{ "uniprot_canonical_ac": "Q9R1X5-1", "uniprot_ac": "Q9R1X5", "uniprot_id": "MRP5_MOUSE", "mass": { "chemical_mass": 161125.0, "monoisotopic_mass": 161125.0 }, "refseq": { "ac": "NP_789809", "name": "ATP-binding cassette sub-family C member 5 isoform 2", "summary": "The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The human protein functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that the human protein provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl)adenine. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_789809" }, "gene_names": [ { "name": "Abcc5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9R1X5", "id": "Q9R1X5" }, { "name": "2900011L11Rik; Abcc5a; Abcc5b; Mrp5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_789809", "id": "NP_789809" }, { "name": "Abcc5a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9R1X5", "id": "Q9R1X5" }, { "name": "Abcc5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_789809", "id": "NP_789809" }, { "name": "Mrp5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9R1X5", "id": "Q9R1X5" } ], "protein_names": [ { "name": "ATP-binding cassette sub-family C member 5", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9R1X5" }, { "name": "7.6.2.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R1X5" }, { "name": "7.6.2.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R1X5" }, { "name": "ATP-binding cassette sub-family C member 5 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038818", "id": "NP_038818" }, { "name": "ATP-binding cassette sub-family C member 5 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_789809", "id": "NP_789809" }, { "name": "MOAT-C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R1X5" }, { "name": "Multi-specific organic anion transporter C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R1X5" }, { "name": "Multidrug resistance-associated protein 5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R1X5" }, { "name": "SMRP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R1X5" }, { "name": "multidrug resistance-associated protein 5; SMRP; MOAT-C; multi-specific organic anion transporter C; ATP-binding cassette, sub-family C (CFTR/MRP), member 5a; ATP-binding cassette, sub-family C (CFTR/MRP), member 5b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038818", "id": "NP_038818" } ], "function": [ { "annotation": "ABCC5 is a general glutamate conjugate and analog transporter that affects the disposition of endogenous metabolites, toxins, and drugs.", "evidence": [ { "database": "RefSeq", "id": "NP_789809", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_789809" }, { "database": "PubMed", "id": "26515061", "url": "https://glygen.org/publication/PubMed/26515061" }, { "database": "RefSeq", "id": "NP_038818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038818" } ] }, { "annotation": "ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes physiological compounds, and xenobiotics from cells. Mediates ATP-dependent transport of endogenous metabolites like cyclic nucleotides, such as cAMP and cGMP, folic acid and N-lactoyl-amino acids (in vitro) (By similarity) (PubMed:17229149). Acts also as a general glutamate conjugate and analog transporter that can limit the brain levels of endogenous metabolites, drugs, and toxins (PubMed:26515061). Confers resistance to the antiviral agent PMEA (By similarity). Able to transport several anticancer drugs including methotrexate, and nucleotide analogs in vitro, however it does with low affinity (By similarity). Acts as a heme transporter required for the translocation of cytosolic heme to the secretory pathway (PubMed:24836561). May play a role in energy metabolism by regulating the glucagon-like peptide 1 (GLP-1) secretion from enteroendocrine cells (PubMed:31338999).", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5#function" }, { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440#function" }, { "database": "PubMed", "id": "24836561", "url": "https://glygen.org/publication/PubMed/24836561" }, { "database": "PubMed", "id": "26515061", "url": "https://glygen.org/publication/PubMed/26515061" }, { "database": "PubMed", "id": "31338999", "url": "https://glygen.org/publication/PubMed/31338999" }, { "database": "PubMed", "id": "17229149", "url": "https://glygen.org/publication/PubMed/17229149" } ] }, { "annotation": "Deficiency of MKP5 resulted in increased inflammatory activation in macrophages. These findings thus demonstrate that MKP5 critically controls inflammation in white adipose tissue and the development of metabolic disorders", "evidence": [ { "database": "RefSeq", "id": "NP_789809", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_789809" }, { "database": "PubMed", "id": "25922079", "url": "https://glygen.org/publication/PubMed/25922079" }, { "database": "RefSeq", "id": "NP_038818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038818" } ] }, { "annotation": "MRP5 and MRP9 play a concerted role in male reproduction and mitochondrial function.", "evidence": [ { "database": "RefSeq", "id": "NP_789809", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_789809" }, { "database": "PubMed", "id": "35121660", "url": "https://glygen.org/publication/PubMed/35121660" }, { "database": "RefSeq", "id": "NP_038818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038818" } ] }, { "annotation": "The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The human protein functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that the human protein provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl)adenine. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_789809", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_789809" }, { "database": "RefSeq", "id": "NP_038818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038818" } ] } ], "disease": [ { "disease_id": "DOID:1793", "recommended_name": { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic cancer", "description": "An endocrine gland cancer located_in the pancreas." }, "synonyms": [ { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreas neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic tumor", "description": "" } ], "evidence": [ { "id": "1793", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1793" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Abcc5", "url": "https://www.uniprot.org/uniprot/Q9R1X5", "locus": { "chromosome": "16", "start_pos": 20150053, "end_pos": 20245144, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000022822", "url": "https://www.ensembl.org/id/ENSMUSG00000022822" } ] } } ], "crossref": [ { "id": "ENSMUSG00000022822", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000022822", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03244", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03244", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03250", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03250", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd18592", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd18592", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd18599", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd18599", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "27416", "url": "https://www.ncbi.nlm.nih.gov/gene/27416", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003439", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003439", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003593", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003593", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011527", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011527", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017871", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017871", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036640", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036640", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:27416", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:27416", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1351644", "url": "http://www.informatics.jax.org/marker/MGI:1351644", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q9R1X5", "url": "https://oglcnac.org/atlas/detail/Q9R1X5", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "Q9R1X5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9R1X5", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "AVRFVKF", "url": "https://omabrowser.org/oma/group/AVRFVKF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3384185at2759", "url": "http://www.orthodb.org/?query=3384185at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24223", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24223", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24223:SF196", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24223:SF196", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00005", "url": "http://pfam.xfam.org/family/PF00005", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00664", "url": "http://pfam.xfam.org/family/PF00664", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9R1X5", "url": "http://purl.obolibrary.org/obo/PR_Q9R1X5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-2142850", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2142850", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-382556", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9748787", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9753281", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_038818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038818", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "66184", "url": "https://www.rhea-db.org/rhea/66184", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66188", "url": "https://www.rhea-db.org/rhea/66188", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66720", "url": "https://www.rhea-db.org/rhea/66720", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66728", "url": "https://www.rhea-db.org/rhea/66728", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66732", "url": "https://www.rhea-db.org/rhea/66732", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66736", "url": "https://www.rhea-db.org/rhea/66736", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66740", "url": "https://www.rhea-db.org/rhea/66740", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66744", "url": "https://www.rhea-db.org/rhea/66744", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66752", "url": "https://www.rhea-db.org/rhea/66752", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66756", "url": "https://www.rhea-db.org/rhea/66756", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66760", "url": "https://www.rhea-db.org/rhea/66760", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66764", "url": "https://www.rhea-db.org/rhea/66764", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A338P7E4", "url": "https://www.uniprot.org/uniprot/A0A338P7E4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A338P7E4-1", "url": "https://www.uniprot.org/uniprot/A0A338P7E4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WJ10", "url": "https://www.uniprot.org/uniprot/F8WJ10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WJ10-1", "url": "https://www.uniprot.org/uniprot/F8WJ10-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6P8Q2", "url": "https://www.uniprot.org/uniprot/Q6P8Q2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6P8Q2-1", "url": "https://www.uniprot.org/uniprot/Q6P8Q2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9R1X5-1", "url": "https://www.uniprot.org/uniprot/Q9R1X5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKDIDMGKEYIIPSPGYRSDRDRSAVPGQHRDPEEPRFRRTRSLECQDALETAARVEGLSLDISVHSHLQILDEEHSKGKYHHGLSVLKPFRTTTKHQHPVDNAGLFSYMTFSWLSPLARVVHKKGELLMEDVWPLSKYESSDVNSRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFVVKHLLEYTQATESNLQYSLLLVLGLLLTEVVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFVSRLTAYFRRKCVAATDDRVQKMNEVLTYIKFIKMYAWVKAFSQCVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSVHMTLGFHLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKIEMKNATLAWDSSHSSIQNSPKLTPKMKKDKRATRGKKEKSRQLQHTEHQAVLAEQKGHLLLDSDERPSPEEEEGKQIHTGSLRLQRTLYNIDLEIEEGKLVGICGSVGSGKTSLVSAILGQMTLLEGSIAVSGTFAYVAQQAWILNATLRDNILFGKEFDEERYNSVLNSCCLRPDLAILPNSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVGNHIFNSAIRKRLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATIFNNLLLGETPPVEINSKKEATGSQKSQDKGPKPGSVKKEKAVKSEEGQLVQVEEKGQGSVPWSVYWVYIQAAGGPLAFLVIMVLFMLNVGSTAFSTWWLSYWIKQGSGNSTVYQGNRSFVSDSMKDNPFMQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLLILFSLLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKRQEFLHRYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPSAYAGLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPPHDWPQEGEVTFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGIRISDIGLADLRSKLAIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLESEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG", "length": 1436, "header": "sp|Q9R1X5-1|MRP5_MOUSE Isoform 1 of ATP-binding cassette sub-family C member 5 OS=Mus musculus OX=10090 GN=Abcc5 PE=1 SV=2 CANONICAL=Q9R1X5-1" }, "isoforms": [ { "isoform_ac": "A0A338P7E4-1", "url": "", "sequence": { "sequence": "RLTAYFRRKCVAATDDRVQKMNEVLTYIKFIKMYAWVKAFSQCVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSVHMTLGFHLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKLPSTV", "length": 136, "header": "tr|A0A338P7E4-1|A0A338P7E4_MOUSE Computationally mapped isoform of ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Mus musculus OX=10090 GN=Abcc5 PE=1 SV=1 CANONICAL=Q9R1X5-1" }, "locus": { "chromosome": "16", "start_pos": 20217698, "end_pos": 20211658, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000232044.2", "url": "https://www.ensembl.org/id/ENSMUST00000232044.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000156205.2", "url": "https://www.ensembl.org/id/ENSMUSP00000156205.2" } ] } }, { "isoform_ac": "F8WJ10-1", "url": "", "sequence": { "sequence": "MKDIDMGKEYIIPSPGYRSDRDRSAVPGQHRDPEEPRFRRTRSLECQDALETAARVEGLSLDISVHSHLQILDEEHSKGKYHHGLSVLKPFRTTTKHQHPVDNAGLFSYMTFSWLSPLARVVHKKGELLMEDVWPLSKYESSDVNSRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFVVKHLLEYTQATESNLQYSLLLVLGLLLTEVVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFVSRLTAYFRRKCVAATDDRVQKMNEVLTYIKFIKMYAWVKAFSQCVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSVHMTLGFHLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKIEMKNATLAWDSSHSSIQNSPKL", "length": 512, "header": "tr|F8WJ10-1|MRP5_MOUSE Computationally mapped isoform of ATP-binding cassette sub-family C member 5 OS=Mus musculus OX=10090 GN=Abcc5 PE=1 SV=1 CANONICAL=Q9R1X5-1" }, "locus": { "chromosome": "16", "start_pos": 20241183, "end_pos": 20211426, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000077867.10", "url": "https://www.ensembl.org/id/ENSMUST00000077867.10" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000077031.4", "url": "https://www.ensembl.org/id/ENSMUSP00000077031.4" } ] } }, { "isoform_ac": "Q6P8Q2-1", "url": "", "sequence": { "sequence": "MKDIDMGKEYIIPSPGYRSDRDRSAVPGQHRDPEEPRFRRTRSLECQDALETAARVEGLSLDISVHSHLQILDEEHSKGKYHHGLSVLKPFRTTTKHQHPVDNAGLFSYMTFSWLSPLARVVHKKGELLMEDVWPLSKYESSDVNSRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPNFQDGCILRSE", "length": 208, "header": "tr|Q6P8Q2-1|MRP5_MOUSE Computationally mapped isoform of ATP-binding cassette sub-family C member 5 OS=Mus musculus OX=10090 GN=Abcc5 PE=1 SV=1 CANONICAL=Q9R1X5-1" }, "locus": { "chromosome": "16", "start_pos": 20241183, "end_pos": 20221052, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000096199.5", "url": "https://www.ensembl.org/id/ENSMUST00000096199.5" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000093913.5", "url": "https://www.ensembl.org/id/ENSMUSP00000093913.5" } ] } }, { "isoform_ac": "Q9R1X5-1", "url": "", "sequence": { "sequence": "MKDIDMGKEYIIPSPGYRSDRDRSAVPGQHRDPEEPRFRRTRSLECQDALETAARVEGLSLDISVHSHLQILDEEHSKGKYHHGLSVLKPFRTTTKHQHPVDNAGLFSYMTFSWLSPLARVVHKKGELLMEDVWPLSKYESSDVNSRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFVVKHLLEYTQATESNLQYSLLLVLGLLLTEVVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFVSRLTAYFRRKCVAATDDRVQKMNEVLTYIKFIKMYAWVKAFSQCVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSVHMTLGFHLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKIEMKNATLAWDSSHSSIQNSPKLTPKMKKDKRATRGKKEKSRQLQHTEHQAVLAEQKGHLLLDSDERPSPEEEEGKQIHTGSLRLQRTLYNIDLEIEEGKLVGICGSVGSGKTSLVSAILGQMTLLEGSIAVSGTFAYVAQQAWILNATLRDNILFGKEFDEERYNSVLNSCCLRPDLAILPNSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVGNHIFNSAIRKRLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATIFNNLLLGETPPVEINSKKEATGSQKSQDKGPKPGSVKKEKAVKSEEGQLVQVEEKGQGSVPWSVYWVYIQAAGGPLAFLVIMVLFMLNVGSTAFSTWWLSYWIKQGSGNSTVYQGNRSFVSDSMKDNPFMQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLLILFSLLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKRQEFLHRYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPSAYAGLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPPHDWPQEGEVTFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGIRISDIGLADLRSKLAIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLESEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG", "length": 1436, "header": "sp|Q9R1X5-1|MRP5_MOUSE Isoform 1 of ATP-binding cassette sub-family C member 5 OS=Mus musculus OX=10090 GN=Abcc5 PE=1 SV=2 CANONICAL=Q9R1X5-1" }, "locus": { "chromosome": "16", "start_pos": 20241183, "end_pos": 20151357, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000115547", "url": "https://www.ensembl.org/id/ENSMUST00000115547" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000111209", "url": "https://www.ensembl.org/id/ENSMUSP00000111209" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1043, "start_aa": "Asn", "end_pos": 1043, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1043", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1213, "start_aa": "Ser", "end_pos": 1213, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1213", "evidence": [ { "id": "Q9R1X5", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9R1X5" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "Q9R1X5", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9R1X5" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1215, "start_aa": "Thr", "end_pos": 1215, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1215", "evidence": [ { "id": "Q9R1X5", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9R1X5" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "Q9R1X5", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9R1X5" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1328, "start_aa": "Asn", "end_pos": 1328, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1328", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1416, "start_aa": "Asn", "end_pos": 1416, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1416", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 494, "start_aa": "Asn", "end_pos": 494, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn494", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 636, "start_aa": "Asn", "end_pos": 636, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn636", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 684, "start_aa": "Asn", "end_pos": 684, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn684", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 889, "start_aa": "Asn", "end_pos": 889, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn889", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 896, "start_aa": "Asn", "end_pos": 896, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn896", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "site_lbl": "Ser14" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "site_lbl": "Ser19" }, { "start_pos": 43, "end_pos": 43, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "Q9R1X5", "url": "http://phospho.elm.eu.org/byAccession/Q9R1X5.html" }, { "database": "iPTMnet", "id": "Q9R1X5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9R1X5" } ], "site_lbl": "Ser43" }, { "start_pos": 505, "end_pos": 505, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9R1X5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9R1X5" } ], "site_lbl": "Ser505" }, { "start_pos": 509, "end_pos": 509, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "phospho.ELM", "id": "Q9R1X5", "url": "http://phospho.elm.eu.org/byAccession/Q9R1X5.html" }, { "database": "iPTMnet", "id": "Q9R1X5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9R1X5" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ], "site_lbl": "Ser509" }, { "start_pos": 513, "end_pos": 513, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "phospho.ELM", "id": "Q9R1X5", "url": "http://phospho.elm.eu.org/byAccession/Q9R1X5.html" }, { "database": "iPTMnet", "id": "Q9R1X5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9R1X5" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ], "site_lbl": "Thr513" }, { "start_pos": 60, "end_pos": 60, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "site_lbl": "Ser60" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Detailed structural analysis on both human MRP5 and mouse mrp5 transcripts.", "journal": "Gene", "date": "2000", "authors": "Sasaki H., Suzuki T., Nishio K., Saijo N., Tatsumi Y., Terada M., Tanabe S., Agui M., Kuh H.J.", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "reference": [ { "type": "PubMed", "id": "10721709", "url": "https://glygen.org/publication/PubMed/10721709" } ] }, { "title": "Differential, strain-specific cellular and subcellular distribution of multidrug transporters in murine choroid plexus and blood-brain barrier.", "journal": "Neuroscience", "date": "2006", "authors": "Fritschy J.M., Soontornmalai A., Vlaming M.L.", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "reference": [ { "type": "PubMed", "id": "16361063", "url": "https://glygen.org/publication/PubMed/16361063" } ] }, { "title": "cGMP transport by vesicles from human and mouse erythrocytes.", "journal": "FEBS J.", "date": "2007", "authors": "de Wolf CJ, Yamaguchi H, van der Heijden I, Wielinga PR, Hundscheid SL, Ono N, Scheffer GL, de Haas M, Schuetz JD, Wijnholds J, Borst P", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "reference": [ { "type": "PubMed", "id": "17229149", "url": "https://glygen.org/publication/PubMed/17229149" } ] }, { "title": "The phagosomal proteome in interferon-gamma-activated macrophages.", "journal": "Immunity", "date": "2009", "authors": "Trost M, English L, Lemieux S, Courcelles M, Desjardins M, Thibault P", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" }, { "database": "UniProtKB", "id": "Q6P8Q2", "url": "https://www.uniprot.org/uniprot/Q6P8Q2" }, { "database": "UniProtKB", "id": "F8WJ10", "url": "https://www.uniprot.org/uniprot/F8WJ10" }, { "database": "iPTMnet", "id": "Q9R1X5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9R1X5" } ], "reference": [ { "type": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" }, { "database": "iPTMnet", "id": "Q9R1X5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9R1X5" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Control of metazoan heme homeostasis by a conserved multidrug resistance protein.", "journal": "Cell Metab.", "date": "2014", "authors": "Zhang J., Scheffer G.L., Hamza I., Beardsley S., Korolnek T.", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "reference": [ { "type": "PubMed", "id": "24836561", "url": "https://glygen.org/publication/PubMed/24836561" } ] }, { "title": "Regulation of Adipose Tissue Inflammation and Insulin Resistance by MAPK Phosphatase 5.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Zhang Y, Nguyen T, Tang P, Kennedy NJ, Jiao H, Zhang M, Reynolds JM, Jaeschke A, Martin-Orozco N, Chung Y, He WM, Wang C, Jia W, Ge B, Davis RJ, Flavell RA, Dong C", "evidence": [ { "database": "RefSeq", "id": "NP_789809", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_789809" }, { "database": "RefSeq", "id": "NP_038818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038818" } ], "reference": [ { "type": "PubMed", "id": "25922079", "url": "https://glygen.org/publication/PubMed/25922079" } ] }, { "title": "ATP-binding Cassette Subfamily C Member 5 (ABCC5) Functions as an Efflux Transporter of Glutamate Conjugates and Analogs.", "journal": "J. Biol. Chem.", "date": "2015", "authors": "Jansen RS, Mahakena S, de Haas M, Borst P, van de Wetering K", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" }, { "database": "RefSeq", "id": "NP_789809", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_789809" }, { "database": "RefSeq", "id": "NP_038818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038818" } ], "reference": [ { "type": "PubMed", "id": "26515061", "url": "https://glygen.org/publication/PubMed/26515061" } ] }, { "title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.", "journal": "ACS chemical biology", "date": "2018", "authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9R1X5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9R1X5" }, { "database": "O-GlcNAc Atlas", "id": "Q9R1X5", "url": "https://oglcnac.org/atlas/detail/Q9R1X5" } ], "reference": [ { "type": "PubMed", "id": "30059200", "url": "https://glygen.org/publication/PubMed/30059200" } ] }, { "title": "Abcc5 Knockout Mice Have Lower Fat Mass and Increased Levels of Circulating GLP-1.", "journal": "Obesity", "date": "2019", "authors": "Cox R.D., Reimann F., Stewart M., Bentley E., de Wet H., Pires E., Larraufie P., Gribble F., Cotter L., Cantley J., Cyranka M., Hare N., Lear P., Lingam S., McCullagh J., McKay E.J., Saibudeen A., Thijsse A., Veprik A., van Loon N.", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "reference": [ { "type": "PubMed", "id": "31338999", "url": "https://glygen.org/publication/PubMed/31338999" } ] }, { "title": "MRP5 and MRP9 play a concerted role in male reproduction and mitochondrial function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2022", "authors": "Chambers IG, Kumar P, Lichtenberg J, Wang P, Yu J, Phillips JD, Kane MA, Bodine D, Hamza I", "evidence": [ { "database": "RefSeq", "id": "NP_789809", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_789809" }, { "database": "RefSeq", "id": "NP_038818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038818" } ], "reference": [ { "type": "PubMed", "id": "35121660", "url": "https://glygen.org/publication/PubMed/35121660" } ] } ], "pathway": [ { "id": "mmu:27416", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:27416", "resource": "KEGG Pathway" }, { "id": "R-MMU-2142850", "name": "Hyaluronan biosynthesis and export", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2142850", "resource": "Reactome", "description": "Hyaluronan biosynthesis and export" }, { "id": "R-MMU-382556", "name": "ABC-family proteins mediated transport", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-382556", "resource": "Reactome", "description": "ABC-family proteins mediated transport" }, { "id": "R-MMU-9748787", "name": "Azathioprine ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9748787", "resource": "Reactome", "description": "Azathioprine ADME" }, { "id": "R-MMU-9753281", "name": "Paracetamol ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9753281", "resource": "Reactome", "description": "Paracetamol ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "O15440-1", "protein_name": "ATP-binding cassette sub-family C member 5", "gene_name": "ABCC5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFMVKHLLEYTQATESNLQYSLLLVLGLLLTEIVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFASRLTAYFRRKCVAATDERVQKMNEVLTYIKFIKMYAWVKAFSQSVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSVHMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKIEMKNATLAWDSSHSSIQNSPKLTPKMKKDKRASRGKKEKVRQLQRTEHQAVLAEQKGHLLLDSDERPSPEEEEGKHIHLGHLRLQRTLHSIDLEIQEGKLVGICGSVGSGKTSLISAILGQMTLLEGSIAISGTFAYVAQQAWILNATLRDNILFGKEYDEERYNSVLNSCCLRPDLAILPSSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVGNHIFNSAIRKHLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATIFNNLLLGETPPVEINSKKETSGSQKKSQDKGPKTGSVKKEKAVKPEEGQLVQLEEKGQGSVPWSVYGVYIQAAGGPLAFLVIMALFMLNVGSTAFSTWWLSYWIKQGSGNTTVTRGNETSVSDSMKDNPHMQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLVILFSVLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKGQEFLHRYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPPAYAGLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQEGEVTFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISDIGLADLRSKLSIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLESEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG", "length": 1437 }, "evidence": [ { "id": "45230733", "url": "http://www.informatics.jax.org/homology/45230733", "database": "MGI" }, { "id": "Q9R1X5", "url": "https://omabrowser.org/oma/group/Q9R1X5/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9QYM0-1", "protein_name": "ATP-binding cassette sub-family C member 5", "gene_name": "Abcc5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKDIDMGKEYIIPSPGYRSVRDRSTIPGTHGDREDPSSGEQISLECQDALETAARVEGLSLDISVHSHLQILDEEHTKGKYHHGLSALKPFRTTTKHQHPVDNAGLFSYMTFSWLSPLAQVVHKKGELLMEDVWPLSKYESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFVVKHLLEYTQATESNLQYSLLLVLGLLLTEVVRSWSLALTWALNYRTGVRLRGAVLTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFVSRLTAYFRRKCVAATDDRVQKMNEVLTYIKFIKMYAWVKAFSQCVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSVHMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKIEMKNATLAWDSSHSSTQSSPKLTPKVKKDKRAPKGKKEKSRQLQHTEHQAVLAEQKGHLLLDSDERPSPEEEEGKQIHAGSMRLQRTLYNIDLEIEEGKLVGICGSVGSGKTSLISAILGQMTLLEGSIAVSGTFAYVAQQAWILNATLRDNILFGKEFDEERYNSVLNSCCLRPDLAILPNSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVGNHIFNSAIRKRLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATIFNNLLLGETPPVEINSKKEASGSQKSQDKGPKPGSVKKEKAVKSEEGQLVQVEEKGQGSVPWSVYWVYIQAAGGPLAFLVIMVLFMLNVGSTAFSTWWLSYWIKQGSGNSTVFEGNRSSVSDSMRDNPFLQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLLILFSVLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKRQEFLHRYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPSAYAGLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPPHDWPQEGEITFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISDIGLADLRSKLAIIPQEPVLFSGTVRSNLDPFNQYTEEQIWDALERTHMKECIAQLPLKLESEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMCAAAENKVAVKG", "length": 1436 }, "evidence": [ { "id": "45230733", "url": "http://www.informatics.jax.org/homology/45230733", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 12, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "ABC-type transporter activity", "id": "GO:0140359", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140359", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "xenobiotic transmembrane transporter activity", "id": "GO:0042910", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042910", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "ATPase-coupled transmembrane transporter activity", "id": "GO:0042626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042626", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "ABC-type xenobiotic transporter activity", "id": "GO:0008559", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008559", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "heme transmembrane transporter activity", "id": "GO:0015232", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015232", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "ATP hydrolysis activity", "id": "GO:0016887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016887", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "purine nucleotide transmembrane transporter activity", "id": "GO:0015216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015216", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "efflux transmembrane transporter activity", "id": "GO:0015562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015562", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "glutathione transmembrane transporter activity", "id": "GO:0034634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034634", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "macromolecule transmembrane transporter activity", "id": "GO:0022884", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022884", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "carbohydrate derivative transmembrane transporter activity", "id": "GO:1901505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901505", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "Golgi lumen", "id": "GO:0005796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005796", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "transmembrane transport", "id": "GO:0055085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055085", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "purine nucleotide transport", "id": "GO:0015865", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015865", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "folate transmembrane transport", "id": "GO:0098838", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098838", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "hyaluronan biosynthetic process", "id": "GO:0030213", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030213", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "glutathione transmembrane transport", "id": "GO:0034775", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034775", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "xenobiotic transport", "id": "GO:0042908", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042908", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "export across plasma membrane", "id": "GO:0140115", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140115", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "heme transmembrane transport", "id": "GO:0035351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035351", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "cGMP transport", "id": "GO:0070731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070731", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" }, { "name": "cAMP transport", "id": "GO:0070730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070730", "evidence": [ { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1043, "end_pos": 1045, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1328, "end_pos": 1330, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1416, "end_pos": 1418, "annotation": "n_glycosylation_sequon" }, { "start_pos": 494, "end_pos": 496, "annotation": "n_glycosylation_sequon" }, { "start_pos": 636, "end_pos": 638, "annotation": "n_glycosylation_sequon" }, { "start_pos": 684, "end_pos": 686, "annotation": "n_glycosylation_sequon" }, { "start_pos": 889, "end_pos": 891, "annotation": "n_glycosylation_sequon" }, { "start_pos": 896, "end_pos": 898, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "66184", "name": "", "equation": "3',5'-cyclic AMP(in) + ATP + H2O = 3',5'-cyclic AMP(out) + ADP + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "F1M3J4-1", "O15439-1", "Q96J66-1", "O15440-1", "E9Q236-1", "Q9R1X5-1" ], "evidence": [ { "id": "66184", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66184" } ] }, { "id": "66188", "name": "", "equation": "3',5'-cyclic GMP(in) + ATP + H2O = 3',5'-cyclic GMP(out) + ADP + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "F1M3J4-1", "O15439-1", "Q96J66-1", "O15440-1", "E9Q236-1", "Q9R1X5-1", "P10090-1" ], "evidence": [ { "id": "66188", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66188" } ] }, { "id": "66720", "name": "", "equation": "ATP + H2O + N-[(S)-lactoyl]-L-phenylalanine(in) = ADP + H(+) + N-[(S)-lactoyl]-L-phenylalanine(out) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66720", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66720" } ] }, { "id": "66728", "name": "", "equation": "ATP + H2O + N-acetyl-L-aspartyl-L-glutamate(in) = ADP + H(+) + N-acetyl-L-aspartyl-L-glutamate(out) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66728", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66728" } ] }, { "id": "66732", "name": "", "equation": "ATP + H2O + N-acetyl-L-aspartyl-L-glutamyl-L-glutamate(in) = ADP + H(+) + N-acetyl-L-aspartyl-L-glutamyl-L-glutamate(out) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66732", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66732" } ] }, { "id": "66736", "name": "", "equation": "ATP + beta-citrylglutamate(in) + H2O = ADP + beta-citrylglutamate(out) + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66736", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66736" } ] }, { "id": "66740", "name": "", "equation": "ATP + H2O + N-acetyl-L-glutamate(in) = ADP + H(+) + N-acetyl-L-glutamate(out) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66740", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66740" } ] }, { "id": "66744", "name": "", "equation": "ATP + H2O + N-acetyl-L-aspartate(in) = ADP + H(+) + N-acetyl-L-aspartate(out) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66744", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66744" } ] }, { "id": "66752", "name": "", "equation": "(2S)-2-[5-amino-1-(beta-D-ribosyl)imidazole-4-carboxamido]succinate(in) + ATP + H2O = (2S)-2-[5-amino-1-(beta-D-ribosyl)imidazole-4-carboxamido]succinate(out) + ADP + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66752", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66752" } ] }, { "id": "66756", "name": "", "equation": "ATP + domoate(in) + H2O = ADP + domoate(out) + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66756", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66756" } ] }, { "id": "66760", "name": "", "equation": "ATP + H2O + kainate(in) = ADP + H(+) + kainate(out) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66760", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66760" } ] }, { "id": "66764", "name": "", "equation": "ATP + folate(in) + H2O = ADP + folate(out) + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66764", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66764" } ] }, { "id": "R-MMU-1454916", "name": "The ABCC family mediates organic anion transport", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [ "R-ALL-1454930" ], "output_participant_list": [ "R-ALL-1454919" ], "enzyme_list": [ "Q9R1S7-1", "P26361-1", "Q8VI47-1", "E9Q236-1", "O35379-1", "B2RX12-1", "Q8R4P9-1", "Q9R1X5-1" ], "evidence": [ { "id": "R-MMU-1454916", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1454916" } ] }, { "id": "R-MMU-2142859", "name": "Growing HA is extruded from the cell by ABCC5", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [ "R-ALL-2142896" ], "output_participant_list": [], "enzyme_list": [ "Q9R1X5-1" ], "evidence": [ { "id": "R-MMU-2142859", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2142859" } ] }, { "id": "R-MMU-9750617", "name": "ABCC5 transports TPMP substrates from cytosol to extracellular region", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9R1X5-1" ], "evidence": [ { "id": "R-MMU-9750617", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9750617" } ] }, { "id": "R-MMU-9753284", "name": "ABCC1,4,5 transport APAP-Cys,APAP-Mer from cytosol to extracellular region", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "E9Q236-1", "O35379-1", "Q9R1X5-1" ], "evidence": [ { "id": "R-MMU-9753284", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9753284" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1454919", "participant_name": "organic anion [extracellular region]", "crossref": [ { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1454930", "participant_name": "organic anion [cytosol]", "crossref": [ { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2142896", "participant_name": "HA polymer [cytosol]", "crossref": [ { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" }, { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" }, { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" }, { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "B2RX12", "gene_name": "Abcc3", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "B2RX12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RX12" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "B2RX12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RX12" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "B2RX12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RX12" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "B2RX12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RX12" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "B2RX12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RX12" } ] } ] }, { "uniprot_ac": "E9Q236", "gene_name": "Abcc4", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] } ] }, { "uniprot_ac": "F1M3J4", "gene_name": "Abcc4", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "5.6.1.6", "activity": "ATP + H2O + closed Cl(-) channel = ADP + phosphate + open Cl(-) channel.", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "5.6.1.6", "activity": "", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] } ] }, { "uniprot_ac": "O15439", "gene_name": "ABCC4", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] } ] }, { "uniprot_ac": "O15440", "gene_name": "ABCC5", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440" } ] } ] }, { "uniprot_ac": "O35379", "gene_name": "Abcc1", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "O35379", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35379" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "O35379", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35379" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "O35379", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35379" } ] } ] }, { "uniprot_ac": "P10090", "gene_name": "w", "activity": [ { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "P10090", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10090" } ] }, { "ec_number": "7.6.2.6", "activity": "ATP + guanine(out) + H2O = ADP + guanine(in) + H(+) + phosphate.", "evidence": [ { "id": "P10090", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10090" } ] }, { "ec_number": "7.6.2.6", "activity": "", "evidence": [ { "id": "P10090", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10090" } ] } ] }, { "uniprot_ac": "P26361", "gene_name": "Cftr", "activity": [ { "ec_number": "5.6.1.6", "activity": "ATP + H2O + closed Cl(-) channel = ADP + phosphate + open Cl(-) channel.", "evidence": [ { "id": "P26361", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26361" } ] }, { "ec_number": "5.6.1.6", "activity": "", "evidence": [ { "id": "P26361", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26361" } ] } ] }, { "uniprot_ac": "Q8R4P9", "gene_name": "Abcc10", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q8R4P9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4P9" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q8R4P9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4P9" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q8R4P9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4P9" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q8R4P9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4P9" } ] } ] }, { "uniprot_ac": "Q8VI47", "gene_name": "Abcc2", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q8VI47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI47" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "Q8VI47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI47" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q8VI47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI47" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q8VI47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI47" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q8VI47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI47" } ] } ] }, { "uniprot_ac": "Q96J66", "gene_name": "ABCC11", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q96J66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J66" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q96J66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J66" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q96J66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J66" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q96J66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J66" } ] } ] }, { "uniprot_ac": "Q9QYM0", "gene_name": "Abcc5", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q9QYM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYM0" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "Q9QYM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYM0" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q9QYM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYM0" } ] } ] }, { "uniprot_ac": "Q9R1S7", "gene_name": "Abcc6", "activity": [ { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "Q9R1S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1S7" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q9R1S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1S7" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q9R1S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1S7" } ] } ] }, { "uniprot_ac": "Q9R1X5", "gene_name": "Abcc5", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }