, Bown N, Tweddle DA",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27888620",
                    "url": "https://glygen.org/publication/PubMed/27888620"
                }
            ]
        },
        {
            "title": "Anaplastic lymphoma kinase L1198F and G1201E mutations identified in anaplastic thyroid cancer patients are not ligand-independent.",
            "journal": "Oncotarget",
            "date": "2017",
            "authors": "Guan J, Wolfstetter G, Siaw J, Chand D, Hugosson F, Palmer RH, Hallberg B",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28030793",
                    "url": "https://glygen.org/publication/PubMed/28030793"
                }
            ]
        },
        {
            "title": "L1198F Mutation Resensitizes Crizotinib to ALK by Altering the Conformation of Inhibitor and ATP Binding Sites.",
            "journal": "International journal of molecular sciences",
            "date": "2017",
            "authors": "Li J, Sun R, Wu Y, Song M, Li J, Yang Q, Chen X, Bao J, Zhao Q",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28245558",
                    "url": "https://glygen.org/publication/PubMed/28245558"
                }
            ]
        },
        {
            "title": "Dual occurrence of ALK G1202R solvent front mutation and small cell lung cancer transformation as resistance mechanisms to second generation ALK inhibitors without prior exposure to crizotinib. Pitfall of solely relying on liquid re-biopsy?",
            "journal": "Lung cancer (Amsterdam, Netherlands)",
            "date": "2017",
            "authors": "Ou SI, Lee TK, Young L, Fernandez-Rocha MY, Pavlick D, Schrock AB, Zhu VW, Milliken J, Ali SM, Gitlitz BJ",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28285684",
                    "url": "https://glygen.org/publication/PubMed/28285684"
                }
            ]
        },
        {
            "title": "Identification of a novel crizotinib-sensitive BCL11A-ALK gene fusion in a nonsmall cell lung cancer patient.",
            "journal": "The European respiratory journal",
            "date": "2017",
            "authors": "Tian Q, Deng WJ, Li ZW",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28404650",
                    "url": "https://glygen.org/publication/PubMed/28404650"
                }
            ]
        },
        {
            "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.",
            "journal": "Analytical chemistry",
            "date": "2017",
            "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X",
            "evidence": [
                {
                    "database": "O-GlcNAc Database",
                    "id": "Q9UM73",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28510447",
                    "url": "https://glygen.org/publication/PubMed/28510447"
                }
            ]
        },
        {
            "title": "F1174V mutation alters the ALK active conformation in response to Crizotinib in NSCLC: Insight from molecular simulations.",
            "journal": "Journal of molecular graphics & modelling",
            "date": "2017",
            "authors": "Dehghanian F, Kay M, Vallian S",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28622610",
                    "url": "https://glygen.org/publication/PubMed/28622610"
                }
            ]
        },
        {
            "title": "Anaplastic lymphoma kinase-positive anaplastic large cell lymphoma with the variant RNF213-, ATIC- and TPM3-ALK fusions is characterized by copy number gain of the rearranged ALK gene.",
            "journal": "Haematologica",
            "date": "2017",
            "authors": "van der Krogt JA, Bempt MV, Ferreiro JF, Mentens N, Jacobs K, Pluys U, Doms K, Geerdens E, Uyttebroeck A, Pierre P, Michaux L, Devos T, Vandenberghe P, Tousseyn T, Cools J, Wlodarska I",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28659337",
                    "url": "https://glygen.org/publication/PubMed/28659337"
                }
            ]
        },
        {
            "title": "Identification of a novel T1151K ALK mutation in a patient with ALK-rearranged NSCLC with prior exposure to crizotinib and ceritinib.",
            "journal": "Lung cancer (Amsterdam, Netherlands)",
            "date": "2017",
            "authors": "Zhu VW, Cui JJ, Fernandez-Rocha M, Schrock AB, Ali SM, Ou SI",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28676215",
                    "url": "https://glygen.org/publication/PubMed/28676215"
                }
            ]
        },
        {
            "title": "Molecular breakdown: a comprehensive view of anaplastic lymphoma kinase (ALK)-rearranged non-small cell lung cancer.",
            "journal": "The Journal of pathology",
            "date": "2017",
            "authors": "Noh KW, Lee MS, Lee SE, Song JY, Shin HT, Kim YJ, Oh DY, Jung K, Sung M, Kim M, An S, Han J, Shim YM, Zo JI, Kim J, Park WY, Lee SH, Choi YL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28741662",
                    "url": "https://glygen.org/publication/PubMed/28741662"
                }
            ]
        },
        {
            "title": "Identification of 4-Phenoxyquinoline Based Inhibitors for L1196M Mutant of Anaplastic Lymphoma Kinase by Structure-Based Design.",
            "journal": "Journal of medicinal chemistry",
            "date": "2017",
            "authors": "Mah S, Park JH, Jung HY, Ahn K, Choi S, Tae HS, Jung KH, Rho JK, Lee JC, Hong SS, Hong S",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29091425",
                    "url": "https://glygen.org/publication/PubMed/29091425"
                }
            ]
        },
        {
            "title": "Mutation L1196M-induced conformational changes and the drug resistant mechanism of anaplastic lymphoma kinase studied by free energy perturbation and umbrella sampling.",
            "journal": "Physical chemistry chemical physics : PCCP",
            "date": "2017",
            "authors": "Chen J, Wang J, Zhu W",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29109998",
                    "url": "https://glygen.org/publication/PubMed/29109998"
                }
            ]
        },
        {
            "title": "Biological and Genetic Features of Neuroblastoma and Their Clinical Importance.",
            "journal": "Current pediatric reviews",
            "date": "2018",
            "authors": "Aygun N",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29380702",
                    "url": "https://glygen.org/publication/PubMed/29380702"
                }
            ]
        },
        {
            "title": "Role and targeting of anaplastic lymphoma kinase in cancer.",
            "journal": "Molecular cancer",
            "date": "2018",
            "authors": "Della Corte CM, Viscardi G, Di Liello R, Fasano M, Martinelli E, Troiani T, Ciardiello F, Morgillo F",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29455642",
                    "url": "https://glygen.org/publication/PubMed/29455642"
                }
            ]
        },
        {
            "title": "A kinome-wide RNAi screen identifies ALK as a target to sensitize neuroblastoma cells for HDAC8-inhibitor treatment.",
            "journal": "Cell death and differentiation",
            "date": "2018",
            "authors": "Shen J, Najafi S, Stable S, Fabian J, Koeneke E, Kolbinger FR, Wrobel JK, Meder B, Distel M, Heimburg T, Sippl W, Jung M, Peterziel H, Kranz D, Boutros M, Westermann F, Witt O, Oehme I",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29515255",
                    "url": "https://glygen.org/publication/PubMed/29515255"
                }
            ]
        },
        {
            "title": "Anaplastic Lymphoma Kinase Mutation (ALK F1174C) in Small Cell Carcinoma of the Prostate and Molecular Response to Alectinib.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2018",
            "authors": "Carneiro BA, Pamarthy S, Shah AN, Sagar V, Unno K, Han H, Yang XJ, Costa RB, Nagy RJ, Lanman RB, Kuzel TM, Ross JS, Gay L, Elvin JA, Ali SM, Cristofanilli M, Chae YK, Giles FJ, Abdulkadir SA",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29559559",
                    "url": "https://glygen.org/publication/PubMed/29559559"
                }
            ]
        },
        {
            "title": "The AP-1-BATF and -BATF3 module is essential for growth, survival and TH17/ILC3 skewing of anaplastic large cell lymphoma.",
            "journal": "Leukemia",
            "date": "2018",
            "authors": "Schleussner N, Merkel O, Costanza M, Liang HC, Hummel F, Romagnani C, Durek P, Anagnostopoulos I, Hummel M, Johrens K, Niedobitek A, Griffin PR, Piva R, Sczakiel HL, Woessmann W, Damm-Welk C, Hinze C, Stoiber D, Gillissen B, Turner SD, Kaergel E, von Hoff L, Grau M, Lenz G, Dorken B, Scheidereit C, Kenner L, Janz M, Mathas S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29588546",
                    "url": "https://glygen.org/publication/PubMed/29588546"
                }
            ]
        },
        {
            "title": "Molecular Mechanism Behind the Resistance of the G1202R-Mutated Anaplastic Lymphoma Kinase to the Approved Drug Ceritinib.",
            "journal": "The journal of physical chemistry. B",
            "date": "2018",
            "authors": "Chen C, He Z, Xie D, Zheng L, Zhao T, Zhang X, Cheng D",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29648831",
                    "url": "https://glygen.org/publication/PubMed/29648831"
                }
            ]
        },
        {
            "title": "Sequential ALK Inhibitors Can Select for Lorlatinib-Resistant Compound ALK Mutations in ALK-Positive Lung Cancer.",
            "journal": "Cancer discovery",
            "date": "2018",
            "authors": "Yoda S, Lin JJ, Lawrence MS, Burke BJ, Friboulet L, Langenbucher A, Dardaei L, Prutisto-Chang K, Dagogo-Jack I, Timofeevski S, Hubbeling H, Gainor JF, Ferris LA, Riley AK, Kattermann KE, Timonina D, Heist RS, Iafrate AJ, Benes CH, Lennerz JK, Mino-Kenudson M, Engelman JA, Johnson TW, Hata AN, Shaw AT",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717329",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717329"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29650534",
                    "url": "https://glygen.org/publication/PubMed/29650534"
                }
            ]
        },
        {
            "title": "A subgroup of pleural mesothelioma expresses ALK protein and may be targetable by combined rapamycin and crizotinib therapy.",
            "journal": "Oncotarget",
            "date": "2018",
            "authors": "Monch D, Bode-Erdmann S, Kalla J, Strater J, Schwanen C, Falkenstern-Ge R, Klumpp S, Friedel G, Ott G, Kalla C",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29755689",
                    "url": "https://glygen.org/publication/PubMed/29755689"
                }
            ]
        },
        {
            "title": "Insight into resistance mechanism of anaplastic lymphoma kinase to alectinib and JH-VIII-157-02 caused by G1202R solvent front mutation.",
            "journal": "Drug design, development and therapy",
            "date": "2018",
            "authors": "Wang H, Wang Y, Guo W, Du B, Huang X, Wu R, Yang B, Lin X, Wu Y",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29785088",
                    "url": "https://glygen.org/publication/PubMed/29785088"
                }
            ]
        },
        {
            "title": "STAT3: a multifaceted oncoprotein.",
            "journal": "Growth factors (Chur, Switzerland)",
            "date": "2018",
            "authors": "Guanizo AC, Fernando CD, Garama DJ, Gough DJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29873274",
                    "url": "https://glygen.org/publication/PubMed/29873274"
                }
            ]
        },
        {
            "title": "Ceritinib Treatment for Carcinomatous Meningitis with a Secondary Mutation at I1171T in Anaplastic Lymphoma Kinase.",
            "journal": "Internal medicine (Tokyo, Japan)",
            "date": "2018",
            "authors": "Ashinuma H, Shingyoji M, Hasegawa Y, Yokoi S, Yoshida Y",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29877262",
                    "url": "https://glygen.org/publication/PubMed/29877262"
                }
            ]
        },
        {
            "title": "Clinical response of the novel activating ALK-I1171T mutation in neuroblastoma to the ALK inhibitor ceritinib.",
            "journal": "Cold Spring Harbor molecular case studies",
            "date": "2018-08",
            "authors": "Guan Jikui, Fransson Susanne, Siaw Joachim Tetteh, Treis Diana, Van den Eynden Jimmy, Chand Damini, Umapathy Ganesh, Ruuth Kristina, Svenberg Petter, Wessman Sandra, Shamikh Alia, Jacobsson Hans, Gordon Lena, Stenman Jakob, Svensson P\u00e4r-Johan, Hansson Magnus, Larsson Erik, Martinsson Tommy, Palmer Ruth H, Kogner Per, Hallberg Bengt",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29907598",
                    "url": "https://glygen.org/publication/PubMed/29907598"
                }
            ]
        },
        {
            "title": "Structural and clinical consequences of activation loop mutations in class III receptor tyrosine kinases.",
            "journal": "Pharmacology & therapeutics",
            "date": "2018",
            "authors": "Klug LR, Kent JD, Heinrich MC",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29964125",
                    "url": "https://glygen.org/publication/PubMed/29964125"
                }
            ]
        },
        {
            "title": "Heterogeneous responses and resistant mechanisms to crizotinib in ALK-positive advanced non-small cell lung cancer.",
            "journal": "Thoracic cancer",
            "date": "2018",
            "authors": "Kang J, Chen HJ, Zhang XC, Su J, Zhou Q, Tu HY, Wang Z, Wang BC, Zhong WZ, Yang XN, Chen ZH, Ding Y, Wu X, Wang M, Fu JG, Yang Z, Zhang X, Shao YW, Wu YL, Yang JJ",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "238",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29978950",
                    "url": "https://glygen.org/publication/PubMed/29978950"
                }
            ]
        },
        {
            "title": "Molecular Modeling for Structural Insights Concerning the Activation Mechanisms of F1174L and R1275Q Mutations on Anaplastic Lymphoma Kinase.",
            "journal": "Molecules (Basel, Switzerland)",
            "date": "2018",
            "authors": "Jiang CH, Huang CX, Chen YJ, Chuang YC, Huang BY, Yang CN",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30004444",
                    "url": "https://glygen.org/publication/PubMed/30004444"
                }
            ]
        },
        {
            "title": "Identification of a biologically active fragment of ALK and LTK-Ligand 2 (augmentor-alpha).",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2018",
            "authors": "Reshetnyak AV, Mohanty J, Tome F, Puleo DE, Plotnikov AN, Ahmed M, Kaur N, Poliakov A, Cinnaiyan AM, Lax I, Schlessinger J",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30061385",
                    "url": "https://glygen.org/publication/PubMed/30061385"
                }
            ]
        },
        {
            "title": "Next generation sequencing reveals a novel ALK G1128A mutation resistant to crizotinib in an ALK-Rearranged NSCLC patient.",
            "journal": "Lung cancer (Amsterdam, Netherlands)",
            "date": "2018",
            "authors": "Ai X, Niu X, Chang L, Chen R, Ou SI, Lu S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717326",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717326"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30089600",
                    "url": "https://glygen.org/publication/PubMed/30089600"
                }
            ]
        },
        {
            "title": "ALK-G1269A mutation in epithelioid inflammatory myofibroblastic sarcoma after progression on crizotinib: A case report.",
            "journal": "Oncology letters",
            "date": "2019",
            "authors": "Xu X, Li H, Peng K, Yu Y, Chen L, Fang Y, Sun Y, Hou Y, Liu T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717326",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717326"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30675302",
                    "url": "https://glygen.org/publication/PubMed/30675302"
                }
            ]
        },
        {
            "title": "Efficacy and Safety of Lorlatinib in Korean Non-Small-Cell Lung Cancer Patients With ALK or ROS1 Rearrangement Whose Disease Failed to Respond to a Previous Tyrosine Kinase Inhibitor.",
            "journal": "Clinical lung cancer",
            "date": "2019",
            "authors": "Lee J, Sun JM, Lee SH, Ahn JS, Park K, Choi Y, Ahn MJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717323",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717323"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30683630",
                    "url": "https://glygen.org/publication/PubMed/30683630"
                }
            ]
        },
        {
            "title": "The Transcriptional Regulator Sin3A Contributes to the Oncogenic Potential of STAT3.",
            "journal": "Cancer research",
            "date": "2019",
            "authors": "Gambi G, Di Simone E, Basso V, Ricci L, Wang R, Verma A, Elemento O, Ponzoni M, Inghirami G, Icardi L, Mondino A",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30692217",
                    "url": "https://glygen.org/publication/PubMed/30692217"
                }
            ]
        },
        {
            "title": "Alectinib, an Anaplastic Lymphoma Kinase Inhibitor, Abolishes ALK Activity and Growth in ALK-Positive Neuroblastoma Cells.",
            "journal": "Frontiers in oncology",
            "date": "2019",
            "authors": "Alam MW, Borenas M, Lind DE, Cervantes-Madrid D, Umapathy G, Palmer RH, Hallberg B",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31334113",
                    "url": "https://glygen.org/publication/PubMed/31334113"
                }
            ]
        },
        {
            "title": "The Transcriptional Roles of ALK Fusion Proteins in Tumorigenesis.",
            "journal": "Cancers",
            "date": "2019",
            "authors": "Ducray SP, Natarajan K, Garland GD, Turner SD, Egger G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31366041",
                    "url": "https://glygen.org/publication/PubMed/31366041"
                }
            ]
        },
        {
            "title": "Rapid Acquisition of Alectinib Resistance in ALK-Positive Lung Cancer With High Tumor Mutation Burden.",
            "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer",
            "date": "2019",
            "authors": "Makimoto G, Ohashi K, Tomida S, Nishii K, Matsubara T, Kayatani H, Higo H, Ninomiya K, Sato A, Watanabe H, Kano H, Ninomiya T, Kubo T, Rai K, Ichihara E, Hotta K, Tabata M, Toyooka S, Takata M, Maeda Y, Kiura K",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717316",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717316"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31374369",
                    "url": "https://glygen.org/publication/PubMed/31374369"
                }
            ]
        },
        {
            "title": "Molecular Modeling of ALK L1198F and/or G1202R Mutations to Determine Differential Crizotinib Sensitivity.",
            "journal": "Scientific reports",
            "date": "2019",
            "authors": "Chuang YC, Huang BY, Chang HW, Yang CN",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9700645",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31388026",
                    "url": "https://glygen.org/publication/PubMed/31388026"
                }
            ]
        },
        {
            "title": "Proteomic Phosphosite Analysis Identified Crucial NPM-ALK-Mediated NIPA Serine and Threonine Residues.",
            "journal": "International journal of molecular sciences",
            "date": "2019",
            "authors": "Gengenbacher A, Muller-Rudorf A, Poggio T, Grassel L, Dumit VI, Kreutmair S, Lippert LJ, Duyster J, Illert AL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725371",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31434245",
                    "url": "https://glygen.org/publication/PubMed/31434245"
                }
            ]
        },
        {
            "title": "Diverse Resistance Mechanisms to the Third-Generation ALK Inhibitor Lorlatinib in ALK-Rearranged Lung Cancer.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2020",
            "authors": "Recondo G, Mezquita L, Facchinetti F, Planchard D, Gazzah A, Bigot L, Rizvi AZ, Frias RL, Thiery JP, Scoazec JY, Sourisseau T, Howarth K, Deas O, Samofalova D, Galissant J, Tesson P, Braye F, Naltet C, Lavaud P, Mahjoubi L, Abou Lovergne A, Vassal G, Bahleda R, Hollebecque A, Nicotra C, Ngo-Camus M, Michiels S, Lacroix L, Richon C, Auger N, De Baere T, Tselikas L, Solary E, Angevin E, Eggermont AM, Andre F, Massard C, Olaussen KA, Soria JC, Besse B, Friboulet L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31585938",
                    "url": "https://glygen.org/publication/PubMed/31585938"
                }
            ]
        },
        {
            "title": "TKI-resistant ALK-rearranged lung adenocarcinoma with secondary CTNNB1 p.S45V and tertiary ALK p.I1171N mutations.",
            "journal": "Lung Cancer (Auckland, N.Z.)",
            "date": "2019",
            "authors": "Ouseph MM, Taber A, Khurshid H, Madison R, Aswad BI, Resnick MB, Yakirevich E, Ali SM, Patel NR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717329",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717329"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31616196",
                    "url": "https://glygen.org/publication/PubMed/31616196"
                }
            ]
        },
        {
            "title": "A Compound L1196M/G1202R ALK Mutation in a Patient with ALK-Positive Lung Cancer with Acquired Resistance to Brigatinib Also Confers Primary Resistance to Lorlatinib.",
            "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer",
            "date": "2019",
            "authors": "Sharma GG, Cortinovis D, Agustoni F, Arosio G, Villa M, Cordani N, Bidoli P, Bisson WH, Pagni F, Piazza R, Gambacorti-Passerini C, Mologni L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717319",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717319"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31668326",
                    "url": "https://glygen.org/publication/PubMed/31668326"
                }
            ]
        },
        {
            "title": "ALK Mutation Status Before and After Alectinib Treatment in Locally Advanced or Metastatic ALK-Positive NSCLC: Pooled Analysis of Two Prospective Trials.",
            "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer",
            "date": "2020",
            "authors": "Noe J, Lovejoy A, Ou SI, Yaung SJ, Bordogna W, Klass DM, Cummings CA, Shaw AT",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717326",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717326"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31712133",
                    "url": "https://glygen.org/publication/PubMed/31712133"
                }
            ]
        },
        {
            "title": "Molecular findings reveal possible resistance mechanisms in a patient with ALK-rearranged lung cancer: a case report and literature review.",
            "journal": "ESMO open",
            "date": "2019",
            "authors": "Kougioumtzi A, Ntellas P, Papadopoulou E, Nasioulas G, Kampletsas E, Pentheroudakis G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717329",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717329"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31749991",
                    "url": "https://glygen.org/publication/PubMed/31749991"
                }
            ]
        },
        {
            "title": "Repotrectinib (TPX-0005), effectively reduces growth of ALK driven neuroblastoma cells.",
            "journal": "Scientific reports",
            "date": "2019-12-18",
            "authors": "Cervantes-Madrid Diana, Szydzik Joanna, Lind Dan Emil, Boren\u00e4s Marcus, Bemark Mats, Cui Jean, Palmer Ruth Helen, Hallberg Bengt",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31852910",
                    "url": "https://glygen.org/publication/PubMed/31852910"
                }
            ]
        },
        {
            "title": "Overcoming resistance by ALK compound mutation (I1171S + G1269A) after sequential treatment of multiple ALK inhibitors in non-small cell lung cancer.",
            "journal": "Thoracic cancer",
            "date": "2020",
            "authors": "Takahashi K, Seto Y, Okada K, Uematsu S, Uchibori K, Tsukahara M, Oh-Hara T, Fujita N, Yanagitani N, Nishio M, Okubo K, Katayama R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9717329",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717329"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31943796",
                    "url": "https://glygen.org/publication/PubMed/31943796"
                }
            ]
        },
        {
            "title": "ALK Inhibitors-Induced M Phase Delay Contributes to the Suppression of Cell Proliferation.",
            "journal": "Cancers",
            "date": "2020-04-24",
            "authors": "Munira Sirajam, Yuki Ryuzaburo, Saito Youhei, Nakayama Yuji",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "32344689",
                    "url": "https://glygen.org/publication/PubMed/32344689"
                }
            ]
        },
        {
            "title": "ALK ligand ALKAL2 potentiates MYCN-driven neuroblastoma in the absence of ALK mutation.",
            "journal": "EMBO J.",
            "date": "2021",
            "authors": "Borenas M, Umapathy G, Lai WY, Lind DE, Witek B, Guan J, Mendoza-Garcia P, Masudi T, Claeys A, Chuang TP, El Wakil A, Arefin B, Fransson S, Koster J, Johansson M, Gaarder J, Van den Eynden J, Hallberg B, Palmer RH",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "33411331",
                    "url": "https://glygen.org/publication/PubMed/33411331"
                }
            ]
        },
        {
            "title": "Anaplastic lymphoma kinase inhibitor NVP\u2011TAE684 suppresses the proliferation of human pancreatic adenocarcinoma cells.",
            "journal": "Oncology reports",
            "date": "2021-04",
            "authors": "Duong Hong-Quan, Than Van Thai, Nguyen Huyen-Trang, Nguyen Phuong-Thoa, Thi Huyen Trang Ha, Bui Thi Ngoc Ha, Dang Vu Phuong Linh, Dinh Thi-Thanh, You Kyu Sic, Dang The-Hung, Seong Yeon-Sun",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "33649854",
                    "url": "https://glygen.org/publication/PubMed/33649854"
                }
            ]
        },
        {
            "title": "Structural basis of cytokine-mediated activation of ALK family receptors.",
            "journal": "Nature",
            "date": "2021",
            "authors": "De Munck S, Provost M, Kurikawa M, Omori I, Mukohyama J, Felix J, Bloch Y, Abdel-Wahab O, Bazan JF, Yoshimi A, Savvides SN",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "34646012",
                    "url": "https://glygen.org/publication/PubMed/34646012"
                }
            ]
        },
        {
            "title": "Mechanism for the activation of the anaplastic lymphoma kinase receptor.",
            "journal": "Nature",
            "date": "2021",
            "authors": "Reshetnyak AV, Rossi P, Myasnikov AG, Sowaileh M, Mohanty J, Nourse A, Miller DJ, Lax I, Schlessinger J, Kalodimos CG",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "34819673",
                    "url": "https://glygen.org/publication/PubMed/34819673"
                }
            ]
        },
        {
            "title": "ALK rearrangement is an independent predictive factor of unexpected nodal metastasis after surgery in early stage, clinical node negative lung adenocarcinoma.",
            "journal": "Lung cancer (Amsterdam, Netherlands)",
            "date": "2023-04-25",
            "authors": "Tommaso Gallina Filippo, Taj\u00e8 Riccardo, Letizia Cecere Fabiana, Forcella Daniele, Landi Lorenza, Minuti Gabriele, Fusco Francesca, Buglioni Simonetta, Visca Paolo, Melis Enrico, Sperduti Isabella, Ciliberto Gennaro, Cappuzzo Federico, Facciolo Francesco",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004295",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37126920",
                    "url": "https://glygen.org/publication/PubMed/37126920"
                }
            ]
        },
        {
            "title": "Expression of Anaplastic Lymphoma Kinase (ALK) in glioma and possible clinical correlations. A retrospective institutional study.",
            "journal": "Cancer treatment and research communications",
            "date": "2023",
            "authors": "Azab Mohammed A",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004295",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37271069",
                    "url": "https://glygen.org/publication/PubMed/37271069"
                }
            ]
        },
        {
            "title": "Anaplastic Lymphoma Kinase Inhibitors for Therapy of Neuroblastoma in Adults.",
            "journal": "JCO precision oncology",
            "date": "2023-08",
            "authors": "Stiefel Jessica, Kushner Brian H, Roberts Stephen S, Iglesias-Cardenas Fiorella, Kramer Kim, Modak Shakeel",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004295",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37561984",
                    "url": "https://glygen.org/publication/PubMed/37561984"
                }
            ]
        },
        {
            "title": "Anaplastic lymphoma kinase overexpression enhances aggressive phenotypic characteristics of endometrial carcinoma.",
            "journal": "BMC cancer",
            "date": "2023-08-17",
            "authors": "Yokoi Ako, Nakamura Yusaku, Hashimura Miki, Oguri Yasuko, Matsumoto Toshihide, Nakagawa Mayu, Ishibashi Yu, Ito Takashi, Ohhigata Kensuke, Harada Youhei, Fukagawa Naomi, Saegusa Makoto",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004295",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004295"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37592266",
                    "url": "https://glygen.org/publication/PubMed/37592266"
                }
            ]
        },
        {
            "title": "Fusion of a kinase gene, ALK, to a nucleolar protein gene, NPM, in non-Hodgkin's lymphoma.",
            "journal": "Science (New York, N.Y.)",
            "date": "1995",
            "authors": "Morris SW, Kirstein MN, Valentine MB, Dittmer K, Shapiro DN, Look AT, Saltman DL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7824924",
                    "url": "https://glygen.org/publication/PubMed/7824924"
                }
            ]
        },
        {
            "title": "Fusion of a kinase gene, ALK, to a nucleolar protein gene, NPM, in non-Hodgkin's lymphoma.",
            "journal": "Science",
            "date": "1994",
            "authors": "Dittmer K.G., Kirstein M.N., Look A.T., Morris S.W., Saltman D.L., Shapiro D.N., Valentine M.B.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8122112",
                    "url": "https://glygen.org/publication/PubMed/8122112"
                }
            ]
        },
        {
            "title": "Characterization of the transforming activity of p80, a hyperphosphorylated protein in a Ki-1 lymphoma cell line with chromosomal translocation t(2;5).",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "1996",
            "authors": "Fujimoto J, Shiota M, Iwahara T, Seki N, Satoh H, Mori S, Yamamoto T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9725370",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8633037",
                    "url": "https://glygen.org/publication/PubMed/8633037"
                }
            ]
        },
        {
            "title": "Molecular characterization of ALK, a receptor tyrosine kinase expressed specifically in the nervous system.",
            "journal": "Oncogene",
            "date": "1997",
            "authors": "Iwahara T, Fujimoto J, Wen D, Cupples R, Bucay N, Arakawa T, Mori S, Ratzkin B, Yamamoto T",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9053841",
                    "url": "https://glygen.org/publication/PubMed/9053841"
                }
            ]
        },
        {
            "title": "ALK, the chromosome 2 gene locus altered by the t(2;5) in non-Hodgkin's lymphoma, encodes a novel neural receptor tyrosine kinase that is highly related to leukocyte tyrosine kinase (LTK).",
            "journal": "Oncogene",
            "date": "1997",
            "authors": "Morris SW, Naeve C, Mathew P, James PL, Kirstein MN, Cui X, Witte DP",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9174053",
                    "url": "https://glygen.org/publication/PubMed/9174053"
                }
            ]
        },
        {
            "title": "Nucleophosmin-anaplastic lymphoma kinase of large-cell anaplastic lymphoma is a constitutively active tyrosine kinase that utilizes phospholipase C-gamma to mediate its mitogenicity.",
            "journal": "Molecular and cellular biology",
            "date": "1998",
            "authors": "Bai RY, Dieter P, Peschel C, Morris SW, Duyster J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-201556",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q9UM73",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UM73"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9819383",
                    "url": "https://glygen.org/publication/PubMed/9819383"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "hsa:238",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:238",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-HSA-201556",
            "name": "Signaling by ALK",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201556",
            "resource": "Reactome",
            "description": "Signaling by ALK"
        },
        {
            "id": "R-HSA-9700645",
            "name": "ALK mutants bind TKIs",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645",
            "resource": "Reactome",
            "description": "ALK mutants bind TKIs"
        },
        {
            "id": "R-HSA-9717264",
            "name": "ASP-3026-resistant ALK mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717264",
            "resource": "Reactome",
            "description": "ASP-3026-resistant ALK mutants"
        },
        {
            "id": "R-HSA-9717301",
            "name": "NVP-TAE684-resistant ALK mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717301",
            "resource": "Reactome",
            "description": "NVP-TAE684-resistant ALK mutants"
        },
        {
            "id": "R-HSA-9717316",
            "name": "alectinib-resistant ALK mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717316",
            "resource": "Reactome",
            "description": "alectinib-resistant ALK mutants"
        },
        {
            "id": "R-HSA-9717319",
            "name": "brigatinib-resistant ALK mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717319",
            "resource": "Reactome",
            "description": "brigatinib-resistant ALK mutants"
        },
        {
            "id": "R-HSA-9717323",
            "name": "ceritinib-resistant ALK mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717323",
            "resource": "Reactome",
            "description": "ceritinib-resistant ALK mutants"
        },
        {
            "id": "R-HSA-9717326",
            "name": "crizotinib-resistant ALK mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717326",
            "resource": "Reactome",
            "description": "crizotinib-resistant ALK mutants"
        },
        {
            "id": "R-HSA-9717329",
            "name": "lorlatinib-resistant ALK mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717329",
            "resource": "Reactome",
            "description": "lorlatinib-resistant ALK mutants"
        },
        {
            "id": "R-HSA-9725370",
            "name": "Signaling by ALK fusions and activated point mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370",
            "resource": "Reactome",
            "description": "Signaling by ALK fusions and activated point mutants"
        },
        {
            "id": "R-HSA-9725371",
            "name": "Nuclear events stimulated by ALK signaling in cancer",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371",
            "resource": "Reactome",
            "description": "Nuclear events stimulated by ALK signaling in cancer"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "F1LRZ0-1",
            "protein_name": "Tyrosine-protein kinase receptor",
            "gene_name": "Alk",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MGALGFLWLLPPLLLTAASYSGAATDQRAGSPASGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARDLLLPQPPSPSEPGAGGLEARGSLALDCDPLLRLLGPSPGISWAEGASSPSPEAAPTLSRVLKGGSVRKLRRAKQLVLELGEETILEGCIGPPEEAAAVGILQFNLSELFSWWILHGEGRLRIRLMPEKKASEVGREGRLSTAIRASQPRLLFQIFGTGHSSLESPSEMPSPPGNFLWNLTWTMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHTHGNQSWSWRRVPSEEASRMNLLDGPEAEHLKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGRYVAQLLPHNEAGREILLVPTPGKHGWTVLHGRVGRPENPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQNCAQGEDEGQLCSKLPAGFYCNFEDGFCGWTQSPLSPRVPRWQVKTLKDTHSQGHQGHALLLSTTDDPTSESATVTSATFPAPMKSSPCELRMSWLIRGVLKGNVSLVLVENKTGKEQSRTVWHVATNEGLSLWQWTVLSLLDVTDRFWLQIVTWWGPGSRATVAFDNISISLDCYLTISGEEKMSLNAVPKSRNLFEKNPNKEPKPWANISGPTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVVVGSEGPLRGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDTLYILVGQQGEDACPRANQLIQKVCVGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLIIAAGGGGRAYGAKTETFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLLEGAAGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLADDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMAGGDLKSFLRETRPRPNQPTSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGAGRIAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPVVEEEEKVPMRPKDPEGMPPLLVSPQSAKHEEASSAPQPSALAAPGPLVKKPSGAGAGAGAGPVPRGAADRGHVNMAFSQPNPPPELHKGPGSRNKPTSLWNPTYGSWFTEKPAKKTHPPPGAEPQARAGAAEGGWTGPGAGPRRAEAALLLEPSALSATMKEVPLFRLRHFPCGNVNYGYQQQGLPLEATAAPGDTVLKSKTKVTQPGP",
                "length": 1617
            },
            "evidence": [
                {
                    "id": "45226001",
                    "url": "http://www.informatics.jax.org/homology/45226001",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "P97793-1",
            "protein_name": "ALK tyrosine kinase receptor",
            "gene_name": "Alk",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MGAAGFLWLLPPLLLAAASYSGAATDQRAGSPASGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARDLLLPQPRSPSEPEAGGLEARGSLALDCEPLLRLLGPLPGISWADGASSPSPEAGPTLSRVLKGGSVRKLRRAKQLVLELGEETILEGCIGPPEEVAAVGILQFNLSELFSWWILHGEGRLRIRLMPEKKASEVGREGRLSSAIRASQPRLLFQIFGTGHSSMESPSETPSPPGTFMWNLTWTMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHNHGNQSWSWRHVPSEEASRMNLLDGPEAEHSQEMPRGSFLLLNTSADSKHTILSPWMRSSSDHCTLAVSVHRHLQPSGRYVAQLLPHNEAGREILLVPTPGKHGWTVLQGRVGRPANPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDEGQLCSKLPAGFYCNFENGFCGWTQSPLSPHMPRWQVRTLRDAHSQGHQGRALLLSTTDILASEGATVTSATFPAPMKNSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQSRTVWHVATDEGLSLWQHTVLSLLDVTDRFWLQIVTWWGPGSRATVGFDNISISLDCYLTISGEEKMSLNSVPKSRNLFEKNPNKESKSWANISGPTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVVVGSEGPLKGVQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKGDTLYILVGQQGEDACPRANQLIQKVCVGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLIIAAGGGGRAYGAKTETFHPERLESNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLLEGAAGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLADDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMAGGDLKSFLRETRPRPNQPTSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGAGRIAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPVVEEEEKVPMRPKDPEGMPPLLVSPQPAKHEEASAAPQPAALTAPGPSVKKPPGAGAGAGAGAGAGPVPRGAADRGHVNMAFSQPNPPPELHKGPGSRNKPTSLWNPTYGSWFTEKPAKKTHPPPGAEPQARAGAAEGGWTGPGAGPRRAEAALLLEPSALSATMKEVPLFRLRHFPCGNVNYGYQQQGLPLEATAAPGDTMLKSKNKVTQPGP",
                "length": 1621
            },
            "evidence": [
                {
                    "id": "45226001",
                    "url": "http://www.informatics.jax.org/homology/45226001",
                    "database": "MGI"
                },
                {
                    "id": "Q9UM73",
                    "url": "https://omabrowser.org/oma/group/Q9UM73/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 8,
                "go_terms": [
                    {
                        "name": "ATP binding",
                        "id": "GO:0005524",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "transmembrane receptor protein tyrosine kinase activity",
                        "id": "GO:0004714",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004714",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein tyrosine kinase activity",
                        "id": "GO:0004713",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004713",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "heparin binding",
                        "id": "GO:0008201",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "identical protein binding",
                        "id": "GO:0042802",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "receptor signaling protein tyrosine kinase activator activity",
                        "id": "GO:0030298",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030298",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "NF-kappaB-inducing kinase activity",
                        "id": "GO:0004704",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004704",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein kinase activity",
                        "id": "GO:0004672",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004672",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 20,
                "go_terms": [
                    {
                        "name": "protein phosphorylation",
                        "id": "GO:0006468",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006468",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "transmembrane receptor protein tyrosine kinase signaling pathway",
                        "id": "GO:0007169",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007169",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "signal transduction",
                        "id": "GO:0007165",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "adult behavior",
                        "id": "GO:0030534",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030534",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "peptidyl-tyrosine autophosphorylation",
                        "id": "GO:0038083",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038083",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of cell population proliferation",
                        "id": "GO:0042127",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042127",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of NF-kappaB transcription factor activity",
                        "id": "GO:0051092",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051092",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "hippocampus development",
                        "id": "GO:0021766",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021766",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "negative regulation of lipid catabolic process",
                        "id": "GO:0050995",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050995",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "energy homeostasis",
                        "id": "GO:0097009",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097009",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of kinase activity",
                        "id": "GO:0033674",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033674",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of neuron differentiation",
                        "id": "GO:0045664",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045664",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein autophosphorylation",
                        "id": "GO:0046777",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046777",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "phosphorylation",
                        "id": "GO:0016310",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of apoptotic process",
                        "id": "GO:0042981",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042981",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "swimming behavior",
                        "id": "GO:0036269",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036269",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "neuron development",
                        "id": "GO:0048666",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048666",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of dopamine receptor signaling pathway",
                        "id": "GO:0060159",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060159",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "response to environmental enrichment",
                        "id": "GO:0090648",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090648",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of dendrite development",
                        "id": "GO:1900006",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900006",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 5,
                "go_terms": [
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "receptor complex",
                        "id": "GO:0043235",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043235",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "extracellular exosome",
                        "id": "GO:0070062",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein-containing complex",
                        "id": "GO:0032991",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9UM73",
                                "url": "https://www.uniprot.org/uniprot/Q9UM73"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 1115,
            "end_pos": 1117,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 169,
            "end_pos": 171,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 244,
            "end_pos": 246,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 285,
            "end_pos": 287,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 324,
            "end_pos": 326,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 411,
            "end_pos": 413,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 424,
            "end_pos": 426,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 445,
            "end_pos": 447,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 563,
            "end_pos": 565,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 571,
            "end_pos": 573,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 627,
            "end_pos": 629,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 709,
            "end_pos": 711,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 808,
            "end_pos": 810,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 863,
            "end_pos": 865,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 864,
            "end_pos": 866,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 886,
            "end_pos": 888,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 986,
            "end_pos": 988,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [
        {
            "annotation": "N-glycosylated.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "9174053",
                    "url": "https://glygen.org/publication/PubMed/9174053"
                }
            ]
        },
        {
            "annotation": "Phosphorylated at tyrosine residues by autocatalysis, which activates kinase activity (PubMed:11121404, PubMed:15938644, PubMed:16878150, PubMed:34819673). In cells not stimulated by a ligand, receptor protein tyrosine phosphatase beta and zeta complex (PTPRB/PTPRZ1) dephosphorylates ALK at the sites in ALK that are undergoing autophosphorylation through autoactivation (PubMed:17681947). Phosphorylation at Tyr-1507 is critical for SHC1 association (PubMed:17274988).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9UM73",
                    "url": "https://www.uniprot.org/uniprot/Q9UM73"
                },
                {
                    "database": "PubMed",
                    "id": "16878150",
                    "url": "https://glygen.org/publication/PubMed/16878150"
                },
                {
                    "database": "PubMed",
                    "id": "17274988",
                    "url": "https://glygen.org/publication/PubMed/17274988"
                },
                {
                    "database": "PubMed",
                    "id": "15938644",
                    "url": "https://glygen.org/publication/PubMed/15938644"
                },
                {
                    "database": "PubMed",
                    "id": "17681947",
                    "url": "https://glygen.org/publication/PubMed/17681947"
                },
                {
                    "database": "PubMed",
                    "id": "34819673",
                    "url": "https://glygen.org/publication/PubMed/34819673"
                },
                {
                    "database": "PubMed",
                    "id": "11121404",
                    "url": "https://glygen.org/publication/PubMed/11121404"
                }
            ]
        }
    ],
    "interactions": [],
    "reactions": [
        {
            "id": "10596",
            "name": "",
            "equation": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]",
            "summary": "",
            "cellular_location": "",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q63132-1",
                "Q9WUD9-1",
                "P57760-1",
                "P35739-1",
                "F1LYY7-1",
                "A0A8I6GCV6-1",
                "Q63117-1",
                "Q5U2X5-1",
                "Q63474-1",
                "O08680-1",
                "O35346-1",
                "P54757-1",
                "P54758-1",
                "P54759-1",
                "P70600-1",
                "Q00495-1",
                "Q03351-1",
                "Q04589-1",
                "P06494-1",
                "P09759-1",
                "P29321-1",
                "P32577-1",
                "Q6XUX2-1",
                "Q4V8A3-1",
                "Q62662-1",
                "Q62799-1",
                "Q62844-1",
                "Q62956-1",
                "Q63184-1",
                "Q63470-1",
                "Q498D6-1",
                "Q01621-1",
                "Q6P6U0-1",
                "Q63604-1",
                "P09760-1",
                "Q01986-1",
                "Q62862-1",
                "Q63572-1",
                "Q07014-1",
                "Q4KSH7-1",
                "G3V9H8-1",
                "P15127-1",
                "O08775-1",
                "P53767-1",
                "Q05030-1",
                "P55146-1",
                "Q64725-1",
                "Q63802-1",
                "Q64716-1",
                "P09215-1",
                "Q62689-1",
                "F1LM93-1",
                "P36506-1",
                "P20786-1",
                "P24062-1",
                "Q924U5-1",
                "Q63272-1",
                "B2RYC7-1",
                "P41243-1",
                "M0RDA4-1",
                "Q62838-1",
                "Q63116-1",
                "A0A8I6AM23-1",
                "P50545-1",
                "P57097-1",
                "P97523-1",
                "Q91ZT1-1",
                "D4A7W7-1",
                "F1LVI0-1",
                "E9PSY0-1",
                "A0A0G2K6M9-1",
                "F1LSN4-1",
                "F1MAJ0-1",
                "A0A0R4J8U1-1",
                "A0A8I6A5T6-1",
                "D3ZDS3-1",
                "D4ADZ5-1",
                "F1LSG7-1",
                "F1LRZ0-1",
                "D3ZBN3-1",
                "F1M0N1-1",
                "G3V6K6-1",
                "D3ZD03-1",
                "D3ZZK3-1",
                "E9PT20-1",
                "D4A584-1",
                "D3ZDH4-1",
                "A0A8I5ZVE3-1",
                "A0A8I6AWX7-1",
                "Q4KM97-1",
                "Q501W1-1",
                "B5DFD6-1",
                "Q5FVG7-1",
                "D3ZCD0-1",
                "A0A8I5ZP97-1",
                "A0A0G2JW59-1",
                "B1WC09-1",
                "Q01134-1",
                "P11980-1",
                "G3V783-1",
                "Q9UM73-1",
                "O15146-1",
                "P42679-1",
                "P08922-1",
                "P07947-1",
                "Q12866-1",
                "P00519-1",
                "Q07912-1",
                "P42684-1",
                "Q9UF33-1",
                "P10721-1",
                "P08069-1",
                "P06239-1",
                "P51451-1",
                "Q06187-1",
                "P51813-1",
                "Q9UIG0-1",
                "P49760-1",
                "P49761-4",
                "Q9HAZ1-1",
                "P49759-1",
                "P07333-1",
                "Q5JZY3-1",
                "Q6XUX3-1",
                "P00533-1",
                "Q9Y463-1",
                "P29317-1",
                "Q9NR20-1",
                "Q13627-1",
                "P54760-1",
                "P41240-1",
                "Q16832-1",
                "Q15375-1",
                "P29323-1",
                "P22455-1",
                "P16591-1",
                "P29322-1",
                "P54756-1",
                "P29320-1",
                "Q08345-1",
                "Q92630-1",
                "Q05397-1",
                "P54753-1",
                "Q15303-1",
                "P36888-1",
                "P04626-1",
                "P21860-1",
                "Q14289-1",
                "O43781-1",
                "P54764-1",
                "P19525-1",
                "P21709-1",
                "P54762-1",
                "P22607-1",
                "P21802-1",
                "P52333-1",
                "P11362-1",
                "P42685-1",
                "P06213-1",
                "P14616-1",
                "Q05655-1",
                "Q08881-1",
                "P07332-1",
                "P08631-1",
                "P29376-1",
                "O60674-1",
                "P23458-1",
                "P09769-1",
                "P43405-1",
                "P06241-1",
                "P07948-1",
                "P46734-1",
                "P45985-1",
                "Q02750-1",
                "P52564-1",
                "O14733-1",
                "Q13163-1",
                "Q16288-1",
                "P36507-1",
                "Q16620-1",
                "P08581-1",
                "P04629-1",
                "Q14680-1",
                "Q01974-1",
                "P09619-1",
                "P07949-1",
                "Q504Y2-1",
                "P34925-1",
                "P16234-1",
                "Q13882-1",
                "Q04912-1",
                "O43353-1",
                "Q06418-1",
                "P30530-1",
                "Q96KB5-1",
                "Q15569-1",
                "Q96S53-1",
                "Q6J9G0-1",
                "P42680-1",
                "P35916-2",
                "P0C1S8-1",
                "P17948-1",
                "P29597-1",
                "P42681-1",
                "P35590-1",
                "Q13470-1",
                "P33981-1",
                "P30291-1",
                "P12931-1",
                "P35968-1",
                "P43403-1",
                "O75716-1",
                "Q02763-1",
                "Q9H3Y6-1",
                "P35790-1",
                "P14618-1",
                "P24604-1",
                "O54967-1",
                "P00520-1",
                "Q9Z188-1",
                "P35969-1",
                "P52332-1",
                "P08923-1",
                "Q00342-1",
                "Q62120-1",
                "Q4JIM5-1",
                "P97504-1",
                "P42682-1",
                "Q60629-1",
                "P97793-1",
                "P16277-1",
                "O35491-1",
                "O35492-1",
                "O35493-1",
                "Q9Z277-1",
                "P35991-1",
                "P22518-1",
                "Q8BYG9-1",
                "P54754-1",
                "P54761-1",
                "Q6XUX1-1",
                "Q62371-1",
                "Q60750-1",
                "Q61527-1",
                "Q62413-1",
                "Q61214-1",
                "Q61772-1",
                "Q61851-1",
                "Q922Y0-1",
                "Q922K9-1",
                "O09127-1",
                "P16092-1",
                "Q03142-1",
                "P29319-1",
                "Q01279-1",
                "P70424-1",
                "P21803-1",
                "Q8CBF3-1",
                "P41241-1",
                "Q03963-1",
                "Q8BI55-1",
                "P54763-3",
                "P16879-1",
                "P09581-1",
                "P34152-3",
                "P14234-1",
                "P39688-1",
                "Q03146-1",
                "Q03145-1",
                "Q61526-1",
                "P70451-1",
                "Q5U4C9-1",
                "Q9QVP9-1",
                "Q03137-1",
                "Q60751-1",
                "Q62137-1",
                "P28867-1",
                "P25911-1",
                "P48025-1",
                "Q9WTL4-1",
                "P41242-1",
                "P05532-1",
                "P06240-1",
                "P08103-1",
                "P15208-1",
                "Q03526-1",
                "Q9WVS7-1",
                "P70236-1",
                "P31938-1",
                "P47809-1",
                "Q61846-1",
                "Q60805-1",
                "Q63932-1",
                "O09110-1",
                "P26618-1",
                "Q8CE90-1",
                "P16056-1",
                "P05622-1",
                "P15209-1",
                "Q6VNS1-1",
                "Q61006-1",
                "Q3UFB7-1",
                "Q5RJI4-1",
                "Q9JJ78-1",
                "P58801-1",
                "P55144-1",
                "Q8VCT9-1",
                "O70146-1",
                "Q62190-1",
                "Q62270-1",
                "P35546-1",
                "P35761-1",
                "Q9Z138-1",
                "Q9R117-1",
                "O88697-1",
                "P05480-2",
                "Q01887-1",
                "Q02858-1",
                "Q06806-1",
                "Q00993-1",
                "Q64434-1",
                "Q78DX7-1",
                "Q6J9G1-1",
                "Q99ML2-1",
                "P43404-1",
                "P35917-1",
                "P47810-1",
                "P35918-1",
                "Q04736-1",
                "Q66JT0-1",
                "O54804-1",
                "P52480-1",
                "P14680-1",
                "P21965-1",
                "P22216-1",
                "P32490-1",
                "P06784-1",
                "P08018-1",
                "P32350-1",
                "P32491-1",
                "P54199-1",
                "Q54G28-1",
                "Q54N73-1",
                "Q54R58-1",
                "P18160-1",
                "P18161-1",
                "Q54BC9-1",
                "Q54I36-1",
                "Q54QV3-1",
                "Q552C6-1",
                "Q55CL6-1",
                "Q75JK0-1",
                "Q76NV1-1",
                "Q23977-1",
                "P18475-1",
                "P09208-1",
                "P13368-1",
                "Q24145-1",
                "Q24488-1",
                "Q27324-1",
                "P08630-1",
                "P00522-1",
                "P00528-1",
                "P04412-1",
                "Q9V422-1",
                "Q9V6K3-1",
                "Q9V9J3-1",
                "Q9VBW3-1",
                "P49762-1",
                "P83102-1",
                "Q24324-1",
                "Q9VPC0-1",
                "P49657-1",
                "P54350-1",
                "P18106-4",
                "Q07407-1",
                "Q09147-1",
                "Q24592-1",
                "Q9I7F7-1",
                "Q9V3D5-1",
                "Q9VZI2-1",
                "Q9V4E5-1",
                "Q8INJ8-1",
                "Q7KJ08-1",
                "Q9VJ04-1"
            ],
            "evidence": [
                {
                    "id": "10596",
                    "database": "Rhea",
                    "url": "https://www.rhea-db.org/rhea/10596"
                }
            ]
        },
        {
            "id": "R-HSA-201486",
            "name": "ALK binds ligand pleiotrophin (PTN)",
            "equation": "",
            "summary": "Pleiotrophin (PTN) is a secreted growth factor that induces neurite outgrowth. The receptor tyrosine kinase anaplastic lymphoma kinase (ALK) binds PTN and transduces PTN-mediated signals through RAS, PI3K, PLCG1 and IRS1 (Stoica et al. 2001, Bowden et al. 2002), as well as through GSK3B/CTTNB1 (Yanagisawa et al. 2010).",
            "cellular_location": "extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-201486",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201486"
                }
            ]
        },
        {
            "id": "R-HSA-201510",
            "name": "PI3K synthesizes PIP3 downstream of ALK",
            "equation": "",
            "summary": "PI3K phosphorylates PIP2 to PIP3 downstream of activated ALK, leading to activation of the AKT pathway as assessed by S473 phosphorylation (Bai et al, 2000; Slupianek et al, 2001; Slupianek et al, 2004; Chen et al, 2008).  AKT signaling contributes to apoptotic escape and cellular proliferation through regulation of proteins such as CDKN1B/p27, CCND2 and BCL2L11/BIM, among others (Gu et al, 2004; Rassidakis et al, 2005; Marzec et al, 2007; reviewed in Chiarle et al, 2008).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P42336-1",
                "Q9UM73-1",
                "P42338-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-201510",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201510"
                }
            ]
        },
        {
            "id": "R-HSA-201515",
            "name": "Active ALK recruits PI3K",
            "equation": "",
            "summary": "Activated ALK recruits PI3K (Phosphatidylinositol 3-kinase catalytic subunit). The binding is probably mediated by an adaptor protein that has not yet been identified (Bai et al, 2000; Slupianek et al, 2001; reviewed in Chiarle et al, 2008).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P42336-1",
                "Q9UM73-1",
                "P42338-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-201515",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201515"
                }
            ]
        },
        {
            "id": "R-HSA-201519",
            "name": "ALK:PTN dimerization",
            "equation": "",
            "summary": "Binding of PTN is believed to induce ALK receptor dimerization, similar to other receptor tyrosine kinases (reviewed in Roskoski, 2013; Della Corte et al, 2018). Consistent with this, studies in rat with enforced dimerization of ALK lead to receptor activation, downstream signaling and neurite outgrowth in PC12 cells (Gouzi et al, 2005).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-201519",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201519"
                }
            ]
        },
        {
            "id": "R-HSA-201521",
            "name": "ALK autophosphorylation downstream of PTN and MDK",
            "equation": "",
            "summary": "ALK1 is phosphorylated on tyrosine residues in intracellular domain after ligand binding and dimerization, consistent with other receptor tyrosine kinases (Soutto et al, 2001; Stoica et al, 2002; Perez-Pinera et al, 2007; Lee et al, 2010; reviewed in Roskoski, 2013; Della Corte et al, 2018). ALK1, like other members of the insulin receptor subfamily, has a YXXXXYY motif in the activation loop. Trans-phosphorylation of the three tyrosine residues in the activation (Y1278, Y1282 and Y1283) after ligand binding causes a conformational change that relieves autoinhibition of the kinase (Donella-Deana et al, 2005; Tartari et al, 2007; Lee et al, 2010; reviewed in Roskoski et al, 2013). ALK also contains a number of tyrosine residues in the juxtamembrane domain region, at positions 1078, 1092, 1096, 1131, 1358, 1507 and 1604, among others (Rush et al, 2005; Kuo et al, 2007; Degoutin et al, 2007; reviewed in Roskoski, 2013). Whether phosphorylation of these residues precedes activation loop phosphorylation, as is the case for other RTKs, remains to be investigated. In addition, some sites may be phosphorylated by other cellular kinases after ALK auto-phosphorylation (reviewed in Klug et al, 2018; Roskoski, 2013).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-201521",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201521"
                }
            ]
        },
        {
            "id": "R-HSA-9667914",
            "name": "ALK binds ligand midkine (MDK)",
            "equation": "",
            "summary": "ALK receptor tyrosine kinase binds to secreted growth factor midkine (MDK), homologous to pleiotrophin (PTN) (Stoica et al, 2002). MDK activates PI3K signaling (Stoica et al. 2002) and IRS1/NFKB signaling (Kuo et al, 2007) downstream of ALK.",
            "cellular_location": "extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9667914",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9667914"
                }
            ]
        },
        {
            "id": "R-HSA-9700114",
            "name": "NVP-TAE684-resistant ALK mutants don't bind NVP-TAE684",
            "equation": "",
            "summary": "The following ALK mutants are resistant to inhibiton by NVP-TAE684<br><br>ALK L1152R: Sasaki et al, 2011<br>ALK T1171N: Ceccon et al, 2013<br>ALK L1198P: Heuckmann et al, 2011<br>ALK D1203N: Heuckmann et al, 2011<br>ALK A1234T: George et al, 2008<br>",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700114",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700114"
                }
            ]
        },
        {
            "id": "R-HSA-9700131",
            "name": "ALK mutants bind type I TKIs",
            "equation": "",
            "summary": "The following ALK mutants and fusion proteins are sensitive to these type I tyrosine kinase inhibitors:  <br>crizotinib: <br><br>ALK F1174V: Ceccon et al, 2015<br>ALK L1198F: Chuang et al, 2019; Ceccon et al, 2015<br>BCL11A(1-219)InsDHPPA-ALK(1058-1620): Tian et al, 2017  <br>BIRC6(1-958)-ALK(1058-1620): Shan et al, 2015 <br>EIF2AK3(30-144)-ALK(1058-1620): Ali et al, 2016<br>EML4(1-223)-ALK(1059-1620): Ali et al, 2016<br>EML4(1-223)insKMSTREKNSQV-ALK(1059-1620): Ali et al, 2016<br>EML4(1-486)-ALK(1058-1620): Ali et al, 2016; Hrustanovic et al, 2015; Katayama et al, 2011<br>FN1(32-1201)-ALK(1022-1620): Ren et al, 2012<br>HIP1(1-1019)-ALK(1058-1620): Ou et al, 2014<br>HIP1(1-963)-ALK(1058-1620): Hong et al, 2014<br>HIP1(1-719)InsL-ALK(1059-1620): Fang et al, 2014<br>PPM1B (1-282)-ALK(1058-1620): Ali et al, 2016 <br>PRKAR1A(1-183)-ALK(1058-1620): Ali et al, 2016 <br>STRN(1-137)-ALK(1058-1620): Kelly et al, 2014<br><br><br>NVP-TAE684: <br><br>ALK F1174L: George et al, 2008; Heuckmann et al, 2011<br>ALK V1180L: Katayama et al, 2014<br>ALK L1196M: Heuckmann et al, 2011<br>ALK L1196Q: Ceccon et al, 2013<br>ALK G1269S: Heuckmann, 2011<br>ALK R1275Q: George, 2008<br>CLTC(2-1634)-ALK(1059-1620): Cerchietti et al, 2011 <br>EML4(1-223)insKMSTREKNSQV -ALK(1059-1620): Heuckmann, 2011<br>FN1(32-1201)-ALK(1022-1620): Ren et al, 2012<br>NPM1(1-117)-ALK(1058-1620): Galkin et al, 2007 <br>STRN(1-137)-ALK(1058-1620): Kelly et al, 2014<br><br>ceritinib: <br><br>ALK I1171T: Friboulet et al, 2014; Katayama et al, 2014<br>ALK F1174V: Ceccon et al, 2015<br>ALK V1180L: Katayama et al, 2014<br>ALK S1206Y: Friboulet et al, 2014;<br>ALK G1269A: Friboulet et al, 2014;<br>EML4(1-486)-ALK(1058-1620): Hrustanovic et al, 2015<br><br>brigatinib: <br><br>ALK F1174V: Ceccon et al, 2015<br>ALK V1180L: Katayama et al, 2014<br>ALK L1196Q: Ceccon et al, 2013<br>NPM1(1-117)-ALK(1058-1620): Ceccon et al, 2015<br><br><br>alectinib: <br><br>ALK F1174I: Ou et al, 2016<br>ALK F1174L: Ou et al, 2016<br>ALK F1174V: Ou et al, 2016; Ceccon et al, 2015 (moderate)<br>EML4(1-223)-ALK(1059-1620): Ou et al, 2014<br>EML4(1-223)insKMSTREKNSQV-ALK(1059-1620): Ou et al, 2014<br>EML4(1-486)-ALK(1058-1620): Davare et al, 2015<br>HIP1(1-1019)-ALK(1058-1620):Ou et al, 2014<br><br>ASP3026:<br><br>ALK V1180L: Katayama et al, 2014<br><br>Entrectinib:<br><br>ALK C1156Y: Ardini et al, 2016<br>ALK L1196M: Ardini et al, 2016<br>EML4(1-223)-ALK(1059-1620): Ardini et al, 2016<br>EML4(1-223)insKMSTREKNSQV-ALK(1059-1620): Ardini et al, 2016<br>EML4(1-486)-ALK(1058-1620): Ardini et al, 2016<br>NPM1(1-117)-ALK(1058-1620): Ardini et al, 2016<br>",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1",
                "O75688-1",
                "Q9NR09-1",
                "Q9NZJ5-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700131",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700131"
                }
            ]
        },
        {
            "id": "R-HSA-9700137",
            "name": "ALK:MDK dimerization",
            "equation": "",
            "summary": "Binding of MDK is believed to induce ALK receptor dimerization, similar to other receptor tyrosine kinases (reviewed in Roskoski, 2013; Della Corte et al, 2018). Consistent with this, studies in rat with enforced dimerization of ALK lead to receptor activation, downstream signaling and neurite outgrowth in PC12 cells (Gouzi et al, 2005).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700137",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700137"
                }
            ]
        },
        {
            "id": "R-HSA-9700142",
            "name": "Active ALK binds FRS2",
            "equation": "",
            "summary": "The adaptor protein FRS2 binds activated ALK. Recruitment and activation of FRS2 does not depend on the juxtamembrane domain or any of the identified phosphotyrosine binding (PTB) NXXpY sites of ALK, and the binding site remains to be determined (Chikamori et al, 2007; Degoutin et al, 2007).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700142",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700142"
                }
            ]
        },
        {
            "id": "R-HSA-9700149",
            "name": "Active ALK binds PLCG1",
            "equation": "",
            "summary": "Based on studies with the oncogenic NPM-ALK fusion, ALK is predicted to signal through the PLC gamma signaling pathway. PLCG1 binds to phosphorylated tyrosine 1604 on the activated receptor. PLCG1 signaling contributes to mitogenesis and cellular proliferation downstream of ALK signaling (Bai et al, 1998; reviewed in Chiarle et al, 2008).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P19174-1",
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700149",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700149"
                }
            ]
        },
        {
            "id": "R-HSA-9700154",
            "name": "Active ALK binds SHC1",
            "equation": "",
            "summary": "SHC1 is recruited to the ALK receptor after activation (Motegi et al, 2004; Degoutin et al, 2007; Kuo et al, 2007). The p46 and p52 isoforms of SHC1 bind to ALK phospho-tyrosine 1507 in a manner that depends on ALK kinase activity (Degoutin et al, 2007). SHC recruitment contributes to activation of MAP kinase signaling and cellular proliferation downstream of ALK signaling,  as well as neurite outgrowth and differentiation in PC-12 cells (Souttou et al, 2001; Motegi et al, 2004; Moog-Lutz et al, 2005; Gouzi et al, 2005; Degoutin et al, 2007; reveiwed in Chiarle et al, 2009).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700154",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700154"
                }
            ]
        },
        {
            "id": "R-HSA-9700156",
            "name": "Active ALK dimer binds IRS1",
            "equation": "",
            "summary": "Phosphorylated tyrosine 1096 is the docking site for IRS1 on the active ALK receptor. IRS-mediated signaling simulates the MAP kinase and PI3K pathways and contributes to cellular proliferation in a manner that depends on ALK kinase activity (Motegi et al, 2004; Kuo et al, 2007; reviewed in Roskoski, 2013; Della Corte et al, 2018).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700156",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700156"
                }
            ]
        },
        {
            "id": "R-HSA-9700164",
            "name": "Active ALK phosphorylates FRS2",
            "equation": "",
            "summary": "FRS2 is phosphorylated downstream of ALK in a manner that depends on ALK kinase activity (Degoutin et al, 2007).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700164",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700164"
                }
            ]
        },
        {
            "id": "R-HSA-9700168",
            "name": "Active ALK phosphorylates IRS1",
            "equation": "",
            "summary": "IRS1 is phosphorylated downstream of active ALK1 in a manner that is dependent on ALK kinase activity. Based on studies in NPM-ALK fusions, ALK likely phosphorylates IRS1 on one or more tyrosine residues, but the target amino acid(s) have not been identified directly in the context of the full-length ALK receptor (Fujimoto et al 1996; Stoica et al, 2001; Motegi et al, 2004; reviewed in Roskoski, 2013; Delle Corte et al, 2018). ALK-dependent IRS phosphorylation activates the MAP kinase signaling pathway and promotes cellular proliferation, but direct binding of a RAS GEF such as GRB2:SOS1 has not been shown (reviewed in Chiarle et al, 2008; Roskoski, 2013).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700168",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700168"
                }
            ]
        },
        {
            "id": "R-HSA-9700171",
            "name": "Active ALK phosphorylates PLCG1",
            "equation": "",
            "summary": "Based on studies with the NPM-ALK fusion, ALK is predicted to phosphorylate PLCG downstream of dimerization and autophosphorylation. PLCG signaling contributes to cellular proliferation downstream of ALK, and mutation of the ALK PLCG binding site eliminates the growth-factor independent transformation of Ba/F3 cells (Bai et al, 1998; reviewed in Chiarle et al, 2008; Palmer et al, 2009).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P19174-1",
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700171",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700171"
                }
            ]
        },
        {
            "id": "R-HSA-9700175",
            "name": "Active ALK phosphorylates SHC1",
            "equation": "",
            "summary": "SHC1 is phosphorylated downstream of active ALK in a manner that depends on ALK kinase activity (Degoutin et al, 2007). SHC signaling downstream of the ALK receptor contributes to MAP kinase signaling and cellular proliferation and differentiation (Degoutin et al, 2007; Motegi et al, 2004; reviewed in Chiarle et al, 2008; Roskoski, 2013).  The exact sites of SHC1 phosphorylation in the context of ALK signaling have not been explicitly demonstrated, but are presumed to be the canonical tyrosine phosphorylation sites of active SHC1 (reviewed in Ravichandran, 2001).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700175",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700175"
                }
            ]
        },
        {
            "id": "R-HSA-9700184",
            "name": "Ligand-independent dimerization of point mutants of ALK",
            "equation": "",
            "summary": "In addition activation by translocations that lead to the formation of ALK fusion proteins, the ALK locus is also subject to activating point mutations (reviewed in Roskoski, 2013; Hallberg and Palmer, 2016; Della Corte et al, 2018). ALK mutations are most prevalent in neuroblastoma, where they are present in 7% of sporadic and up to 50% of familial cases, but also occur at lower frequencies in non-small cell lung cancer, anaplastic thyroid cancer among other cancers (Mosse et al, 2008; Chand et al, 2013; Schonherr et al, 2011; George et al, 2008; Janoueix-Lerousy et al, 2008; reviewed in Della Corte et al, 2018). Missense mutations tend to cluster in the kinase domain, but are also found in the juxtamembrane and extracellular regions (Chen et al, 2008; Murugan et al, 2011; Wang et al, 2011). Activating mutations have been shown in several cases to lead to ligand-independent dimerization and activation, and to promote oncogenic transformation in vitro and in vivo, while some ALK mutations identified in cancers retain dependence on ligand binding (Chand et al, 2008; Schonherr et al, 2011; Chen et al, 2008; George et al, 2008; Mosse et al, 2008; Ceccon et al, 2013; Ceccon et al, 2015; Murugan et al, 2011; Wang et al, 2011; reviewed in Della Corte et al, 2018).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700184",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700184"
                }
            ]
        },
        {
            "id": "R-HSA-9700186",
            "name": "Autophosphorylation of point mutants of ALK",
            "equation": "",
            "summary": "Oncogenic point mutations in ALK promote ligand-independent transautophosphorylation, leading to constitutive downstream signaling though pathways such as the MAP kinase, PI3K-AKT, PLC gamma and STAT3 cascades (Chen et al, 2008; Mosse et al, 2008; George et al, 2008; Wang et al, 2011; Ceccon et al, 2013; Ceccon et al, 2015; reviewed in Hallberg and Palmer, 2013; Della Corte et al, 2018).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700186",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700186"
                }
            ]
        },
        {
            "id": "R-HSA-9700190",
            "name": "ALK mutants bind SHC",
            "equation": "",
            "summary": "Early studies with the NPM-ALK fusion identified two putative consensus sequences for phosphotyrosine binding proteins such as SHC. Coimmunoprecipitation studies in NIH 3T3 cells determined that the predominant SHC binding site is at tyrosine 567 (equivalent to Y1507 in the full length protein). SHC is tyrosine phosphorylated and associated with both  NPM-ALK and GRB2 in these cells (Fujimoto et al, 1996). SHC has also been demonstrated to be a target of ALK-mediated phosphorylation in ALK-amplified neuroblastoma cells (Miyake et al, 2002). Mutation of the Y567 binding site to F abrogates the binding of SHC to the fusion protein, but does not eliminate the transforming activity of the protein, suggesting that SHC binding is not essential to cellular transformation (Fujimoto et al, 1996). SHC has also been shown to bind to other ALK fusions, including those with TFG, ATIC and FN1 and to contribute to signaling and transformation to various extents (Hernandez et al, 2002; Trinei et al, 2000; Ren et al, 2012; Okubo et al, 2012; Cazes et al, 2013reviewed in Hallberg and Palmer, 2013; Hallberg and Palmer, 2016; Roskoski, 2013)",
            "cellular_location": "cytosol",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700190",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700190"
                }
            ]
        },
        {
            "id": "R-HSA-9700193",
            "name": "ALK mutants phosphorylate SHC1",
            "equation": "",
            "summary": "SHC is tyrosine phosphorylated downstream of ALK fusion proteins. SHC may stimulate signaling through the MAP kinase cascade by virtue of its interaction with GRB2. The relative importance of this pathway to the oncogenic properties varies somewhat among different fusion proteins (Fujimoto et al, 1996; Trinei et al, 2000; Hernandez et al, 2002; Ren et al, 2012; reviewed in Hallberg and Palmer, 2013; Hallberg and Palmer, 2016).",
            "cellular_location": "cytosol",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700193",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700193"
                }
            ]
        },
        {
            "id": "R-HSA-9700200",
            "name": "PTPRZ dephosphorylates ligand-bound ALK dimers",
            "equation": "",
            "summary": "ALK is dephosphorylated by PTPRZ leading to loss of activity (Perez-Pinera et al, 2007). <br>Some studies suggest that, rather than being canonically activated by direct binding of PTN and MDK, ALK is activated in a ligand-independent manner by the binding of these ligands to PTPRZ (and possibly PTPRB) instead. PTN- and MDK-binding to PTPRZ/B promotes their oligomerization and catalytic inactivation, thus inhibiting the phosphatase activity and allowing the autoactivation of ALK to predominate (Perez-Pinera et al, 2007; Fukada et al, 2006; Maeda et al, 1999; Kuboyama et al, 2016; reviewed in Deuel, 2013). Discrepancies between these two models remain to be worked out.",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1",
                "P23471-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700200",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700200"
                }
            ]
        },
        {
            "id": "R-HSA-9700646",
            "name": "ASP-3026- resistant ALK mutants don't bind ASP-3026",
            "equation": "",
            "summary": "The following ALK mutants are resistant to inhibition by ASP-3026:<br><br>ALK T1551M: Amin et al 2016<br>ALK I1171S: Amin et al 2016<br>ALK I1171T: Katayama et al, 2014<br>ALK F1174L: Amin et al, 2016 (moderate)<br>ALKR 1192P: Amin et al, 2016<br>ALK G1269A: Amin et al, 2016 (moderate)",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700646",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700646"
                }
            ]
        },
        {
            "id": "R-HSA-9700647",
            "name": "Active ALK phosphorylates SRC",
            "equation": "",
            "summary": "SRC is phosphorylated on tyrosine 419 and tyrosine 216 downstream of activated ALK (Cussac et al, 2004). SRC signaling contributes to cellular proliferation, potentially through GRB2-SOS1 mediated RAS activation, although this has not been explicitly demonstrated (Cussac et al, 2004; reviewed in Chiarle et al, 2008; Palmer et al, 2009).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700647",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700647"
                }
            ]
        },
        {
            "id": "R-HSA-9700648",
            "name": "Active ALK binds SRC",
            "equation": "",
            "summary": "Based on studies with the oncogenic fusion protein NPM-ALK, SRC (and potentially other SRC-family members) binds to activated ALK receptor. Binding depends on tyrosine residue 1358 and ALK kinase activity, identifying pY1358 as the SRC-binding site (Cussac et al, 2004). SRC signaling downstream of ALK contributes to cellular proliferation (Cussac et al, 2004; reviewed in Chiarle et al, 2008; Palmer et al, 2009).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700648",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700648"
                }
            ]
        },
        {
            "id": "R-HSA-9700656",
            "name": "alectinib resistant ALK mutants don't bind alectinib",
            "equation": "",
            "summary": "The following ALK mutants show resistance to alectinib:<br><br>ALK L1122V: Ceccon et al, 2015<br>ALK I1171N: Toyokawa et al, 2014; Ou et al, 2014; Gainor et al, 2016<br>ALK I1171S: Gainor et al 2016; Ou et al, 2014; Ou et al, 2016<br>ALK I1171T: Gainor et al, 2016; Ou et al, 2014; Zdzalik et al, 2014; Katayama et al, 2014<br>ALK F1174C: Ou et al, 2016<br>ALK V1180L: Katayama et al, 2014<br>ALK L1196M: Ceccon et al, 2015 (moderate); Gainor et al, 2016<br>ALK L1198F: Ceccon et al, 2015<br>ALK G1202R: Makimoto et al, 2019; Lin et al, 2016; Gainor et al, 2016<br>ALK S1206C: Ceccon et al, 2015<br><br>",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700656",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700656"
                }
            ]
        },
        {
            "id": "R-HSA-9700658",
            "name": "ceritinib-resistant ALK mutants don't bind ceritinib",
            "equation": "",
            "summary": "The following ALK mutants are resistant to inhibition by ceritinib:<br><br>ALK L1122V: Ceccon et al, 2015<br>ALK I1171S: Amin et al, 2016<br>ALK F1174C: Gainor et al, 2016; Friboulet et al, 2014<br>ALK F1174L: Gainor et al, 2016; Wang et al, 2017<br>ALK F1174V: Friboulet et al, 2014<br>ALK L1196M: Friboulet et al, 2014; Gainor et al, 2016; Ceccon et al, 2015<br>ALK L1198F: Ceccon et al, 2015<br>ALK G1202R: Gainor et al, 2016; Friboulet et al, 2014; Lee et al, 2019<br>ALK D1203N: Wang et al, 2017<br>ALK S1206C: Ceccon et al, 2015<br>ALK G1269A: Friboulet et al, 2014<br><br>",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700658",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700658"
                }
            ]
        },
        {
            "id": "R-HSA-9700662",
            "name": "(PTN/MDK):ALK dimer binds type I ALK-binding TKIs",
            "equation": "",
            "summary": "ALK can be bound and inhibited by type I tyrosine kinase inhibitors. Type I inhibitors bind in the ATP-binding site of the active conformation and prevent activation of the kinase (reviewed in Klug et al 2018; Roskoski, 2013). Crizotinib was one the first inhibitors ALK inhibitors to be approved for use in ALK+ cancers (reviewed in Rodig et al, 2010; Ou et al, 2011; Gambacorti et al, 2011). Accumulation of secondary mutations leads to acquired crizotinib resistance and has prompted the development of second-and third generation inhibitors such as ceritinib, alectinib, brigatinib and lorlatinib, among others (Ou et al, 2014; Ou et al, 2016; Shaw et al, 2015; Ceccon et al, 2013; Ceccon et al, 2015; Zhang et al, 2016; Shaw et al, 2014; Recondo et al, 2020; Galkin et al, 2006; reviewed in Della Corte et al, 2018).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9700662",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700662"
                }
            ]
        },
        {
            "id": "R-HSA-9701485",
            "name": "Active ALK binds JAK3",
            "equation": "",
            "summary": "Based on studies with NPM-ALK fusion proteins, ALK appears to signal through JAK3 in a manner that depends on JAK3-ALK binding (Zamo et al, 2002; Amin et al, 2003; Lai et al, 2005). When co-expressed in HEK293 cells, JAK3 binds to residues corresponding to 1058 to 1077 of the full length ALK receptor (Zamo et al, 2002). Although JAK3 often signals through recruitment and phosphorylation of STAT3, it is unclear whether STAT3 activation downstream of ALK depends on JAK3 (Zamo et al, 2002; Amin et al, 2003; Marzec et al, 2005; Han et al, 2006 a,b; Lai et al, 2005; Shi et al, 2006; reviewed in Palmer et al, 2009).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P52333-1",
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9701485",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9701485"
                }
            ]
        },
        {
            "id": "R-HSA-9701488",
            "name": "Active ALK phosphorylates JAK3",
            "equation": "",
            "summary": "JAK3 is phosphorylated downstream of active ALK signaling (Zamo et al, 2002; Amin et al, 2003; Lai et al, 2005; Han et al, 2006a, b) Signaling through JAK3 and STAT3 contributes to cellular survival downstream of ALK signaling (Lai et al, 2005; Shi et al, 2006; reviewed in Palmer et al, 2009).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P52333-1",
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9701488",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9701488"
                }
            ]
        },
        {
            "id": "R-HSA-9701507",
            "name": "PTPN6 dephosphorylates JAK3",
            "equation": "",
            "summary": "PTPN6, also known as SHP1, dephosphorylates JAK3 downstream of ALK signaling, leading to the inactivation and increased proteolytic degradation of JAK3 (Han et al, 2006 a, b; reviewed in Palmer et al, 2009; Chiarle et al, 2008). PTPN6 gene expression is lost in some cases of anaplastic large cell lymphoma (ALCL) due to changes in promoter methylation, resulting in increased JAK3 activity in these cancers (Khoury et al, 2004; reviewed in Chiarle et al, 2008; Palmer et al, 2009).",
            "cellular_location": "cytosol",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P52333-1",
                "Q9UM73-1",
                "P29350-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9701507",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9701507"
                }
            ]
        },
        {
            "id": "R-HSA-9701524",
            "name": "STAT3 is phosphorylated downstream of active ALK",
            "equation": "",
            "summary": "STAT3 is phosphorylated at tyrosine 705 downstream of active ALK and oncogenic ALK fusion proteins and contributes to cellular survival (Zamo et al, 2002; Zhang et al, 2002; Amin et al, 2003; Chiarle et al, 2003; Chiarle et al, 2005; reviewed in Chiarle et al, 2008; Palmer et al, 2009). Whether STAT3 activation downstream of ALK is mediated directly by the receptor itself or depends on JAK3 is controversial (Zhang et al, 2002; Han et al 2006 a,b; Lai et al, 2005; Marzec et al. 2005; Shi et al, 2006; reviewed in Palmer et al, 2009). STAT3 is also phosphorylated at serine 727 in a manner that depends on the PI3K, mTOR and MAPK pathways. The functional significance of S727 phsophorylation is not entirely clear (Gambi et al, 2019). STAT3 supports cell survival by promoting the expression of a number of cell cycle and anti-apoptotic genes (reviewed in Chiarle et al, 2008).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [
                "R-HSA-539048"
            ],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9701524",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9701524"
                }
            ]
        },
        {
            "id": "R-HSA-9701810",
            "name": "MECP2 binds the STAT5A gene",
            "equation": "",
            "summary": "Expression of STAT5A is abrogated in cells expressing NPM-ALK fusions by high levels of promoter methylation. Hypermethylation of the STAT5A enhancer provides binding sites for the methyl binding protein MeCP2 as assessed by chromatin immunoprecipitation, and precludes binding of the normal transcriptional activator Sp1. As a consequence of these events, STAT5A expression is repressed in NPM-ALK + T-cell lymphomas. siRNA-mediated depletion of the NPM-ALK effector STAT3 restores STAT5A expression in these cells, highlighting the role for STAT3 in NPM-ALK-mediated oncogenesis (Zhang et al, 2007; Zhang et al, 2002).",
            "cellular_location": "nucleoplasm",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9701810",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9701810"
                }
            ]
        },
        {
            "id": "R-HSA-9712078",
            "name": "ALK mutants bind PI3KR1",
            "equation": "",
            "summary": "Various ALK fusions and point mutants have been shown to form stable, active complexes with the PI3K and to activate downstream signaling through AKT/PKB (Bai et al, 2000; Slupianek et al, 2001; Slupianek and Tomasz, 2004; Marzec et al, 2007; Chen et al, 2008; Chand et al, 2013; George et al, 2008; Janoieux-Lerousey et al, 2008; Wong et al, 2011; Cerchietti et al, 2011; Wiesner et al, 2014; Koivunen et al, 2008; Ren et al, 2012; Cazes et al, 2013; Okubo et al, 2103; reviewed in Della Corte et al, 2018; Hallberg and Palmer, 2013; Ducray et al, 2019). Attempts to define a binding site for the p85 regulatory subunit of PI3K on NPM-ALK identified fragment with a putative p85 phospho-tyrosine binding site that was capable of blocking the interaction of PIK3R1 when co-expressed. In spite of this, mutation of the putative tyrosine residue did not block PIK3R1 binding, suggesting that the interaction may be mediated by an adaptor protein. SHC, CRKL and GAB2 each formed complexes with both PIK3R1 and NPM-ALK as assessed by co-immunoprecipitation, making them candidates (Bai et al, 2000).<br>Signaling throught the PI3K/AKT pathway activates the anti-apoptotic pathway contributing to oncogenesis (Bai et al, 2000; Slupianek et al, 2001; reviewed in Rososki, 2013; Ducray et al, 2019).",
            "cellular_location": "cytosol",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9712078",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9712078"
                }
            ]
        },
        {
            "id": "R-HSA-9712079",
            "name": "ALK mutants bind STAT3",
            "equation": "",
            "summary": "The STAT3 signaling pathway is a major downstream target of several oncogenic ALK proteins (Zamo et al, 2002; Zhang et al, 2002; Amin et al, 2003; Chiarle et al, 2003; Chiarle et al, 2005; Koivunen et al, 2008; Takezawa et al, 2011; Cerchietti et al, 2011; Wong et al, 2011; Okubo et al, 2012; Cazes et al, 2013; reviewed in Chiarle et al, 2008; Hallberg and Palmer 2013; Hallberg and Palmer, 2016). STAT3 is phosphorylated at tyrosine 705 downstream of active ALK and oncogenic ALK fusion proteins and contributes to cellular survival (Zamo et al, 2002; Zhang et al, 2002; Amin et al, 2003; Chiarle et al, 2003; Chiarle et al, 2005; reviewed in Chiarle et al, 2008; Palmer et al, 2009). ; Whether STAT3 activation downstream of ALK is mediated directly by the receptor itself or depends on JAK3 is controversial (Zhang et al, 2002; Han et al 2006 a,b; Lai et al, 2005; Marzec et al. 2005; Shi et al, 2006; reviewed in Palmer et al, 2009). STAT3 is also phosphorylated at serine 727 in a manner that depends on the PI3K, mTOR and MAPK pathways. The functional significance of S727 phsophorylation is not entirely clear (Gambi et al, 2019). STAT3 supports cell survival by promoting the expression of a number of cell cycle and anti-apoptotic genes (reviewed in Chiarle et al, 2008).",
            "cellular_location": "cytosol",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9712079",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9712079"
                }
            ]
        },
        {
            "id": "R-HSA-9712083",
            "name": "ALK mutants bind PI3KCA",
            "equation": "",
            "summary": "The catalytic subunit of PI3K is recruited downstream ALK fusions and point mutants signal through the PI3K pathway as assessed by both binding and activity assays (Bai et al, 2000; Slupianek and Tomasz, 2001; Slupianek et al, 2004; Koivunen et al, 2008; George et al, 2008; Wang et al, 2011; reviewed in Roskoski, 2013; Hallberg and Palmer, 2013; Della Corte et al, 2018; Ducray et al, 2019).",
            "cellular_location": "cytosol",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P42336-1",
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9712083",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9712083"
                }
            ]
        },
        {
            "id": "R-HSA-9712084",
            "name": "PI3K synthesizes PIP3 downstream of ALK mutants",
            "equation": "",
            "summary": "PI3K phosphorylates PIP2 to PIP3 downstream of activated ALK fusions and mutants, leading to activation of the AKT pathway as assessed by S473 phosphorylation (Bai et al, 2000; Slupianek et al, 2001; Slupianek et al, 2004; Chen et al, 2008).  AKT signaling contributes to apoptotic escape and cellular proliferation through regulation of proteins such as CDKN1B/p27, CCND2 and BCL2L11/BIM, among others (Gu et al, 2004; Rassidakis et al, 2005; Marzec et al, 2007; reviewed in Chiarle et al, 2008; Hallberg and Palmer, 2013).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P42336-1",
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9712084",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9712084"
                }
            ]
        },
        {
            "id": "R-HSA-9712085",
            "name": "ALK mutants phosphorylate STAT3",
            "equation": "",
            "summary": "STAT3 is tyrosine phosphorylated at residue 705, and this phosphorylation is required for STAT3 dimerization, nuclear translocation, and DNA binding. The function of serine 727 phosphorylation is not clear, however it occurs independently of tyrosine phosphorylation (reviewed in Yu et al, 2014; Guanizo et al, 2018).",
            "cellular_location": "cytosol",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9712085",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9712085"
                }
            ]
        },
        {
            "id": "R-HSA-9715355",
            "name": "lorlatinib-resistant ALK mutants don't bind lorlatinib",
            "equation": "",
            "summary": "The following ALK mutants are resistant to inhibition by lorlatinib:<br><br>ALK I1171N: Ouseph et al, 2019<br>ALK I1171S: Takahashi et al, 2020<br>ALK L1196M: Yoda et al, 2018<br>ALK L1198F: Yoda et al, 2018<br>ALK G1202R: Kougioumtzi et al, 2019<br>ALK G1269A: Kougioumtzi et al, 2019; Takahashi et al, 2020; Yoda et al, 2018<br>",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9715355",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9715355"
                }
            ]
        },
        {
            "id": "R-HSA-9715356",
            "name": "brigatinib-resistant ALK mutants don't bind brigatinib",
            "equation": "",
            "summary": "The following ALK mutants show resistance to brigatinib:<br><br>ALK L1122V: Ceccon et al, 2015<br>ALK I1171N: Ceccon et al, 2013<br>ALK 1171S: Amin et al, 2016<br>ALK I1171T: Katayama et al, 2021 (moderate)<br>ALK L1196M: Sharma et al, 2019; Ceccon et al, 2015 (moderate) <br>ALK  L1198F: Ceccon et al, 2015<br>ALK G1202R: Sharma et al, 2019; Gainor et al, 2016<br>ALK D1203N: Gainor et al, 2016<br>ALK S1206C: Ceccon et al, 2015<br>",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9715356",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9715356"
                }
            ]
        },
        {
            "id": "R-HSA-9715357",
            "name": "crizotinib-resistant ALK mutants don't bind crizotinib",
            "equation": "",
            "summary": "The following ALK mutants show resistance to inhibition by crizotinib:<br><br>ALK L1122V: Ceccon et al, 2015 (moderate)<br>ALK T1151dup: Katayama et al, 2012<br>ALK T1151M: Noe et al, 2020<br>ALK L1152R: Sasaki et al, 2011<br>ALK C1156Y: Noe et al, 2020; Saber et al 2016; Huang et al, 2013; Choi et al, 2010; Gainor et al, 2016<br>ALK I1171N: Gainor et al, 2016; Zhang et al, 2011; Ceccon et al, 2013<br>ALK I1171S: Gainor et al, 2016; Zhang et al, 2011<br>ALK I1171T: Noe et al, 2020; Toyokawa et al, 2014; Gainor et al, 2016; Zhang et al, 2011; Zdzalik et al, 2014; Katayama et al, 2014<br>ALK F1174C: Noe et al, 2020; Friboulet et al, 2014<br>ALK F1174L: Noe et al, 2020; Sasaki et al, 2010; Heuckmann et al, 2011<br>ALK F1174V: Noe et al, 2020; Ou et al, 2014<br>ALK V1180L: Katayama et al, 2014<br>ALK L1196M: Gainor et al, 2016; Huang et al, 2013; Katayama et al, 2012; Kim et al, 2013; Choi et al, 2010; Doebele et al, 2012; Friboulet et al, 2014; Heuckmann et al, 2011; Huang et al, 2013<br>ALK L1196Q: Ceccon et al, 2013<br>ALK L1198P: Heuckmann et al, 2011<br>ALK G1202R: Katayama et al, 2012; Noe et al, 2020; Kougiomtzi et al, 2019; Gainor et al, 2016, Ou et al, 2016; Chuang et al, 2019<br>ALK D1203N: Heuckmann et al, 2011<br>ALK S1206C: Ceccon et al, 2015<br>ALK S1206F: Noe et al, 2020<br>ALK S1206Y: Gainor et al, 2016; Friboulet et al, 2014; Katayama et al, 2012; Noe et al, 2020<br>ALK G1228A: Ai et al, 2018<br>ALK G1269A: Noe et al, 2020; Saber et al, 2016; Gainor et al, 2016; Friboulet et al, 2014; Huang et al, 2013; Kim et al, 2013; Xu et al, 2019; Doebele et al, 2012; Heuckmann et al, 2011; Amin et al, 2016 <br>ALK G1269S: Heuckmann et al, 2011<br>",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9715357",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9715357"
                }
            ]
        },
        {
            "id": "R-HSA-9724099",
            "name": "ALK mutants:p-3Y SHC binds GRB2",
            "equation": "",
            "summary": "GRB2 is found in complex with SHC in cells expressing a number of ALK fusion proteins and may contribute to signaling through the MAP kinase and PI3K pathways. In some backgrounds, GRB2 may also bind directly to the fusion protein itself to promote signaling (Fukimoto et al, 1996; Hernandez et al, 2002; Trinei et al, 2000; reviewed in Hallberg and Palmer, 2013; Hallberg and Palmer, 2016; Roskoski, 2013).",
            "cellular_location": "cytosol",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9724099",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9724099"
                }
            ]
        },
        {
            "id": "R-HSA-9725117",
            "name": "ALK gene expression",
            "equation": "",
            "summary": "18-38% percent of neuroblastomas show amplification of the MYCN gene, while the majority of familial and 10% of sporadic neuroblastomas carry activating mutations in the ALK kinase domain (Mosse et al, 2008; reviewed in Aygun, 2018; Roskoski, 2013). Amplifications of the ALK gene have also been reported in this disease (Caren et al, 2008). ALK and MYCN may play cooperative roles in driving progression of neuroblastoma (Zhu et al, 2012; Mosse et al, 2008; reviewed in Roskoski, 2013).<br>High levels of ALK expression are seen in MYCN amplified neuroblastomas, and inhibition of ALK activity with tyrosine kinase inhibitors in a MYCN-amplified background reduces proliferation, cell migration and tumor growth in xenograft models, suggesting that ALK activity contributes to the oncogenic potential of MYCN-driven neuroblastomas (Hasan et al, 2013; reviewed in Hallberg and Palmer, 2013).",
            "cellular_location": "nucleoplasm, plasma membrane",
            "input_participant_list": [
                "R-HSA-9725096"
            ],
            "output_participant_list": [
                "R-HSA-201502"
            ],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9725117",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725117"
                }
            ]
        },
        {
            "id": "R-HSA-9725315",
            "name": "ALK-stimulated MYCN gene expression",
            "equation": "",
            "summary": "MYCN gene expression is stimulated downstream of wild-type and activated ALK signaling in neuronal and neuroblastoma cell lines as well as in murine neuroblastoma models (Schonherr et al, 2012; Montavon et al, 2014). MYCN and ALK are both located on chromosome 2, which is subject to amplifications in neuroblastoma, and ALK and MYCN are both implicated as contributing to neuroblastoma progression (Mosse et al, 2008; Caren et al, 2008; Hasan et al, 2012; De Brouwer et al, 2010; Montavon et al, 2012; Zhu et al, 2012). Abrogation of ALK activity with protein tyrosine kinase inhibitors or with anti-siRNA against ALK decreases MYCN transcript and protein levels, but the direct mechanisms for ALK-dependent MYCN gene expression have not been identified (Schonherr et al, 2012; Hallberg and Palmer, 2013; Roskoski, 2013).",
            "cellular_location": "nucleoplasm",
            "input_participant_list": [
                "R-HSA-9725313"
            ],
            "output_participant_list": [
                "R-HSA-452357"
            ],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9725315",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725315"
                }
            ]
        },
        {
            "id": "R-NUL-9700161",
            "name": "p-7Y ALK dimer phosphorylates Frs2",
            "equation": "",
            "summary": "Frs2 is phosphorylated in an ALK kinase-dependent manner when Frs2 and ALK are co-expressed in HEK293 cells (Degoutin et al, 2007).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-NUL-9700161",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-NUL-9700161"
                }
            ]
        },
        {
            "id": "R-NUL-9700655",
            "name": "Active ALK phosphorylates Src",
            "equation": "",
            "summary": "Endogenous Src is phosphorylated when co-expressed in Ba/F3 cells with the human NPM-ALK fusion in a manner that depends on ALK kinase activity (Cussac et al, 2004).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-NUL-9700655",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-NUL-9700655"
                }
            ]
        },
        {
            "id": "R-NUL-9700661",
            "name": "Active ALK binds Src",
            "equation": "",
            "summary": "The human NPM:ALK fusion interacts with SRC in a ALK-kinase dependent fashion when expressed in Ba/F3 cells (Cussac et al, 2004).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9UM73-1"
            ],
            "evidence": [
                {
                    "id": "R-NUL-9700661",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-NUL-9700661"
                }
            ]
        }
    ],
    "reaction_participants": [
        {
            "participant_id": "R-HSA-201502",
            "participant_name": "ALK [plasma membrane]",
            "crossref": [
                {
                    "id": "Q9UM73",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "2YFX",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5AA8",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "8ARJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2XP2",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5A9U",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4Z55",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2YJS",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5AAA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2YJR",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2YHV",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5AA9",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "HMDBP01223",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "5AAC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2YT2",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5AAB",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2YS5",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ALK_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "3L9P",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5FTQ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "17442",
                    "database": "Orphanet",
                    "url": ""
                },
                {
                    "id": "5FTO",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "3AOX",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7MZW",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000171094-ALK",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "4FNX",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4FNW",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7LS0",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4DCE",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ALK_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "ALK_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "4FOB",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4FOC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7N00",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4FNY",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4FNZ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7MZY",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4JOA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "NP_004295.2",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "7NX3",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2KUQ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2KUP",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "Q9UM73",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "4FOD",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000171094",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000389048",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000373700",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "7NWZ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7R7R",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2XBA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7R7K",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4TT7",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4MKC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7NX4",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2XB7",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6MX8",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "Q9UM73",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "4CMO",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000171094",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "6EDL",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6EBW",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4CLJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6CDT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4CD0",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6E0R",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4CLI",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4ANS",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1839",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "4CCB",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5VZ5",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ALK_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "6AT9",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4CCU",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ALK_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "4ANL",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ALK_HUMAN",
                    "database": "ZINC - Metabolites",
                    "url": ""
                },
                {
                    "id": "5IUI",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4ANQ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5KZ0",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5IMX",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "Q9UM73",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "3LCS",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "3LCT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5IUG",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5IUH",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4CTB",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7JYS",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7JYT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4CTC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ALK_HUMAN",
                    "database": "ZINC - FDA approved",
                    "url": ""
                },
                {
                    "id": "7LRZ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4CMU",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7JY4",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7JYR",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4CNH",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "Q9UM73",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "7BTT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4CMT",
                    "database": "PDB",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-452357",
            "participant_name": "MYCN [nucleoplasm]",
            "crossref": [
                {
                    "id": "P04198",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "XP_016859657.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "ENSP00000281043",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSG00000134323",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000281043",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "16494",
                    "database": "Orphanet",
                    "url": ""
                },
                {
                    "id": "7ZTL",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "NP_005369.2",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "NP_001280162.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "5G1X",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000134323-MYCN",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "NP_001280160.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "NP_001280157.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "P04198",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "P04198",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "P04198",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "ENSG00000134323",
                    "database": "OpenTargets",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-539048",
            "participant_name": "p-Y705,S727-STAT3 [cytosol]",
            "crossref": [
                {
                    "id": "P40763",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "STAT3_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "P40763",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "ENSG00000168610-STAT3",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "P40763",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "ENSG00000168610",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "P40763",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "ENST00000679014",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "STAT3_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "ENSP00000503574",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000678960",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000264657",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000503237",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000404395",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000677723",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000503102",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000467985",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000467000",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000503662",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000588969",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000384943",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSG00000168610",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000585517",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000678827",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000264657",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "6TLC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_016880461.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "STAT3_HUMAN",
                    "database": "ZINC - Metabolites",
                    "url": ""
                },
                {
                    "id": "XP_016880464.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "XP_005257674.2",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "16805",
                    "database": "Orphanet",
                    "url": ""
                },
                {
                    "id": "6NUQ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_011523447.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "XP_011523448.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "6QHD",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5AX3",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "NP_998827.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "STAT3_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "5U5S",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6NJS",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P40763",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "XP_005257673.2",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "STAT3_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "NP_003141.2",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "2994",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "NP_644805.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "STAT3_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "ENST00000677030",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000504184",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000503181",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000678044",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000678906",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000503634",
                    "database": "Ensembl",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-9725096",
            "participant_name": "ALK gene [nucleoplasm]",
            "crossref": [
                {
                    "id": "ENSG00000171094",
                    "database": "ENSEMBL",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-9725313",
            "participant_name": "MYCN gene [nucleoplasm]",
            "crossref": [
                {
                    "id": "ENSG00000134323",
                    "database": "ENSEMBL",
                    "url": ""
                }
            ]
        }
    ],
    "reaction_enzymes": [
        {
            "uniprot_ac": "A0A0G2JW59",
            "gene_name": "Flt3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A0G2JW59",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2JW59"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0G2JW59",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2JW59"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A0G2K6M9",
            "gene_name": "Btk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A0G2K6M9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2K6M9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0G2K6M9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2K6M9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A0R4J8U1",
            "gene_name": "Zap70",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A0R4J8U1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0R4J8U1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0R4J8U1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0R4J8U1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I5ZP97",
            "gene_name": "Dyrk1b",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I5ZP97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZP97"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I5ZP97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZP97"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I5ZVE3",
            "gene_name": "Ephb3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I5ZVE3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZVE3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I5ZVE3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZVE3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6A5T6",
            "gene_name": "Mst1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I6A5T6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6A5T6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6A5T6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6A5T6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6AM23",
            "gene_name": "Jak1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I6AM23",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AM23"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6AM23",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AM23"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6AWX7",
            "gene_name": "Dyrk4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I6AWX7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AWX7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6AWX7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AWX7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6GCV6",
            "gene_name": "Ltk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I6GCV6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6GCV6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6GCV6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6GCV6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "B1WC09",
            "gene_name": "Ddr2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "B1WC09",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B1WC09"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "B1WC09",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B1WC09"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "B2RYC7",
            "gene_name": "Tec",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "B2RYC7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B2RYC7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "B2RYC7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B2RYC7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "B5DFD6",
            "gene_name": "Tie1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "B5DFD6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B5DFD6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "B5DFD6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B5DFD6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZBN3",
            "gene_name": "Epha2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZBN3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZBN3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZBN3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZBN3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZCD0",
            "gene_name": "Tek",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZCD0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZCD0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZCD0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZCD0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZD03",
            "gene_name": "Tyk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZD03",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZD03"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZD03",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZD03"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZDH4",
            "gene_name": "Epha1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZDH4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZDH4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZDH4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZDH4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZDS3",
            "gene_name": "Ptk6",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZDS3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZDS3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZDS3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZDS3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZZK3",
            "gene_name": "Epha4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZZK3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZZK3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZZK3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZZK3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4A584",
            "gene_name": "Fes",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D4A584",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A584"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A584",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A584"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4A7W7",
            "gene_name": "Itk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D4A7W7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A7W7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A7W7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A7W7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4ADZ5",
            "gene_name": "Wee2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D4ADZ5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4ADZ5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4ADZ5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4ADZ5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "E9PSY0",
            "gene_name": "Axl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "E9PSY0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PSY0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "E9PSY0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PSY0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "E9PT20",
            "gene_name": "Abl1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "E9PT20",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PT20"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "E9PT20",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PT20"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LM93",
            "gene_name": "Yes1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LM93",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LM93"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LM93",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LM93"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LRZ0",
            "gene_name": "Alk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LRZ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LRZ0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LRZ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LRZ0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LSG7",
            "gene_name": "Fgfr2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LSG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LSG7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LSG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LSG7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LSN4",
            "gene_name": "Fgfr3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LSN4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LSN4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LSN4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LSN4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LVI0",
            "gene_name": "Bmx",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LVI0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LVI0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LVI0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LVI0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LYY7",
            "gene_name": "Dyrk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LYY7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LYY7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LYY7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LYY7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1M0N1",
            "gene_name": "Abl2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1M0N1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1M0N1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1M0N1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1M0N1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1MAJ0",
            "gene_name": "Ephb2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1MAJ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1MAJ0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1MAJ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1MAJ0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "G3V6K6",
            "gene_name": "Egfr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "G3V6K6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V6K6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V6K6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V6K6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "G3V783",
            "gene_name": "Ripk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "G3V783",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V783"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "G3V783",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V783"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V783",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V783"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V783",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V783"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "G3V9H8",
            "gene_name": "Ret",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "G3V9H8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V9H8"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V9H8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V9H8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "M0RDA4",
            "gene_name": "Ephb4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "M0RDA4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/M0RDA4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "M0RDA4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/M0RDA4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O08680",
            "gene_name": "Epha3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O08680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O08680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O08680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O08680"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O08775",
            "gene_name": "Kdr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O08775",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O08775"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O08775",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O08775"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O09110",
            "gene_name": "Map2k3",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O09110",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09110"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O09110",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09110"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O09127",
            "gene_name": "Epha8",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O09127",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09127"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O09127",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09127"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O14733",
            "gene_name": "MAP2K7",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O14733",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O14733"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O14733",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O14733"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O15146",
            "gene_name": "MUSK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O15146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O15146"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O15146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O15146"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O35346",
            "gene_name": "Ptk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O35346",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35346"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O35346",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35346"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O35491",
            "gene_name": "Clk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O35491",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35491"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O35491",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35491"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O35492",
            "gene_name": "Clk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O35492",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35492"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O35492",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35492"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O35493",
            "gene_name": "Clk4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O35493",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35493"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O35493",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35493"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O43353",
            "gene_name": "RIPK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O43353",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43353"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O43353",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43353"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O43353",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43353"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O43781",
            "gene_name": "DYRK3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O43781",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43781"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O43781",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43781"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O54804",
            "gene_name": "Chka",
            "activity": [
                {
                    "ec_number": "2.7.1.32",
                    "activity": "ATP + choline = ADP + H(+) + phosphocholine.",
                    "evidence": [
                        {
                            "id": "O54804",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54804"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.82",
                    "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.",
                    "evidence": [
                        {
                            "id": "O54804",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54804"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.32",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O54804",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54804"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O54967",
            "gene_name": "Tnk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O54967",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54967"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O54967",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54967"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O54967",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54967"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O54967",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54967"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O60674",
            "gene_name": "JAK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O60674",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O60674"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O60674",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O60674"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O70146",
            "gene_name": "Tesk1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O70146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O70146"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O70146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O70146"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O75688",
            "gene_name": "PPM1B",
            "activity": [
                {
                    "ec_number": "3.1.3.16",
                    "activity": "H2O + O-phospho-L-threonyl-[protein] = L-threonyl-[protein] + phosphate.",
                    "evidence": [
                        {
                            "id": "O75688",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O75688"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.3.16",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O75688",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O75688"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O75716",
            "gene_name": "STK16",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O75716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O75716"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O75716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O75716"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O75716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O75716"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O88697",
            "gene_name": "Stk16",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O88697",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O88697"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O88697",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O88697"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O88697",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O88697"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00519",
            "gene_name": "ABL1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00519",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00519"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00519",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00519"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00520",
            "gene_name": "Abl1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00520",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00520"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00520",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00520"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00522",
            "gene_name": "Abl",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00522",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00522"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00522",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00522"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00528",
            "gene_name": "Src64B",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00528",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00528"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00528",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00528"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00533",
            "gene_name": "EGFR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00533",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00533"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00533",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00533"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P04412",
            "gene_name": "Egfr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P04412",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04412"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P04412",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04412"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P04626",
            "gene_name": "ERBB2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P04626",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04626"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P04626",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04626"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P04629",
            "gene_name": "NTRK1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P04629",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04629"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P04629",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04629"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P05480",
            "gene_name": "Src",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P05480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05480"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P05480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05480"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P05532",
            "gene_name": "Kit",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P05532",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05532"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P05532",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05532"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P05622",
            "gene_name": "Pdgfrb",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P05622",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05622"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P05622",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05622"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06213",
            "gene_name": "INSR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06213",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06213"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06213",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06213"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06239",
            "gene_name": "LCK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06239",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06239"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06239",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06239"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06240",
            "gene_name": "Lck",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06240",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06240"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06240",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06240"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06241",
            "gene_name": "FYN",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06241",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06241"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06241",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06241"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06494",
            "gene_name": "Erbb2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06494",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06494"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06494",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06494"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06784",
            "gene_name": "STE7",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P06784",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06784"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06784",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06784"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07332",
            "gene_name": "FES",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07332",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07332"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07332",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07332"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07333",
            "gene_name": "CSF1R",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07333",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07333"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07333",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07333"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07947",
            "gene_name": "YES1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07947",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07947"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07947",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07947"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07948",
            "gene_name": "LYN",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07948",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07948"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07948",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07948"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07949",
            "gene_name": "RET",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07949",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07949"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07949",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07949"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08018",
            "gene_name": "PBS2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P08018",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08018"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08018",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08018"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08069",
            "gene_name": "IGF1R",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08069",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08069"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08069",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08069"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08103",
            "gene_name": "Hck",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08103",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08103"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08103",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08103"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08581",
            "gene_name": "MET",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08581",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08581"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08581",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08581"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08630",
            "gene_name": "Btk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08630",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08630"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08630",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08630"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08631",
            "gene_name": "HCK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08631",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08631"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08631",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08631"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08922",
            "gene_name": "ROS1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08922",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08922"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08922",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08922"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08923",
            "gene_name": "Ltk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08923",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08923"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08923",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08923"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09208",
            "gene_name": "InR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09208",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09208"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09208",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09208"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09215",
            "gene_name": "Prkcd",
            "activity": [
                {
                    "ec_number": "2.7.11.13",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P09215",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09215"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09215",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09215"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09581",
            "gene_name": "Csf1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09581",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09581"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09619",
            "gene_name": "PDGFRB",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09619",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09619"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09619",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09619"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09759",
            "gene_name": "Ephb1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09759"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09759"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09760",
            "gene_name": "Fer",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09760"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09769",
            "gene_name": "FGR",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09769",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09769"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09769",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09769"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P0C1S8",
            "gene_name": "WEE2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P0C1S8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P0C1S8"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P0C1S8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P0C1S8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P10721",
            "gene_name": "KIT",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P10721",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P10721"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P10721",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P10721"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P11362",
            "gene_name": "FGFR1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P11362",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11362"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P11362",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11362"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P11980",
            "gene_name": "Pkm",
            "activity": [
                {
                    "ec_number": "2.7.1.40",
                    "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.",
                    "evidence": [
                        {
                            "id": "P11980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11980"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.40",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P11980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11980"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P11980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11980"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P11980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11980"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P12931",
            "gene_name": "SRC",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P12931",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P12931"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P12931",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P12931"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P13368",
            "gene_name": "sev",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P13368",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P13368"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P13368",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P13368"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P14234",
            "gene_name": "Fgr",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P14234",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14234"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P14234",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14234"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P14616",
            "gene_name": "INSRR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P14616",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14616"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P14616",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14616"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P14618",
            "gene_name": "PKM",
            "activity": [
                {
                    "ec_number": "2.7.1.40",
                    "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.",
                    "evidence": [
                        {
                            "id": "P14618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14618"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.40",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P14618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14618"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P14618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14618"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P14618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14618"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P14680",
            "gene_name": "YAK1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14680"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P15127",
            "gene_name": "Insr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P15127",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15127"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P15127",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15127"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P15208",
            "gene_name": "Insr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P15208",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15208"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P15208",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15208"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P15209",
            "gene_name": "Ntrk2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P15209",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15209"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P15209",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15209"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16056",
            "gene_name": "Met",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16056",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16056"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16056",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16056"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16092",
            "gene_name": "Fgfr1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16092",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16092"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16092",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16092"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16234",
            "gene_name": "PDGFRA",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16234",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16234"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16234",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16234"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16277",
            "gene_name": "Blk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16277",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16277"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16277",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16277"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16591",
            "gene_name": "FER",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16591",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16591"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16591",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16591"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16879",
            "gene_name": "Fes",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16879",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16879"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16879",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16879"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P17948",
            "gene_name": "FLT1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P17948",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P17948"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P17948",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P17948"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P18106",
            "gene_name": "FER",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P18106",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18106"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P18106",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18106"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P18160",
            "gene_name": "splA",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P18160",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18160"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P18160",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18160"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P18161",
            "gene_name": "splB",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P18161",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18161"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P18161",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18161"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P18475",
            "gene_name": "tor",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P18475",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18475"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P18475",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18475"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P19174",
            "gene_name": "PLCG1",
            "activity": [
                {
                    "ec_number": "3.1.4.11",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).",
                    "evidence": [
                        {
                            "id": "P19174",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P19174"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.4.11",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P19174",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P19174"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P19525",
            "gene_name": "EIF2AK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P19525",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P19525"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P19525",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P19525"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P19525",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P19525"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P20786",
            "gene_name": "Pdgfra",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P20786",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P20786"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P20786",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P20786"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21709",
            "gene_name": "EPHA1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P21709",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21709"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21709",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21709"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21802",
            "gene_name": "FGFR2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P21802",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21802"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21802",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21802"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21803",
            "gene_name": "Fgfr2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P21803",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21803"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21803",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21803"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21860",
            "gene_name": "ERBB3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P21860",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21860"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21860",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21860"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21965",
            "gene_name": "MCK1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P21965",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21965"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21965",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21965"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22216",
            "gene_name": "RAD53",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P22216",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22216"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22216",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22216"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22455",
            "gene_name": "FGFR4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P22455",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22455"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22455",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22455"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22518",
            "gene_name": "Clk1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P22518",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22518"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22518",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22518"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22607",
            "gene_name": "FGFR3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P22607",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22607"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22607",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22607"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P23458",
            "gene_name": "JAK1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P23458",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P23458"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P23458",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P23458"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P23471",
            "gene_name": "PTPRZ1",
            "activity": [
                {
                    "ec_number": "3.1.3.48",
                    "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.",
                    "evidence": [
                        {
                            "id": "P23471",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P23471"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.3.48",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P23471",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P23471"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P24062",
            "gene_name": "Igf1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P24062",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P24062"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P24062",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P24062"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P24604",
            "gene_name": "Tec",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P24604",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P24604"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P24604",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P24604"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P25911",
            "gene_name": "Lyn",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P25911",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P25911"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P25911",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P25911"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P26618",
            "gene_name": "Pdgfra",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P26618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P26618"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P26618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P26618"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P28867",
            "gene_name": "Prkcd",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P28867",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P28867"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P28867",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P28867"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P28867",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P28867"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29317",
            "gene_name": "EPHA2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29317",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29317"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29317",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29317"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29319",
            "gene_name": "Epha3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29319",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29319"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29319",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29319"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29320",
            "gene_name": "EPHA3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29320",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29320"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29320",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29320"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29321",
            "gene_name": "Epha8",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29321",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29321"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29321",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29321"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29322",
            "gene_name": "EPHA8",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29322",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29322"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29322",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29322"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29323",
            "gene_name": "EPHB2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29323",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29323"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29323",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29323"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29350",
            "gene_name": "PTPN6",
            "activity": [
                {
                    "ec_number": "3.1.3.48",
                    "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.",
                    "evidence": [
                        {
                            "id": "P29350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29350"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.3.48",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29350"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29376",
            "gene_name": "LTK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29376",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29376"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29376",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29376"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29597",
            "gene_name": "TYK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29597",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29597"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29597",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29597"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P30291",
            "gene_name": "WEE1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P30291",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P30291"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P30291",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P30291"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P30530",
            "gene_name": "AXL",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P30530",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P30530"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P30530",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P30530"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P31938",
            "gene_name": "Map2k1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P31938",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P31938"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P31938",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P31938"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P32350",
            "gene_name": "KNS1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P32350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32350"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P32350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32350"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P32490",
            "gene_name": "MKK1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P32490",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32490"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P32490",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32490"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P32491",
            "gene_name": "MKK2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P32491",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32491"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P32491",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32491"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P32577",
            "gene_name": "Csk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P32577",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32577"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P32577",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32577"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P33981",
            "gene_name": "TTK",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P33981",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P33981"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P33981",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P33981"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P34152",
            "gene_name": "Ptk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P34152",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P34152"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P34152",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P34152"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P34925",
            "gene_name": "RYK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P34925",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P34925"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P34925",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P34925"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35546",
            "gene_name": "Ret",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35546",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35546"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35546",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35546"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35590",
            "gene_name": "TIE1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35590",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35590"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35590",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35590"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35739",
            "gene_name": "Ntrk1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35739",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35739"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35739",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35739"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35761",
            "gene_name": "Ttk",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P35761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35761"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35761"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35790",
            "gene_name": "CHKA",
            "activity": [
                {
                    "ec_number": "2.7.1.32",
                    "activity": "ATP + choline = ADP + H(+) + phosphocholine.",
                    "evidence": [
                        {
                            "id": "P35790",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35790"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.82",
                    "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.",
                    "evidence": [
                        {
                            "id": "P35790",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35790"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.32",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35790",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35790"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35916",
            "gene_name": "FLT4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35916",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35916"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35916",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35916"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35917",
            "gene_name": "Flt4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35917",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35917"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35917",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35917"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35918",
            "gene_name": "Kdr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35918",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35918"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35918",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35918"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35968",
            "gene_name": "KDR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35968",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35968"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35968",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35968"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35969",
            "gene_name": "Flt1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35969",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35969"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35969",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35969"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35991",
            "gene_name": "Btk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35991",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35991"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35991",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35991"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P36506",
            "gene_name": "Map2k2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P36506",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36506"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P36506",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36506"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P36507",
            "gene_name": "MAP2K2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P36507",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36507"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P36507",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36507"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P36888",
            "gene_name": "FLT3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P36888",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36888"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P36888",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36888"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P39688",
            "gene_name": "Fyn",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P39688",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P39688"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P39688",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P39688"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P41240",
            "gene_name": "CSK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P41240",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41240"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P41240",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41240"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P41241",
            "gene_name": "Csk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P41241",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41241"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P41241",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41241"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P41242",
            "gene_name": "Matk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P41242",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41242"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P41242",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41242"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P41243",
            "gene_name": "Matk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P41243",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41243"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P41243",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41243"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42336",
            "gene_name": "PIK3CA",
            "activity": [
                {
                    "ec_number": "2.7.1.153",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.153",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42338",
            "gene_name": "PIK3CB",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.153",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.153",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42679",
            "gene_name": "MATK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42679",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42679"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42679",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42679"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42680",
            "gene_name": "TEC",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42680"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42681",
            "gene_name": "TXK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42681",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42681"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42681",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42681"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42682",
            "gene_name": "Txk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42682",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42682"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42682",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42682"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42684",
            "gene_name": "ABL2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42684",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42684"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42684",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42684"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42685",
            "gene_name": "FRK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42685",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42685"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42685",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42685"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P43403",
            "gene_name": "ZAP70",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P43403",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43403"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P43403",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43403"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P43404",
            "gene_name": "Zap70",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P43404",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43404"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P43404",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43404"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P43405",
            "gene_name": "SYK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P43405",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43405"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P43405",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43405"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P45985",
            "gene_name": "MAP2K4",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P45985",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P45985"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P45985",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P45985"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P46734",
            "gene_name": "MAP2K3",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P46734",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P46734"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P46734",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P46734"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P47809",
            "gene_name": "Map2k4",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P47809",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P47809"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P47809",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P47809"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P47810",
            "gene_name": "Wee1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P47810",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P47810"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P47810",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P47810"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P48025",
            "gene_name": "Syk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P48025",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48025"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P48025",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48025"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49657",
            "gene_name": "mnb",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49657",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49657"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49657",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49657"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49759",
            "gene_name": "CLK1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49759"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49759"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49760",
            "gene_name": "CLK2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49760"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49761",
            "gene_name": "CLK3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49761"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49761"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49762",
            "gene_name": "Doa",
            "activity": [
                {
                    "ec_number": "2.7.11.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49762"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49762"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49762"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P50545",
            "gene_name": "Hck",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P50545",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P50545"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P50545",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P50545"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P51451",
            "gene_name": "BLK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P51451",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51451"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P51451",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51451"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P51813",
            "gene_name": "BMX",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P51813",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51813"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P51813",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51813"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P52332",
            "gene_name": "Jak1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P52332",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52332"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P52332",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52332"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P52333",
            "gene_name": "JAK3",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P52333",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52333"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P52333",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52333"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P52480",
            "gene_name": "Pkm",
            "activity": [
                {
                    "ec_number": "2.7.1.40",
                    "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.",
                    "evidence": [
                        {
                            "id": "P52480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52480"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.40",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P52480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52480"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P52480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52480"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P52480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52480"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P52564",
            "gene_name": "MAP2K6",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P52564",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52564"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P52564",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52564"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P53767",
            "gene_name": "Flt1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P53767",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P53767"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P53767",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P53767"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54199",
            "gene_name": "MPS1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P54199",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54199"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54199",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54199"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54350",
            "gene_name": "Wee1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54350"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54350"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54753",
            "gene_name": "EPHB3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54753",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54753"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54753",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54753"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54754",
            "gene_name": "Ephb3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54754",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54754"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54754",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54754"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54756",
            "gene_name": "EPHA5",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54756",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54756"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54756",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54756"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54757",
            "gene_name": "Epha5",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54757",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54757"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54757",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54757"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54758",
            "gene_name": "Epha6",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54758",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54758"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54758",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54758"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54759",
            "gene_name": "Epha7",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54759"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54759"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54760",
            "gene_name": "EPHB4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54760"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54761",
            "gene_name": "Ephb4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54761"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54761"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54762",
            "gene_name": "EPHB1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54762"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54762"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54763",
            "gene_name": "Ephb2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54763",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54763"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54763",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54763"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54764",
            "gene_name": "EPHA4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54764",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54764"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54764",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54764"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P55144",
            "gene_name": "Tyro3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P55144",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P55144"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P55144",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P55144"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P55146",
            "gene_name": "Tyro3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P55146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P55146"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P55146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P55146"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P57097",
            "gene_name": "Mertk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P57097",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57097"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P57097",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57097"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P57760",
            "gene_name": "Stk16",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P57760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P57760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P57760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57760"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P58801",
            "gene_name": "Ripk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P58801",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P58801"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P58801",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P58801"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P58801",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P58801"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P70236",
            "gene_name": "Map2k6",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P70236",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70236"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P70236",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70236"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P70424",
            "gene_name": "Erbb2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P70424",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70424"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P70424",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70424"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P70451",
            "gene_name": "Fer",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P70451",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70451"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P70451",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70451"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P70600",
            "gene_name": "Ptk2b",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P70600",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70600"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P70600",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70600"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P83102",
            "gene_name": "Dyrk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P83102",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P83102"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P83102",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P83102"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P97504",
            "gene_name": "Bmx",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P97504",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97504"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P97504",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97504"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P97523",
            "gene_name": "Met",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P97523",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97523"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P97523",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97523"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P97793",
            "gene_name": "Alk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P97793",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97793"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P97793",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97793"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q00342",
            "gene_name": "Flt3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q00342",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00342"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q00342",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00342"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q00495",
            "gene_name": "Csf1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q00495",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00495"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q00495",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00495"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q00993",
            "gene_name": "Axl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q00993",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00993"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q00993",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00993"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01134",
            "gene_name": "Chka",
            "activity": [
                {
                    "ec_number": "2.7.1.32",
                    "activity": "ATP + choline = ADP + H(+) + phosphocholine.",
                    "evidence": [
                        {
                            "id": "Q01134",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01134"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.82",
                    "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.",
                    "evidence": [
                        {
                            "id": "Q01134",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01134"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.32",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01134",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01134"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01279",
            "gene_name": "Egfr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01279",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01279"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01279",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01279"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01621",
            "gene_name": "Lck",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01621",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01621"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01621",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01621"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01887",
            "gene_name": "Ryk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01887",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01887"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01887",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01887"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01974",
            "gene_name": "ROR2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01974",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01974"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01974",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01974"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01986",
            "gene_name": "Map2k1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01986",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01986"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01986",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01986"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q02750",
            "gene_name": "MAP2K1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q02750",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02750"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q02750",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02750"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q02763",
            "gene_name": "TEK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q02763",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02763"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q02763",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02763"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q02858",
            "gene_name": "Tek",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q02858",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02858"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q02858",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02858"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03137",
            "gene_name": "Epha4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03137",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03137"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03137",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03137"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03142",
            "gene_name": "Fgfr4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03142",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03142"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03142",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03142"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03145",
            "gene_name": "Epha2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03145",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03145"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03145",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03145"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03146",
            "gene_name": "Ddr1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03146"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03146"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03351",
            "gene_name": "Ntrk3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03351",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03351"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03351",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03351"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03526",
            "gene_name": "Itk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03526"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03526"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03963",
            "gene_name": "Eif2ak2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03963",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03963"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03963",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03963"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03963",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03963"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q04589",
            "gene_name": "Fgfr1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q04589",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04589"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q04589",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04589"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q04736",
            "gene_name": "Yes1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q04736",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04736"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q04736",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04736"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q04912",
            "gene_name": "MST1R",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q04912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04912"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q04912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04912"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q05030",
            "gene_name": "Pdgfrb",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q05030",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05030"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q05030",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05030"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q05397",
            "gene_name": "PTK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q05397",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05397"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q05397",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05397"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q05655",
            "gene_name": "PRKCD",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q05655",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05655"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q05655",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05655"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q05655",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05655"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q06187",
            "gene_name": "BTK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q06187",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06187"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q06187",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06187"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q06418",
            "gene_name": "TYRO3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q06418",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06418"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q06418",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06418"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q06806",
            "gene_name": "Tie1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q06806",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06806"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q06806",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06806"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q07014",
            "gene_name": "Lyn",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q07014",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07014"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q07014",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07014"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q07407",
            "gene_name": "htl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q07407",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07407"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q07407",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07407"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q07912",
            "gene_name": "TNK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q07912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07912"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q07912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07912"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q07912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07912"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q07912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07912"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q08345",
            "gene_name": "DDR1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q08345",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q08345"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q08345",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q08345"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q08881",
            "gene_name": "ITK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q08881",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q08881"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q08881",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q08881"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q09147",
            "gene_name": "btl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q09147",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q09147"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q09147",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q09147"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q12866",
            "gene_name": "MERTK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q12866",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q12866"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q12866",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q12866"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13163",
            "gene_name": "MAP2K5",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13163",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13163"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13163",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13163"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13470",
            "gene_name": "TNK1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13470"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13470"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13627",
            "gene_name": "DYRK1A",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13627",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13627"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13627",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13627"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.23",
                    "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].",
                    "evidence": [
                        {
                            "id": "Q13627",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13627"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.23",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13627",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13627"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13882",
            "gene_name": "PTK6",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13882",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13882"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13882",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13882"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q14289",
            "gene_name": "PTK2B",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q14289",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14289"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q14289",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14289"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q14680",
            "gene_name": "MELK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14680"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q15303",
            "gene_name": "ERBB4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q15303",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15303"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q15303",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15303"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q15375",
            "gene_name": "EPHA7",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q15375",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15375"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q15375",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15375"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q15569",
            "gene_name": "TESK1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q15569",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15569"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q15569",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15569"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q16288",
            "gene_name": "NTRK3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q16288",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16288"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q16288",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16288"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q16620",
            "gene_name": "NTRK2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q16620",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16620"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q16620",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16620"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q16832",
            "gene_name": "DDR2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q16832",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16832"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q16832",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16832"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q23977",
            "gene_name": "hep",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q23977",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q23977"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q23977",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q23977"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q23977",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q23977"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q24145",
            "gene_name": "Shark",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q24145",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24145"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q24145",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24145"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q24324",
            "gene_name": "Dsor1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q24324",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24324"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q24324",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24324"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q24324",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24324"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q24488",
            "gene_name": "Ror",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q24488",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24488"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q24488",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24488"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q24592",
            "gene_name": "hop",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q24592",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24592"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q24592",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24592"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q27324",
            "gene_name": "drl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q27324",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q27324"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q27324",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q27324"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q3UFB7",
            "gene_name": "Ntrk1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q3UFB7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q3UFB7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q3UFB7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q3UFB7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q498D6",
            "gene_name": "Fgfr4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q498D6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q498D6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q498D6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q498D6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4JIM5",
            "gene_name": "Abl2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4JIM5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4JIM5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4JIM5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4JIM5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4KM97",
            "gene_name": "Blk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4KM97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KM97"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4KM97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KM97"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4KSH7",
            "gene_name": "Map2k7",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4KSH7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KSH7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4KSH7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KSH7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4V8A3",
            "gene_name": "Dyrk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4V8A3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4V8A3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4V8A3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4V8A3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q501W1",
            "gene_name": "Txk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q501W1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q501W1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q501W1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q501W1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q504Y2",
            "gene_name": "PKDCC",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q504Y2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q504Y2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q504Y2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q504Y2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54BC9",
            "gene_name": "dyrk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54BC9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54BC9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54BC9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54BC9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54G28",
            "gene_name": "",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54G28",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54G28"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54G28",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54G28"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54I36",
            "gene_name": "pyk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54I36",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54I36"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54I36",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54I36"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54N73",
            "gene_name": "7tmk1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54N73",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54N73"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54N73",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54N73"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54QV3",
            "gene_name": "yakA",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54QV3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54QV3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54QV3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54QV3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54R58",
            "gene_name": "",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54R58",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54R58"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54R58",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54R58"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q552C6",
            "gene_name": "zak2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q552C6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q552C6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q552C6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q552C6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q55CL6",
            "gene_name": "mekA",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q55CL6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q55CL6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q55CL6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q55CL6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5FVG7",
            "gene_name": "Srms",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5FVG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5FVG7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5FVG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5FVG7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5JZY3",
            "gene_name": "EPHA10",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5JZY3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5JZY3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5JZY3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5JZY3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5RJI4",
            "gene_name": "Pkdcc",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5RJI4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5RJI4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5RJI4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5RJI4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5U2X5",
            "gene_name": "Tnk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5U2X5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U2X5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5U2X5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U2X5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5U2X5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U2X5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5U2X5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U2X5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5U4C9",
            "gene_name": "Dyrk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5U4C9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U4C9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5U4C9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U4C9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q60629",
            "gene_name": "Epha5",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q60629",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60629"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q60629",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60629"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q60750",
            "gene_name": "Epha1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q60750",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60750"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q60750",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60750"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q60751",
            "gene_name": "Igf1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q60751",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60751"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q60751",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60751"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q60805",
            "gene_name": "Mertk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q60805",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60805"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q60805",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60805"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61006",
            "gene_name": "Musk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61006",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61006"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61006",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61006"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61214",
            "gene_name": "Dyrk1a",
            "activity": [
                {
                    "ec_number": "2.7.11.23",
                    "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].",
                    "evidence": [
                        {
                            "id": "Q61214",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61214"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61214",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61214"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61214",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61214"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.23",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61214",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61214"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61526",
            "gene_name": "Erbb3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61526"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61526"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61527",
            "gene_name": "Erbb4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61527",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61527"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61527",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61527"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61772",
            "gene_name": "Epha7",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61772",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61772"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61772",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61772"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61846",
            "gene_name": "Melk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61846",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61846"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61846",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61846"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61846",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61846"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61851",
            "gene_name": "Fgfr3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61851",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61851"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61851",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61851"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62120",
            "gene_name": "Jak2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62120",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62120"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62120",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62120"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62137",
            "gene_name": "Jak3",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62137",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62137"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62137",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62137"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62190",
            "gene_name": "Mst1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62190",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62190"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62190",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62190"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62270",
            "gene_name": "Srms",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62270",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62270"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62270",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62270"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62371",
            "gene_name": "Ddr2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62371",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62371"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62371",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62371"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62413",
            "gene_name": "Epha6",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62413",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62413"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62413",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62413"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62662",
            "gene_name": "Frk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62662",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62662"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62662",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62662"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62689",
            "gene_name": "Jak2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62689",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62689"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62689",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62689"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62799",
            "gene_name": "Erbb3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62799",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62799"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62799",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62799"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62838",
            "gene_name": "Musk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62838",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62838"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62838",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62838"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62844",
            "gene_name": "Fyn",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62844",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62844"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62844",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62844"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62862",
            "gene_name": "Map2k5",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62862",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62862"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62862",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62862"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62956",
            "gene_name": "Erbb4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62956",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62956"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62956",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62956"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63116",
            "gene_name": "Kit",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63116",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63116"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63116",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63116"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63117",
            "gene_name": "Clk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63117",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63117"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63117",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63117"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63132",
            "gene_name": "Ros1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63132",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63132"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63132",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63132"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63184",
            "gene_name": "Eif2ak2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63184",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63184"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63184",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63184"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63184",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63184"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63272",
            "gene_name": "Jak3",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63272",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63272"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63272",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63272"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63470",
            "gene_name": "Dyrk1a",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63470"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63470"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.23",
                    "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].",
                    "evidence": [
                        {
                            "id": "Q63470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63470"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.23",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63470"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63474",
            "gene_name": "Ddr1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63474",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63474"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63474",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63474"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63572",
            "gene_name": "Tesk1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63572",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63572"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63572",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63572"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63604",
            "gene_name": "Ntrk2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63604",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63604"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63604",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63604"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63802",
            "gene_name": "Wee1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63802",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63802"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63802",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63802"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63932",
            "gene_name": "Map2k2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63932",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63932"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63932",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63932"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q64434",
            "gene_name": "Ptk6",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q64434",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64434"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q64434",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64434"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q64716",
            "gene_name": "Insrr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q64716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64716"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q64716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64716"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q64725",
            "gene_name": "Syk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q64725",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64725"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q64725",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64725"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q66JT0",
            "gene_name": "Wee2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q66JT0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q66JT0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q66JT0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q66JT0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6J9G0",
            "gene_name": "STYK1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6J9G0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6J9G0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6J9G0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6J9G0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6J9G1",
            "gene_name": "Styk1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6J9G1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6J9G1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6J9G1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6J9G1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6P6U0",
            "gene_name": "Fgr",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6P6U0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6P6U0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6P6U0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6P6U0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6VNS1",
            "gene_name": "Ntrk3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6VNS1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6VNS1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6VNS1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6VNS1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6XUX1",
            "gene_name": "Dstyk",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6XUX1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6XUX1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6XUX2",
            "gene_name": "Dstyk",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6XUX2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6XUX2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6XUX3",
            "gene_name": "DSTYK",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6XUX3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6XUX3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q75JK0",
            "gene_name": "zakA",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q75JK0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q75JK0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q75JK0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q75JK0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q76NV1",
            "gene_name": "dyrk1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q76NV1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q76NV1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q76NV1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q76NV1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q78DX7",
            "gene_name": "Ros1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q78DX7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q78DX7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q78DX7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q78DX7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q7KJ08",
            "gene_name": "Alk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q7KJ08",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q7KJ08"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q7KJ08",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q7KJ08"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8BI55",
            "gene_name": "Dyrk4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8BI55",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8BI55"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8BI55",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8BI55"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8BYG9",
            "gene_name": "Epha10",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8BYG9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8BYG9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8BYG9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8BYG9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8CBF3",
            "gene_name": "Ephb1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8CBF3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CBF3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8CBF3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CBF3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8CE90",
            "gene_name": "Map2k7",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8CE90",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CE90"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8CE90",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CE90"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8INJ8",
            "gene_name": "Csk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8INJ8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8INJ8"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8INJ8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8INJ8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8VCT9",
            "gene_name": "Tesk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8VCT9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8VCT9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8VCT9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8VCT9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q91ZT1",
            "gene_name": "Flt4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q91ZT1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q91ZT1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q91ZT1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q91ZT1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q922K9",
            "gene_name": "Frk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q922K9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q922K9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q922K9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q922K9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q922Y0",
            "gene_name": "Dyrk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q922Y0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q922Y0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q922Y0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q922Y0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q924U5",
            "gene_name": "Tesk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q924U5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q924U5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q924U5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q924U5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q92630",
            "gene_name": "DYRK2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q92630",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q92630"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q92630",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q92630"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q96KB5",
            "gene_name": "PBK",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q96KB5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q96KB5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q96KB5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q96KB5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q96S53",
            "gene_name": "TESK2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q96S53",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q96S53"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q96S53",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q96S53"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q99ML2",
            "gene_name": "Tnk1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q99ML2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q99ML2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q99ML2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q99ML2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9H3Y6",
            "gene_name": "SRMS",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9H3Y6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9H3Y6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9H3Y6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9H3Y6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9HAZ1",
            "gene_name": "CLK4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9HAZ1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9HAZ1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9HAZ1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9HAZ1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9I7F7",
            "gene_name": "Ack-like",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9I7F7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9I7F7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9I7F7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9I7F7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9I7F7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9I7F7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9JJ78",
            "gene_name": "Pbk",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9JJ78",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9JJ78"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9JJ78",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9JJ78"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9NR09",
            "gene_name": "BIRC6",
            "activity": [
                {
                    "ec_number": "2.3.2.27",
                    "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
                    "evidence": [
                        {
                            "id": "Q9NR09",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9NR09"
                        }
                    ]
                },
                {
                    "ec_number": "2.3.2.27",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9NR09",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9NR09"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9NR20",
            "gene_name": "DYRK4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9NR20",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9NR20"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9NR20",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9NR20"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9NZJ5",
            "gene_name": "EIF2AK3",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9NZJ5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9NZJ5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9NZJ5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9NZJ5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9QVP9",
            "gene_name": "Ptk2b",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9QVP9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9QVP9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9QVP9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9QVP9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9R117",
            "gene_name": "Tyk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9R117",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9R117"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9R117",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9R117"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9UF33",
            "gene_name": "EPHA6",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9UF33",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UF33"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9UF33",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UF33"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9UIG0",
            "gene_name": "BAZ1B",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9UIG0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UIG0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9UIG0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UIG0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9UM73",
            "gene_name": "ALK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9UM73",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UM73"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9UM73",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UM73"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9V3D5",
            "gene_name": "Dyrk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9V3D5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V3D5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9V3D5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V3D5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9V422",
            "gene_name": "dnt",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9V422",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V422"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9V422",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V422"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9V4E5",
            "gene_name": "Eph",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9V4E5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V4E5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9V4E5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V4E5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9V6K3",
            "gene_name": "Nrk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9V6K3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V6K3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9V6K3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V6K3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9V9J3",
            "gene_name": "Src42A",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9V9J3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V9J3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9V9J3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V9J3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VBW3",
            "gene_name": "Cad96Ca",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VBW3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VBW3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VBW3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VBW3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VJ04",
            "gene_name": "Dmel\\CG10702",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VJ04",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VJ04"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VJ04",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VJ04"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VPC0",
            "gene_name": "Pitslre",
            "activity": [
                {
                    "ec_number": "2.7.11.22",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VPC0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VPC0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.22",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VPC0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VPC0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VZI2",
            "gene_name": "Ack",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VZI2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZI2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VZI2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZI2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VZI2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZI2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VZI2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZI2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9WTL4",
            "gene_name": "Insrr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9WTL4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WTL4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9WTL4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WTL4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9WUD9",
            "gene_name": "Src",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9WUD9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WUD9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9WUD9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WUD9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9WVS7",
            "gene_name": "Map2k5",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9WVS7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WVS7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9WVS7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WVS7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9Y463",
            "gene_name": "DYRK1B",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9Y463",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Y463"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9Y463",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Y463"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9Z138",
            "gene_name": "Ror2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9Z138",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z138"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9Z138",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z138"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9Z188",
            "gene_name": "Dyrk1b",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9Z188",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z188"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9Z188",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z188"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9Z277",
            "gene_name": "Baz1b",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9Z277",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z277"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9Z277",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z277"
                        }
                    ]
                }
            ]
        }
    ],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 17
                },
                {
                    "field": "total_sites",
                    "count": 17
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 16
                },
                {
                    "field": "o_linked_glycans",
                    "count": 1
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 1
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 16
                },
                {
                    "field": "total_sites",
                    "count": 16
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 16
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 18
                },
                {
                    "field": "total_sites",
                    "count": 14
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 75
                },
                {
                    "field": "total_sites",
                    "count": 55
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "sequence_org",
                "sequence_mut",
                "comment",
                "chr_id",
                "chr_pos",
                "ref_nt",
                "alt_nt",
                "minor_allelic_frequency",
                "site_lbl",
                "subjects_tested",
                "subjects_positive",
                "frequency"
            ]
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 19
                },
                {
                    "field": "total_sites",
                    "count": 19
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "sequence_org",
                "sequence_mut",
                "comment",
                "chr_id",
                "chr_pos",
                "ref_nt",
                "alt_nt",
                "minor_allelic_frequency",
                "site_lbl",
                "subjects_tested",
                "subjects_positive",
                "frequency"
            ]
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 56
                },
                {
                    "field": "total_sites",
                    "count": 40
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "sequence_org",
                "sequence_mut",
                "comment",
                "chr_id",
                "chr_pos",
                "ref_nt",
                "alt_nt",
                "minor_allelic_frequency",
                "site_lbl",
                "subjects_tested",
                "subjects_positive",
                "frequency"
            ]
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 239
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}