{ "uniprot_canonical_ac": "Q9UKL0-1", "uniprot_ac": "Q9UKL0", "uniprot_id": "RCOR1_HUMAN", "mass": { "chemical_mass": 53327.0, "monoisotopic_mass": 53327.0 }, "refseq": { "ac": "NP_055971", "name": "REST corepressor 1", "summary": "This gene encodes a protein that is well-conserved, downregulated at birth, and with a specific role in determining neural cell differentiation. The encoded protein binds to the C-terminal domain of REST (repressor element-1 silencing transcription factor). [provided by RefSeq, Aug 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971" }, "gene_names": [ { "name": "RCOR1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9UKL0", "id": "Q9UKL0" }, { "name": "COREST; RCOR", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971", "id": "NP_055971" }, { "name": "KIAA0071", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9UKL0", "id": "Q9UKL0" }, { "name": "RCOR1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971", "id": "NP_055971" }, { "name": "RCOR", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9UKL0", "id": "Q9UKL0" } ], "protein_names": [ { "name": "REST corepressor 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9UKL0" }, { "name": "Protein CoREST", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9UKL0" }, { "name": "REST corepressor 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971", "id": "NP_055971" } ], "function": [ { "annotation": "Crystal Structure of the LSD1/CoREST Histone Demethylase Bound to Its Nucleosome Substrate.", "evidence": [ { "database": "RefSeq", "id": "NP_055971", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971" }, { "database": "PubMed", "id": "32396821", "url": "https://glygen.org/publication/PubMed/32396821" } ] }, { "annotation": "Essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it serves as a molecular beacon for the recruitment of molecular machinery, including MeCP2 and SUV39H1, that imposes silencing across a chromosomal interval. Plays a central role in demethylation of Lys-4 of histone H3 by promoting demethylase activity of KDM1A on core histones and nucleosomal substrates. It also protects KDM1A from the proteasome. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development and controls hematopoietic differentiation.", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0#function" }, { "database": "PubMed", "id": "11171972", "url": "https://glygen.org/publication/PubMed/11171972" }, { "database": "PubMed", "id": "12032298", "url": "https://glygen.org/publication/PubMed/12032298" }, { "database": "PubMed", "id": "16140033", "url": "https://glygen.org/publication/PubMed/16140033" }, { "database": "PubMed", "id": "16079794", "url": "https://glygen.org/publication/PubMed/16079794" }, { "database": "PubMed", "id": "12493763", "url": "https://glygen.org/publication/PubMed/12493763" }, { "database": "PubMed", "id": "11516394", "url": "https://glygen.org/publication/PubMed/11516394" }, { "database": "PubMed", "id": "12399542", "url": "https://glygen.org/publication/PubMed/12399542" } ] }, { "annotation": "Genome-wide association study suggests that variation at the RCOR1 locus is associated with tinnitus in UK Biobank. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_055971", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971" }, { "database": "PubMed", "id": "33742053", "url": "https://glygen.org/publication/PubMed/33742053" } ] }, { "annotation": "MYT1 attenuates neuroblastoma cell differentiation by interacting with the LSD1/CoREST complex.", "evidence": [ { "database": "RefSeq", "id": "NP_055971", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971" }, { "database": "PubMed", "id": "32251364", "url": "https://glygen.org/publication/PubMed/32251364" } ] }, { "annotation": "RCOR1 directly binds to MED28 and weakens its inducing effect on cancer stem cell-like activity of oral cavity squamous cell carcinoma cells.", "evidence": [ { "database": "RefSeq", "id": "NP_055971", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971" }, { "database": "PubMed", "id": "32306431", "url": "https://glygen.org/publication/PubMed/32306431" } ] }, { "annotation": "This gene encodes a protein that is well-conserved, downregulated at birth, and with a specific role in determining neural cell differentiation. The encoded protein binds to the C-terminal domain of REST (repressor element-1 silencing transcription factor). [provided by RefSeq, Aug 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_055971", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "Q9UKL0", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UKL0" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 241, "end_pos": 241, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (TKT->NKT).", "chr_id": "14", "chr_pos": "102708526", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T241", "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs377362785", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377362785" }, { "id": "rs377362785", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377362785" }, { "id": "rs377362785", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs377362785#frequency_tab" }, { "id": "rs377362785", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs377362785" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 281, "end_pos": 281, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KES->NES).", "chr_id": "14", "chr_pos": "102710998", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K281", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1488741125", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1488741125" }, { "id": "rs1488741125", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1488741125" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 292, "end_pos": 292, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "14", "chr_pos": "102714439", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T292", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768292642", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768292642" }, { "id": "rs768292642", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768292642" }, { "id": "rs768292642", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768292642" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 465, "end_pos": 465, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSI->NST).", "chr_id": "14", "chr_pos": "102722391", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I465", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762706265", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762706265" }, { "id": "rs762706265", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762706265" }, { "id": "rs762706265", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762706265" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 84, "end_pos": 84, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SNS->NNS).", "chr_id": "14", "chr_pos": "102593137", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S84", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "75.72", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "89.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "81.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "66.28", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "85.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "88.09", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "76.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "83.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "80.89", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "82.55", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "83.5", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "82.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "85.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "Q9UKL0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UKL0" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "Q9UKL0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UKL0" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "Q9UKL0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UKL0" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "Q9UKL0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UKL0" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "Q9UKL0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UKL0" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "Q9UKL0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UKL0" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "Q9UKL0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UKL0" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "Q9UKL0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UKL0" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "Q9UKL0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UKL0" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "Q9UKL0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UKL0" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "Q9UKL0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UKL0" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "Q9UKL0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9UKL0" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "common_name": "Human" } ], "gene": [ { "name": "RCOR1", "url": "https://www.uniprot.org/uniprot/Q9UKL0", "locus": { "chromosome": "14", "start_pos": 102730561, "end_pos": 102592649, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000089902", "url": "https://www.ensembl.org/id/ENSG00000089902" } ] } } ], "crossref": [ { "id": "ENSG00000089902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000089902", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "Q9UKL0", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q9UKL0", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00167", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00167", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3137262", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3137262", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "RCOR1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=RCOR1", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "23186", "url": "https://www.ncbi.nlm.nih.gov/gene/23186", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "17441", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=17441", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "Q9UKL0", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9UKL0*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000949", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000949", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001005", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001005", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017884", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017884", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:23186", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:23186", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "607675", "url": "http://www.omim.org/entry/607675", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_Q9UKL0", "url": "https://www.nextprot.org/entry/NX_Q9UKL0", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "Q9UKL0", "url": "https://oglcnac.org/atlas/detail/Q9UKL0", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "Q9UKL0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UKL0", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "HFFVSYR", "url": "https://omabrowser.org/oma/group/HFFVSYR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3684011at2759", "url": "http://www.orthodb.org/?query=3684011at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16089", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16089", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16089:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16089:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2IW5", "url": "https://www.rcsb.org/structure/2IW5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2UXN", "url": "https://www.rcsb.org/structure/2UXN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2UXX", "url": "https://www.rcsb.org/structure/2UXX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2V1D", "url": "https://www.rcsb.org/structure/2V1D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2X0L", "url": "https://www.rcsb.org/structure/2X0L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2XAF", "url": "https://www.rcsb.org/structure/2XAF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2XAG", "url": "https://www.rcsb.org/structure/2XAG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2XAH", "url": "https://www.rcsb.org/structure/2XAH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2XAJ", "url": "https://www.rcsb.org/structure/2XAJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2XAQ", "url": "https://www.rcsb.org/structure/2XAQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2XAS", "url": "https://www.rcsb.org/structure/2XAS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Y48", "url": "https://www.rcsb.org/structure/2Y48", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZMS", "url": "https://www.rcsb.org/structure/3ZMS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZMT", "url": "https://www.rcsb.org/structure/3ZMT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZMU", "url": "https://www.rcsb.org/structure/3ZMU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZMV", "url": "https://www.rcsb.org/structure/3ZMV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZMZ", "url": "https://www.rcsb.org/structure/3ZMZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZN0", "url": "https://www.rcsb.org/structure/3ZN0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZN1", "url": "https://www.rcsb.org/structure/3ZN1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4BAY", "url": "https://www.rcsb.org/structure/4BAY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4KUM", "url": "https://www.rcsb.org/structure/4KUM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4UV8", "url": "https://www.rcsb.org/structure/4UV8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4UV9", "url": "https://www.rcsb.org/structure/4UV9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4UVA", "url": "https://www.rcsb.org/structure/4UVA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4UVB", "url": "https://www.rcsb.org/structure/4UVB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4UVC", "url": "https://www.rcsb.org/structure/4UVC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4UXN", "url": "https://www.rcsb.org/structure/4UXN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4XBF", "url": "https://www.rcsb.org/structure/4XBF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5H6Q", "url": "https://www.rcsb.org/structure/5H6Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5H6R", "url": "https://www.rcsb.org/structure/5H6R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5L3B", "url": "https://www.rcsb.org/structure/5L3B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5L3C", "url": "https://www.rcsb.org/structure/5L3C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5L3D", "url": "https://www.rcsb.org/structure/5L3D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5L3E", "url": "https://www.rcsb.org/structure/5L3E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5L3F", "url": "https://www.rcsb.org/structure/5L3F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5L3G", "url": "https://www.rcsb.org/structure/5L3G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LBQ", "url": "https://www.rcsb.org/structure/5LBQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LGN", "url": "https://www.rcsb.org/structure/5LGN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LGT", "url": "https://www.rcsb.org/structure/5LGT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LGU", "url": "https://www.rcsb.org/structure/5LGU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LHG", "url": "https://www.rcsb.org/structure/5LHG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LHH", "url": "https://www.rcsb.org/structure/5LHH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LHI", "url": "https://www.rcsb.org/structure/5LHI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5X60", "url": "https://www.rcsb.org/structure/5X60", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5YJB", "url": "https://www.rcsb.org/structure/5YJB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6K3E", "url": "https://www.rcsb.org/structure/6K3E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KGK", "url": "https://www.rcsb.org/structure/6KGK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KGL", "url": "https://www.rcsb.org/structure/6KGL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KGM", "url": "https://www.rcsb.org/structure/6KGM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KGN", "url": "https://www.rcsb.org/structure/6KGN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6S35", "url": "https://www.rcsb.org/structure/6S35", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TE1", "url": "https://www.rcsb.org/structure/6TE1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TUY", "url": "https://www.rcsb.org/structure/6TUY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6VYP", "url": "https://www.rcsb.org/structure/6VYP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6W4K", "url": "https://www.rcsb.org/structure/6W4K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WC6", "url": "https://www.rcsb.org/structure/6WC6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CDC", "url": "https://www.rcsb.org/structure/7CDC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CDD", "url": "https://www.rcsb.org/structure/7CDD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CDE", "url": "https://www.rcsb.org/structure/7CDE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CDF", "url": "https://www.rcsb.org/structure/7CDF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CDG", "url": "https://www.rcsb.org/structure/7CDG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZRY", "url": "https://www.rcsb.org/structure/7ZRY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00249", "url": "http://pfam.xfam.org/family/PF00249", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01448", "url": "http://pfam.xfam.org/family/PF01448", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "Q9UKL0", "url": "https://pharos.nih.gov/targets/Q9UKL0", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q9UKL0", "url": "http://purl.obolibrary.org/obo/PR_Q9UKL0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_055971", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "H0YNY4", "url": "https://www.uniprot.org/uniprot/H0YNY4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNY4-1", "url": "https://www.uniprot.org/uniprot/H0YNY4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9UKL0-1", "url": "https://www.uniprot.org/uniprot/Q9UKL0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS", "length": 485, "header": "sp|Q9UKL0-1|RCOR1_HUMAN Isoform 1 of REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2 CANONICAL=Q9UKL0-1" }, "isoforms": [ { "isoform_ac": "H0YNY4-1", "url": "", "sequence": { "sequence": "QTNSALKEKLDGGIEPYRLPEPSGNMAEIFRQSQT", "length": 35, "header": "tr|H0YNY4-1|H0YNY4_HUMAN Computationally mapped isoform of REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=1 CANONICAL=Q9UKL0-1" }, "locus": { "chromosome": "14", "start_pos": 102722228, "end_pos": 102721022, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000560472.1", "url": "https://www.ensembl.org/id/ENST00000560472.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000454204.1", "url": "https://www.ensembl.org/id/ENSP00000454204.1" } ] } }, { "isoform_ac": "Q9UKL0-1", "url": "", "sequence": { "sequence": "MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS", "length": 485, "header": "sp|Q9UKL0-1|RCOR1_HUMAN Isoform 1 of REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2 CANONICAL=Q9UKL0-1" }, "locus": { "chromosome": "14", "start_pos": 102726503, "end_pos": 102592887, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000262241.7", "url": "https://www.ensembl.org/id/ENST00000262241.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000262241.5", "url": "https://www.ensembl.org/id/ENSP00000262241.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 290, "start_aa": "Thr", "end_pos": 290, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr290", "evidence": [ { "id": "Q9UKL0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UKL0" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "Q9UKL0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9UKL0" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 292, "start_aa": "Thr", "end_pos": 292, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr292", "evidence": [ { "id": "Q9UKL0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9UKL0" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] } ], "phosphorylation": [ { "start_pos": 127, "end_pos": 127, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "Q9UKL0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UKL0" } ], "site_lbl": "Ser127" }, { "start_pos": 260, "end_pos": 260, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "Q9UKL0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UKL0" } ], "site_lbl": "Ser260" }, { "start_pos": 460, "end_pos": 460, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "Q9UKL0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UKL0" } ], "site_lbl": "Ser460" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Molecular and ligand-binding characterization of the sigma-receptor in the Jurkat human T lymphocyte cell line.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1999", "authors": "Ganapathy ME, Prasad PD, Huang W, Seth P, Leibach FH, Ganapathy V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "10087012", "url": "https://glygen.org/publication/PubMed/10087012" } ] }, { "title": "Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation.", "journal": "Genes & development", "date": "1999", "authors": "Zhang Y, Ng HH, Erdjument-Bromage H, Tempst P, Bird A, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10444591", "url": "https://glygen.org/publication/PubMed/10444591" } ] }, { "title": "CoREST: a functional corepressor required for regulation of neural-specific gene expression.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1999", "authors": "Andres ME, Burger C, Peral-Rubio MJ, Battaglioli E, Anderson ME, Grimes J, Dallman J, Ballas N, Mandel G", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" }, { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10449787", "url": "https://glygen.org/publication/PubMed/10449787" } ] }, { "title": "The co-repressor mSin3A is a functional component of the REST-CoREST repressor complex.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Kouzarides T., Holdener B.C., Nielsen S.J., Miska E.A., Mandel G., Battaglioli E., Atouf F., Berry D.L., Grimes J.A., Speh J.C.", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "10734093", "url": "https://glygen.org/publication/PubMed/10734093" } ] }, { "title": "Cloning and characterization of a novel human class I histone deacetylase that functions as a transcription repressor.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hu E, Chen Z, Fredrickson T, Zhu Y, Kirkpatrick R, Zhang GF, Johanson K, Sung CM, Liu R, Winkler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10748112", "url": "https://glygen.org/publication/PubMed/10748112" } ] }, { "title": "NuRD and SIN3 histone deacetylase complexes in development.", "journal": "Trends in genetics : TIG", "date": "2000", "authors": "Ahringer J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10904264", "url": "https://glygen.org/publication/PubMed/10904264" } ] }, { "title": "Histone deacetylase inhibitors: inducers of differentiation or apoptosis of transformed cells.", "journal": "Journal of the National Cancer Institute", "date": "2000", "authors": "Marks PA, Richon VM, Rifkind RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10922406", "url": "https://glygen.org/publication/PubMed/10922406" } ] }, { "title": "Cloning and characterization of a novel human histone deacetylase, HDAC8.", "journal": "The Biochemical journal", "date": "2000", "authors": "Buggy JJ, Sideris ML, Mak P, Lorimer DD, McIntosh B, Clark JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10926844", "url": "https://glygen.org/publication/PubMed/10926844" } ] }, { "title": "Multitasking in signal transduction by a promiscuous human Ins(3,4,5,6)P(4) 1-kinase/Ins(1,3,4)P(3) 5/6-kinase.", "journal": "The Biochemical journal", "date": "2000", "authors": "Yang X, Shears SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11042108", "url": "https://glygen.org/publication/PubMed/11042108" } ] }, { "title": "Rabenosyn-5, a novel Rab5 effector, is complexed with hVPS45 and recruited to endosomes through a FYVE finger domain.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Nielsen E, Christoforidis S, Uttenweiler-Joseph S, Miaczynska M, Dewitte F, Wilm M, Hoflack B, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11062261", "url": "https://glygen.org/publication/PubMed/11062261" } ] }, { "title": "Stable histone deacetylase complexes distinguished by the presence of SANT domain proteins CoREST/kiaa0071 and Mta-L1.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Nakatani Y., Qin J., Wang Y., Hirai T., Howard B.H., Humphrey G.W., Russanova V.R.", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "11102443", "url": "https://glygen.org/publication/PubMed/11102443" } ] }, { "title": "CoREST is an integral component of the CoREST-human histone deacetylase complex.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2001", "authors": "Schreiber S.L., Tong J.K., Grozinger C.M., You A.", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "11171972", "url": "https://glygen.org/publication/PubMed/11171972" } ] }, { "title": "Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins.", "journal": "Nature", "date": "2001", "authors": "Lachner M, O'Carroll D, Rea S, Mechtler K, Jenuwein T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11242053", "url": "https://glygen.org/publication/PubMed/11242053" } ] }, { "title": "Tumor suppressor and anti-inflammatory actions of PPARgamma agonists are mediated via upregulation of PTEN.", "journal": "Current biology : CB", "date": "2001", "authors": "Patel L, Pass I, Coxon P, Downes CP, Smith SA, Macphee CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "11378386", "url": "https://glygen.org/publication/PubMed/11378386" } ] }, { "title": "The SMRT and N-CoR corepressors are activating cofactors for histone deacetylase 3.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Guenther MG, Barak O, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11509652", "url": "https://glygen.org/publication/PubMed/11509652" } ] }, { "title": "Regulation of neuronal traits by a novel transcriptional complex.", "journal": "Neuron", "date": "2001", "authors": "Rose D.W., Rosenfeld M.G., Anderson M.E., Davie J.R., Moniwa M., Federoff H.J., Chenoweth J., Mandel G., Battaglioli E., Andres M.E., Atouf F., Ballas N., Bowers W.J., Brehm P., Burger C.", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "11516394", "url": "https://glygen.org/publication/PubMed/11516394" } ] }, { "title": "Regulation of PTEN transcription by p53.", "journal": "Molecular cell", "date": "2001", "authors": "Stambolic V, MacPherson D, Sas D, Lin Y, Snow B, Jang Y, Benchimol S, Mak TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "11545734", "url": "https://glygen.org/publication/PubMed/11545734" } ] }, { "title": "Isolation and characterization of a novel class II histone deacetylase, HDAC10.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fischer DD, Cai R, Bhatia U, Asselbergs FA, Song C, Terry R, Trogani N, Widmer R, Atadja P, Cohen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11739383", "url": "https://glygen.org/publication/PubMed/11739383" } ] }, { "title": "Valproic acid defines a novel class of HDAC inhibitors inducing differentiation of transformed cells.", "journal": "The EMBO journal", "date": "2001", "authors": "Gottlicher M, Minucci S, Zhu P, Kramer OH, Schimpf A, Giavara S, Sleeman JP, Lo Coco F, Nervi C, Pelicci PG, Heinzel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11742974", "url": "https://glygen.org/publication/PubMed/11742974" } ] }, { "title": "RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Miller KA, Yoshikawa DM, McConnell IR, Clark R, Schild D, Albala JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11744692", "url": "https://glygen.org/publication/PubMed/11744692" } ] }, { "title": "Mediator function of the human Rad51B-Rad51C complex in Rad51/RPA-catalyzed DNA strand exchange.", "journal": "Genes & development", "date": "2001", "authors": "Sigurdsson S, Van Komen S, Bussen W, Schild D, Albala JS, Sung P", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11751636", "url": "https://glygen.org/publication/PubMed/11751636" } ] }, { "title": "The Egr-1 transcription factor directly activates PTEN during irradiation-induced signalling.", "journal": "Nature cell biology", "date": "2001", "authors": "Virolle T, Adamson ED, Baron V, Birle D, Mercola D, Mustelin T, de Belle I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "11781575", "url": "https://glygen.org/publication/PubMed/11781575" } ] }, { "title": "The human beta-globin locus control region.", "journal": "European journal of biochemistry", "date": "2002", "authors": "Levings PP, Bungert J", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11895428", "url": "https://glygen.org/publication/PubMed/11895428" } ] }, { "title": "Identification of mammalian Sds3 as an integral component of the Sin3/histone deacetylase corepressor complex.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Alland L, David G, Shen-Li H, Potes J, Muhle R, Lee HC, Hou H Jr, Chen K, DePinho RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11909966", "url": "https://glygen.org/publication/PubMed/11909966" } ] }, { "title": "Membrane topology and mitochondrial targeting of mitofusins, ubiquitous mammalian homologs of the transmembrane GTPase Fzo.", "journal": "Journal of cell science", "date": "2002", "authors": "Rojo M, Legros F, Chateau D, Lombes A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11950885", "url": "https://glygen.org/publication/PubMed/11950885" } ] }, { "title": "p53 regulates cell survival by inhibiting PIK3CA in squamous cell carcinomas.", "journal": "Genes & development", "date": "2002", "authors": "Singh B, Reddy PG, Goberdhan A, Walsh C, Dao S, Ngai I, Chou TC, O-Charoenrat P, Levine AJ, Rao PH, Stoffel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "11959846", "url": "https://glygen.org/publication/PubMed/11959846" } ] }, { "title": "A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2002", "authors": "Hakimi MA, Bochar DA, Chenoweth J, Lane WS, Mandel G, Shiekhattar R", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" }, { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "12032298", "url": "https://glygen.org/publication/PubMed/12032298" } ] }, { "title": "Unconventional Rac-GEF activity is mediated through the Dock180-ELMO complex.", "journal": "Nature cell biology", "date": "2002", "authors": "Brugnera E, Haney L, Grimsley C, Lu M, Walk SF, Tosello-Trampont AC, Macara IG, Madhani H, Fink GR, Ravichandran KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "12134158", "url": "https://glygen.org/publication/PubMed/12134158" } ] }, { "title": "REST repression of neuronal genes requires components of the hSWI.SNF complex.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Battaglioli E, Andres ME, Rose DW, Chenoweth JG, Rosenfeld MG, Anderson ME, Mandel G", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "12192000", "url": "https://glygen.org/publication/PubMed/12192000" } ] }, { "title": "Corepressor-dependent silencing of chromosomal regions encoding neuronal genes.", "journal": "Science", "date": "2002", "authors": "Lunyak VV, Burgess R, Prefontaine GG, Nelson C, Sze SH, Chenoweth J, Schwartz P, Pevzner PA, Glass C, Mandel G, Rosenfeld MG", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "12399542", "url": "https://glygen.org/publication/PubMed/12399542" } ] }, { "title": "Complex formation by the human Rad51B and Rad51C DNA repair proteins and their activities in vitro.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lio YC, Mazin AV, Kowalczykowski SC, Chen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "12427746", "url": "https://glygen.org/publication/PubMed/12427746" } ] }, { "title": "A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Lane W.S., Speicher D.W., Shiekhattar R., Dong Y., Hakimi M.-A.", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "12493763", "url": "https://glygen.org/publication/PubMed/12493763" } ] }, { "title": "Identification and characterization of three new components of the mSin3A corepressor complex.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Fleischer TC, Yun UJ, Ayer DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "12724404", "url": "https://glygen.org/publication/PubMed/12724404" } ] }, { "title": "Rabenosyn-5 and EHD1 interact and sequentially regulate protein recycling to the plasma membrane.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Naslavsky N, Boehm M, Backlund PS Jr, Caplan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "15020713", "url": "https://glygen.org/publication/PubMed/15020713" } ] }, { "title": "The novel Cdc42 guanine nucleotide exchange factor, zizimin1, dimerizes via the Cdc42-binding CZH2 domain.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Meller N, Irani-Tehrani M, Ratnikov BI, Paschal BM, Schwartz MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "15247287", "url": "https://glygen.org/publication/PubMed/15247287" } ] }, { "title": "Zizimin2: a novel, DOCK180-related Cdc42 guanine nucleotide exchange factor expressed predominantly in lymphocytes.", "journal": "FEBS letters", "date": "2005", "authors": "Nishikimi A, Meller N, Uekawa N, Isobe K, Schwartz MA, Maruyama M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "15710388", "url": "https://glygen.org/publication/PubMed/15710388" } ] }, { "title": "Components of the REST/CoREST/histone deacetylase repressor complex are disrupted, modified, and translocated in HSV-1-infected cells.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2005", "authors": "Gu H, Liang Y, Mandel G, Roizman B", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "15897453", "url": "https://glygen.org/publication/PubMed/15897453" } ] }, { "title": "Mammalian CARMIL inhibits actin filament capping by capping protein.", "journal": "Developmental cell", "date": "2005", "authors": "Yang C, Pring M, Wear MA, Huang M, Cooper JA, Svitkina TM, Zigmond SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "16054028", "url": "https://glygen.org/publication/PubMed/16054028" } ] }, { "title": "An essential role for CoREST in nucleosomal histone 3 lysine 4 demethylation.", "journal": "Nature", "date": "2005", "authors": "Lee MG, Wynder C, Cooch N, Shiekhattar R", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "16079794", "url": "https://glygen.org/publication/PubMed/16079794" } ] }, { "title": "Chloroquine is a potent inhibitor of SARS coronavirus infection and spread.", "journal": "Virology journal", "date": "2005", "authors": "Vincent MJ, Bergeron E, Benjannet S, Erickson BR, Rollin PE, Ksiazek TG, Seidah NG, Nichol ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "16115318", "url": "https://glygen.org/publication/PubMed/16115318" } ] }, { "title": "Regulation of LSD1 histone demethylase activity by its associated factors.", "journal": "Mol. Cell", "date": "2005", "authors": "Shi Y., Baba T., Iwase S., Lan F., Matson C., Shi Y.-J.", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "16140033", "url": "https://glygen.org/publication/PubMed/16140033" } ] }, { "title": "Inducible processing of interferon regulatory factor-2.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Palombella VJ, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "1630448", "url": "https://glygen.org/publication/PubMed/1630448" } ] }, { "title": "Up-regulation of PTEN (phosphatase and tensin homolog deleted on chromosome ten) mediates p38 MAPK stress signal-induced inhibition of insulin signaling. A cross-talk between stress signaling and insulin signaling in resistin-treated human endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Shen YH, Zhang L, Gan Y, Wang X, Wang J, LeMaire SA, Coselli JS, Wang XL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "16418168", "url": "https://glygen.org/publication/PubMed/16418168" } ] }, { "title": "Chronic antidepressants potentiate via sigma-1 receptors the brain-derived neurotrophic factor-induced signaling for glutamate release.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yagasaki Y, Numakawa T, Kumamaru E, Hayashi T, Su TP, Kunugi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "16522641", "url": "https://glygen.org/publication/PubMed/16522641" } ] }, { "title": "c-Jun promotes cellular survival by suppression of PTEN.", "journal": "Cell death and differentiation", "date": "2007", "authors": "Hettinger K, Vikhanskaya F, Poh MK, Lee MK, de Belle I, Zhang JT, Reddy SA, Sabapathy K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "16676006", "url": "https://glygen.org/publication/PubMed/16676006" } ] }, { "title": "Nuclear receptor TLX prevents retinal dystrophy and recruits the corepressor atrophin1.", "journal": "Genes & development", "date": "2006", "authors": "Zhang CL, Zou Y, Yu RT, Gage FH, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "16702404", "url": "https://glygen.org/publication/PubMed/16702404" } ] }, { "title": "Structural basis for CoREST-dependent demethylation of nucleosomes by the human LSD1 histone demethylase.", "journal": "Mol. Cell", "date": "2006", "authors": "Yang M, Gocke CB, Luo X, Borek D, Tomchick DR, Machius M, Otwinowski Z, Yu H", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "16885027", "url": "https://glygen.org/publication/PubMed/16885027" } ] }, { "title": "Dock4 is regulated by RhoG and promotes Rac-dependent cell migration.", "journal": "Experimental cell research", "date": "2006", "authors": "Hiramoto K, Negishi M, Katoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "17027967", "url": "https://glygen.org/publication/PubMed/17027967" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" }, { "database": "iPTMnet", "id": "Q9UKL0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Dock6, a Dock-C subfamily guanine nucleotide exchanger, has the dual specificity for Rac1 and Cdc42 and regulates neurite outgrowth.", "journal": "Experimental cell research", "date": "2007", "authors": "Miyamoto Y, Yamauchi J, Sanbe A, Tanoue A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "17196961", "url": "https://glygen.org/publication/PubMed/17196961" } ] }, { "title": "Dimethyl sulfoxide to vorinostat: development of this histone deacetylase inhibitor as an anticancer drug.", "journal": "Nature biotechnology", "date": "2007", "authors": "Marks PA, Breslow R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "17211407", "url": "https://glygen.org/publication/PubMed/17211407" } ] }, { "title": "High occupancy of sigma-1 receptors in the human brain after single oral administration of fluvoxamine: a positron emission tomography study using [11C]SA4503.", "journal": "Biological psychiatry", "date": "2007", "authors": "Ishikawa M, Ishiwata K, Ishii K, Kimura Y, Sakata M, Naganawa M, Oda K, Miyatake R, Fujisaki M, Shimizu E, Shirayama Y, Iyo M, Hashimoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "17662961", "url": "https://glygen.org/publication/PubMed/17662961" } ] }, { "title": "Orphan nuclear receptor TLX recruits histone deacetylases to repress transcription and regulate neural stem cell proliferation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Sun G, Yu RT, Evans RM, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "17873065", "url": "https://glygen.org/publication/PubMed/17873065" } ] }, { "title": "Suppression of PTEN expression is essential for antiapoptosis and cellular transformation by oncogenic Ras.", "journal": "Cancer research", "date": "2007", "authors": "Vasudevan KM, Burikhanov R, Goswami A, Rangnekar VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "17974977", "url": "https://glygen.org/publication/PubMed/17974977" } ] }, { "title": "Repression of PTEN phosphatase by Snail1 transcriptional factor during gamma radiation-induced apoptosis.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Escriva M, Peiro S, Herranz N, Villagrasa P, Dave N, Montserrat-Sentis B, Murray SA, Franci C, Gridley T, Virtanen I, Garcia de Herreros A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "18172008", "url": "https://glygen.org/publication/PubMed/18172008" } ] }, { "title": "Transrepressive function of TLX requires the histone demethylase LSD1.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Yokoyama A, Takezawa S, Schule R, Kitagawa H, Kato S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "18391013", "url": "https://glygen.org/publication/PubMed/18391013" } ] }, { "title": "SALL4 is a key regulator of survival and apoptosis in human leukemic cells.", "journal": "Blood", "date": "2008", "authors": "Yang J, Chai L, Gao C, Fowles TC, Alipio Z, Dang H, Xu D, Fink LM, Ward DC, Ma Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "18487508", "url": "https://glygen.org/publication/PubMed/18487508" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" }, { "database": "iPTMnet", "id": "Q9UKL0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Lnk inhibits myeloproliferative disorder-associated JAK2 mutant, JAK2V617F.", "journal": "Journal of leukocyte biology", "date": "2009", "authors": "Gery S, Cao Q, Gueller S, Xing H, Tefferi A, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "19293402", "url": "https://glygen.org/publication/PubMed/19293402" } ] }, { "title": "Stem cell factor SALL4 represses the transcriptions of PTEN and SALL1 through an epigenetic repressor complex.", "journal": "PloS one", "date": "2009", "authors": "Lu J, Jeong HW, Kong N, Yang Y, Carroll J, Luo HR, Silberstein LE, Yupoma, Chai L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "19440552", "url": "https://glygen.org/publication/PubMed/19440552" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" }, { "database": "iPTMnet", "id": "Q9UKL0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "The polycomb group protein Bmi-1 represses the tumor suppressor PTEN and induces epithelial-mesenchymal transition in human nasopharyngeal epithelial cells.", "journal": "The Journal of clinical investigation", "date": "2009", "authors": "Song LB, Li J, Liao WT, Feng Y, Yu CP, Hu LJ, Kong QL, Xu LH, Zhang X, Liu WL, Li MZ, Zhang L, Kang TB, Fu LW, Huang WL, Xia YF, Tsao SW, Li M, Band V, Band H, Shi QH, Zeng YX, Zeng MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "19884659", "url": "https://glygen.org/publication/PubMed/19884659" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" }, { "database": "iPTMnet", "id": "Q9UKL0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Identification of a primary target of thalidomide teratogenicity.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Ito T, Ando H, Suzuki T, Ogura T, Hotta K, Imamura Y, Yamaguchi Y, Handa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "20223979", "url": "https://glygen.org/publication/PubMed/20223979" } ] }, { "title": "Requirement of the mTOR kinase for the regulation of Maf1 phosphorylation and control of RNA polymerase III-dependent transcription in cancer cells.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Shor B, Wu J, Shakey Q, Toral-Barza L, Shi C, Follettie M, Yu K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "20233713", "url": "https://glygen.org/publication/PubMed/20233713" } ] }, { "title": "mTORC1 directly phosphorylates and regulates human MAF1.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Michels AA, Robitaille AM, Buczynski-Ruchonnet D, Hodroj W, Reina JH, Hall MN, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "20516213", "url": "https://glygen.org/publication/PubMed/20516213" } ] }, { "title": "Regulation of mouse steroidogenesis by WHISTLE and JMJD1C through histone methylation balance.", "journal": "Nucleic acids research", "date": "2010", "authors": "Kim SM, Kim JY, Choe NW, Cho IH, Kim JR, Kim DW, Seol JE, Lee SE, Kook H, Nam KI, Kook H, Bhak YY, Seo SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "20530532", "url": "https://glygen.org/publication/PubMed/20530532" } ] }, { "title": "Regulation of immune cell homeostasis by type I interferons.", "journal": "Cytokine & growth factor reviews", "date": "2010", "authors": "Mattei F, Schiavoni G, Tough DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "20627800", "url": "https://glygen.org/publication/PubMed/20627800" } ] }, { "title": "Evi1 represses PTEN expression and activates PI3K/AKT/mTOR via interactions with polycomb proteins.", "journal": "Blood", "date": "2011", "authors": "Yoshimi A, Goyama S, Watanabe-Okochi N, Yoshiki Y, Nannya Y, Nitta E, Arai S, Sato T, Shimabe M, Nakagawa M, Imai Y, Kitamura T, Kurokawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "21289308", "url": "https://glygen.org/publication/PubMed/21289308" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" }, { "database": "iPTMnet", "id": "Q9UKL0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Romidepsin (Istodax, NSC 630176, FR901228, FK228, depsipeptide): a natural product recently approved for cutaneous T-cell lymphoma.", "journal": "The Journal of antibiotics", "date": "2011", "authors": "VanderMolen KM, McCulloch W, Pearce CJ, Oberlies NH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "21587264", "url": "https://glygen.org/publication/PubMed/21587264" } ] }, { "title": "Mitochondrial GTP-AMP phosphotransferase. 2. Kinetic and equilibrium dialysis studies.", "journal": "European journal of biochemistry", "date": "1979", "authors": "Tomasselli AG, Noda LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "218813", "url": "https://glygen.org/publication/PubMed/218813" } ] }, { "title": "Stem cell gene SALL4 suppresses transcription through recruitment of DNA methyltransferases.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Yang J, Corsello TR, Ma Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "22128185", "url": "https://glygen.org/publication/PubMed/22128185" } ] }, { "title": "An extension of hypotheses regarding rapid-acting, treatment-refractory, and conventional antidepressant activity of dextromethorphan and dextrorphan.", "journal": "Medical hypotheses", "date": "2012", "authors": "Lauterbach EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "22401777", "url": "https://glygen.org/publication/PubMed/22401777" } ] }, { "title": "Cereblon is a direct protein target for immunomodulatory and antiproliferative activities of lenalidomide and pomalidomide.", "journal": "Leukemia", "date": "2012", "authors": "Lopez-Girona A, Mendy D, Ito T, Miller K, Gandhi AK, Kang J, Karasawa S, Carmel G, Jackson P, Abbasian M, Mahmoudi A, Cathers B, Rychak E, Gaidarova S, Chen R, Schafer PH, Handa H, Daniel TO, Evans JF, Chopra R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "22552008", "url": "https://glygen.org/publication/PubMed/22552008" } ] }, { "title": "An overview of tubulin inhibitors that interact with the colchicine binding site.", "journal": "Pharmaceutical research", "date": "2012", "authors": "Lu Y, Chen J, Xiao M, Li W, Miller DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "22814904", "url": "https://glygen.org/publication/PubMed/22814904" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" }, { "database": "iPTMnet", "id": "Q9UKL0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Targeting transcription factor SALL4 in acute myeloid leukemia by interrupting its interaction with an epigenetic complex.", "journal": "Blood", "date": "2013", "authors": "Gao C, Dimitrov T, Yong KJ, Tatetsu H, Jeong HW, Luo HR, Bradner JE, Tenen DG, Chai L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "23287862", "url": "https://glygen.org/publication/PubMed/23287862" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9UKL0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "From alpha4beta2 Nicotinic Ligands to the Discovery of sigma1 Receptor Ligands: Pharmacophore Analysis and Rational Design.", "journal": "ACS medicinal chemistry letters", "date": "2012", "authors": "Yu LF, Zhang HK, Gunosewoyo H, Kozikowski AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "23641311", "url": "https://glygen.org/publication/PubMed/23641311" } ] }, { "title": "4-Acyl pyrroles: mimicking acetylated lysines in histone code reading.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2013", "authors": "Lucas X, Wohlwend D, Hugle M, Schmidtkunz K, Gerhardt S, Schule R, Jung M, Einsle O, Gunther S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "24272870", "url": "https://glygen.org/publication/PubMed/24272870" } ] }, { "title": "Dual kinase-bromodomain inhibitors for rationally designed polypharmacology.", "journal": "Nature chemical biology", "date": "2014", "authors": "Ciceri P, Muller S, O'Mahony A, Fedorov O, Filippakopoulos P, Hunt JP, Lasater EA, Pallares G, Picaud S, Wells C, Martin S, Wodicka LM, Shah NP, Treiber DK, Knapp S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "24584101", "url": "https://glygen.org/publication/PubMed/24584101" } ] }, { "title": "The tumor suppressor PTEN interacts with p53 in hereditary cancer (Review).", "journal": "International journal of oncology", "date": "2014", "authors": "Nakanishi A, Kitagishi Y, Ogura Y, Matsuda S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "24718924", "url": "https://glygen.org/publication/PubMed/24718924" } ] }, { "title": "SLUG is a direct transcriptional repressor of PTEN tumor suppressor.", "journal": "The Prostate", "date": "2015", "authors": "Uygur B, Abramo K, Leikina E, Vary C, Liaw L, Wu WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "25728608", "url": "https://glygen.org/publication/PubMed/25728608" } ] }, { "title": "Structure guided design of potent and selective ponatinib-based hybrid inhibitors for RIPK1.", "journal": "Cell reports", "date": "2015", "authors": "Najjar M, Suebsuwong C, Ray SS, Thapa RJ, Maki JL, Nogusa S, Shah S, Saleh D, Gough PJ, Bertin J, Yuan J, Balachandran S, Cuny GD, Degterev A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "25801024", "url": "https://glygen.org/publication/PubMed/25801024" } ] }, { "title": "CC-122, a pleiotropic pathway modifier, mimics an interferon response and has antitumor activity in DLBCL.", "journal": "Blood", "date": "2015", "authors": "Hagner PR, Man HW, Fontanillo C, Wang M, Couto S, Breider M, Bjorklund C, Havens CG, Lu G, Rychak E, Raymon H, Narla RK, Barnes L, Khambatta G, Chiu H, Kosek J, Kang J, Amantangelo MD, Waldman M, Lopez-Girona A, Cai T, Pourdehnad M, Trotter M, Daniel TO, Schafer PH, Klippel A, Thakurta A, Chopra R, Gandhi AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "26002965", "url": "https://glygen.org/publication/PubMed/26002965" } ] }, { "title": "Belinostat in Patients With Relapsed or Refractory Peripheral T-Cell Lymphoma: Results of the Pivotal Phase II BELIEF (CLN-19) Study.", "journal": "Journal of clinical oncology : official journal of the American Society of Clinical Oncology", "date": "2015", "authors": "O'Connor OA, Horwitz S, Masszi T, Van Hoof A, Brown P, Doorduijn J, Hess G, Jurczak W, Knoblauch P, Chawla S, Bhat G, Choi MR, Walewski J, Savage K, Foss F, Allen LF, Shustov A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "26101246", "url": "https://glygen.org/publication/PubMed/26101246" } ] }, { "title": "Properties and catalytic activities of MICAL1, the flavoenzyme involved in cytoskeleton dynamics, and modulation by its CH, LIM and C-terminal domains.", "journal": "Archives of biochemistry and biophysics", "date": "2016", "authors": "Vitali T, Maffioli E, Tedeschi G, Vanoni MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "26845023", "url": "https://glygen.org/publication/PubMed/26845023" } ] }, { "title": "MAF1 suppresses AKT-mTOR signaling and liver cancer through activation of PTEN transcription.", "journal": "Hepatology (Baltimore, Md.)", "date": "2016", "authors": "Li Y, Tsang CK, Wang S, Li XX, Yang Y, Fu L, Huang W, Li M, Wang HY, Zheng XF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "26910647", "url": "https://glygen.org/publication/PubMed/26910647" } ] }, { "title": "A Cereblon Modulator (CC-220) with Improved Degradation of Ikaros and Aiolos.", "journal": "Journal of medicinal chemistry", "date": "2018", "authors": "Matyskiela ME, Zhang W, Man HW, Muller G, Khambatta G, Baculi F, Hickman M, LeBrun L, Pagarigan B, Carmel G, Lu CC, Lu G, Riley M, Satoh Y, Schafer P, Daniel TO, Carmichael J, Cathers BE, Chamberlain PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "28425720", "url": "https://glygen.org/publication/PubMed/28425720" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9UKL0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Cereblon modulator iberdomide induces degradation of the transcription factors Ikaros and Aiolos: immunomodulation in healthy volunteers and relevance to systemic lupus erythematosus.", "journal": "Annals of the rheumatic diseases", "date": "2018", "authors": "Schafer PH, Ye Y, Wu L, Kosek J, Ringheim G, Yang Z, Liu L, Thomas M, Palmisano M, Chopra R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "29945920", "url": "https://glygen.org/publication/PubMed/29945920" } ] }, { "title": "A First-in-Human Study of Novel Cereblon Modulator Avadomide (CC-122) in Advanced Malignancies.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2019", "authors": "Rasco DW, Papadopoulos KP, Pourdehnad M, Gandhi AK, Hagner PR, Li Y, Wei X, Chopra R, Hege K, DiMartino J, Shih K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "30201761", "url": "https://glygen.org/publication/PubMed/30201761" } ] }, { "title": "Targeting RIPK1 for the treatment of human diseases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2019", "authors": "Degterev A, Ofengeim D, Yuan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "31048504", "url": "https://glygen.org/publication/PubMed/31048504" } ] }, { "title": "MYT1 attenuates neuroblastoma cell differentiation by interacting with the LSD1/CoREST complex.", "journal": "Oncogene", "date": "2020", "authors": "Chen K, Cai Y, Cheng C, Zhang J, Lv F, Xu G, Duan P, Wu Y, Wu Z", "evidence": [ { "database": "RefSeq", "id": "NP_055971", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971" } ], "reference": [ { "type": "PubMed", "id": "32251364", "url": "https://glygen.org/publication/PubMed/32251364" } ] }, { "title": "RCOR1 directly binds to MED28 and weakens its inducing effect on cancer stem cell-like activity of oral cavity squamous cell carcinoma cells.", "journal": "Journal of oral pathology & medicine : official publication of the International Association of Oral Pathologists and the American Academy of Oral Pathology", "date": "2020", "authors": "Xiang Z, Zhou S, Liang S, Zhang G, Tan Y", "evidence": [ { "database": "RefSeq", "id": "NP_055971", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971" } ], "reference": [ { "type": "PubMed", "id": "32306431", "url": "https://glygen.org/publication/PubMed/32306431" } ] }, { "title": "Crystal Structure of the LSD1/CoREST Histone Demethylase Bound to Its Nucleosome Substrate.", "journal": "Molecular cell", "date": "2020", "authors": "Kim SA, Zhu J, Yennawar N, Eek P, Tan S", "evidence": [ { "database": "RefSeq", "id": "NP_055971", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971" } ], "reference": [ { "type": "PubMed", "id": "32396821", "url": "https://glygen.org/publication/PubMed/32396821" } ] }, { "title": "A new tandem enrichment strategy for the simultaneous profiling of O-GlcNAcylation and phosphorylation in RNA-binding proteome.", "journal": "The Analyst", "date": "2021", "authors": "Fan Z, Li J, Liu T, Zhang Z, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9UKL0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UKL0" }, { "database": "O-GlcNAc Atlas", "id": "Q9UKL0", "url": "https://oglcnac.org/atlas/detail/Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "33465208", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "title": "Genome-wide association study suggests that variation at the RCOR1 locus is associated with tinnitus in UK Biobank.", "journal": "Scientific reports", "date": "2021", "authors": "Wells HRR, Abidin FNZ, Freidin MB, Williams FMK, Dawson SJ", "evidence": [ { "database": "RefSeq", "id": "NP_055971", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055971" } ], "reference": [ { "type": "PubMed", "id": "33742053", "url": "https://glygen.org/publication/PubMed/33742053" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9UKL0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UKL0" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Regulated expression of a gene encoding a nuclear factor, IRF-1, that specifically binds to IFN-beta gene regulatory elements.", "journal": "Cell", "date": "1988", "authors": "Miyamoto M, Fujita T, Kimura Y, Maruyama M, Harada H, Sudo Y, Miyata T, Taniguchi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "3409321", "url": "https://glygen.org/publication/PubMed/3409321" } ] }, { "title": "FR901228, a novel antitumor bicyclic depsipeptide produced by Chromobacterium violaceum No. 968. I. Taxonomy, fermentation, isolation, physico-chemical and biological properties, and antitumor activity.", "journal": "The Journal of antibiotics", "date": "1994", "authors": "Ueda H, Nakajima H, Hori Y, Fujita T, Nishimura M, Goto T, Okuhara M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "7513682", "url": "https://glygen.org/publication/PubMed/7513682" } ] }, { "title": "Isolation of inositol 1,3,4-trisphosphate 5/6-kinase, cDNA cloning and expression of the recombinant enzyme.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Wilson MP, Majerus PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "8662638", "url": "https://glygen.org/publication/PubMed/8662638" } ] }, { "title": "NF-E2 disrupts chromatin structure at human beta-globin locus control region hypersensitive site 2 in vitro.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Armstrong JA, Emerson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "8816476", "url": "https://glygen.org/publication/PubMed/8816476" } ] }, { "title": "Identification of a novel protein kinase A anchoring protein that binds both type I and type II regulatory subunits.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Huang LJ, Durick K, Weiner JA, Chun J, Taylor SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9065479", "url": "https://glygen.org/publication/PubMed/9065479" } ] }, { "title": "Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex.", "journal": "Cell", "date": "1997", "authors": "Zhang Y, Iratni R, Erdjument-Bromage H, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "9150135", "url": "https://glygen.org/publication/PubMed/9150135" } ] }, { "title": "FOG, a multitype zinc finger protein, acts as a cofactor for transcription factor GATA-1 in erythroid and megakaryocytic differentiation.", "journal": "Cell", "date": "1997", "authors": "Tsang AP, Visvader JE, Turner CA, Fujiwara Y, Yu C, Weiss MJ, Crossley M, Orkin SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9230307", "url": "https://glygen.org/publication/PubMed/9230307" } ] }, { "title": "D-AKAP2, a novel protein kinase A anchoring protein with a putative RGS domain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Huang LJ, Durick K, Weiner JA, Chun J, Taylor SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9326583", "url": "https://glygen.org/publication/PubMed/9326583" } ] }, { "title": "Vertebrates have conserved capping protein alpha isoforms with specific expression patterns.", "journal": "Cell motility and the cytoskeleton", "date": "1997", "authors": "Hart MC, Korshunova YO, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9331217", "url": "https://glygen.org/publication/PubMed/9331217" } ] }, { "title": "Structure of IRF-1 with bound DNA reveals determinants of interferon regulation.", "journal": "Nature", "date": "1998", "authors": "Escalante CR, Yie J, Thanos D, Aggarwal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9422515", "url": "https://glygen.org/publication/PubMed/9422515" } ] }, { "title": "SAP30, a novel protein conserved between human and yeast, is a component of a histone deacetylase complex.", "journal": "Molecular cell", "date": "1998", "authors": "Zhang Y, Sun ZW, Iratni R, Erdjument-Bromage H, Tempst P, Hampsey M, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "9651585", "url": "https://glygen.org/publication/PubMed/9651585" } ] }, { "title": "The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling activities.", "journal": "Cell", "date": "1998", "authors": "Zhang Y, LeRoy G, Seelig HP, Lane WS, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "9790534", "url": "https://glygen.org/publication/PubMed/9790534" } ] }, { "title": "FOG-2: A novel GATA-family cofactor related to multitype zinc-finger proteins Friend of GATA-1 and U-shaped.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Tevosian SG, Deconinck AE, Cantor AB, Rieff HI, Fujiwara Y, Corfas G, Orkin SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9927674", "url": "https://glygen.org/publication/PubMed/9927674" } ] } ], "pathway": [ { "id": "hsa:23186", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:23186", "resource": "KEGG Pathway" }, { "id": "R-HSA-3214815", "name": "HDACs deacetylate histones", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815", "resource": "Reactome", "description": "HDACs deacetylate histones" }, { "id": "R-HSA-8943724", "name": "Regulation of PTEN gene transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724", "resource": "Reactome", "description": "Regulation of PTEN gene transcription" }, { "id": "R-HSA-9679191", "name": "Potential therapeutics for SARS", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191", "resource": "Reactome", "description": "Potential therapeutics for SARS" }, { "id": "R-HSA-983231", "name": "Factors involved in megakaryocyte development and platelet production", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231", "resource": "Reactome", "description": "Factors involved in megakaryocyte development and platelet production" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8CFE3-1", "protein_name": "REST corepressor 1", "gene_name": "Rcor1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPAMVEKGPEVSGKRRGRNTAASAASAAASAASAAASAAASAGTASASAAAAASAAAAPNNGQNKSLAAAAPNGNSGSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAAVPDFDPAKLARRSQERDNLGMLVWSPNQSLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEETNGSNPVDIEIDPNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSIKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKDETNGPANQKPVKSPESSIKIPEEEDEAASVLDVRYASAS", "length": 480 }, "evidence": [ { "id": "45229489", "url": "http://www.informatics.jax.org/homology/45229489", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" }, { "name": "transcription corepressor activity", "id": "GO:0003714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003714", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" }, { "name": "transcription repressor complex", "id": "GO:0017053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017053", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" }, { "name": "histone deacetylase complex", "id": "GO:0000118", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000118", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" }, { "name": "DNA repair complex", "id": "GO:1990391", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990391", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" }, { "name": "erythrocyte differentiation", "id": "GO:0030218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030218", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" }, { "name": "chromatin organization", "id": "GO:0006325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006325", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" }, { "name": "positive regulation of megakaryocyte differentiation", "id": "GO:0045654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045654", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 143, "end_pos": 145, "annotation": "n_glycosylation_sequon" }, { "start_pos": 187, "end_pos": 189, "annotation": "n_glycosylation_sequon" }, { "start_pos": 330, "end_pos": 332, "annotation": "n_glycosylation_sequon" }, { "start_pos": 414, "end_pos": 416, "annotation": "n_glycosylation_sequon" }, { "start_pos": 70, "end_pos": 72, "annotation": "n_glycosylation_sequon" }, { "start_pos": 81, "end_pos": 83, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by HSV-1 protein kinases in case of infection.", "evidence": [ { "database": "UniProtKB", "id": "Q9UKL0", "url": "https://www.uniprot.org/uniprot/Q9UKL0" }, { "database": "PubMed", "id": "15897453", "url": "https://glygen.org/publication/PubMed/15897453" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 113 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }