{ "uniprot_canonical_ac": "Q9R1T5-1", "uniprot_ac": "Q9R1T5", "uniprot_id": "ACY2_RAT", "mass": { "chemical_mass": 35314.0, "monoisotopic_mass": 35314.0 }, "refseq": { "ac": "NP_077375", "name": "aspartoacylase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375" }, "gene_names": [ { "name": "Aspa", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9R1T5", "id": "Q9R1T5" }, { "name": "Aspa", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006246879", "id": "XP_006246879" } ], "protein_names": [ { "name": "Aspartoacylase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9R1T5" }, { "name": "3.5.1.15", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R1T5" }, { "name": "ACY-2; aminoacylase-2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375", "id": "NP_077375" }, { "name": "ACY-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R1T5" }, { "name": "Aminoacylase-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R1T5" }, { "name": "aspartoacylase isoform X3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006246880", "id": "XP_006246880" }, { "name": "aspartoacylase isoform X4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006246879", "id": "XP_006246879" }, { "name": "aspartoacylase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375", "id": "NP_077375" } ], "function": [ { "annotation": "ASPA colocalized throughout the brain with CC1, a marker for oligodendrocytes, with 92-98% of CC1-positive cells also reactive with the ASPA antibody.", "evidence": [ { "database": "RefSeq", "id": "NP_077375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375" }, { "database": "PubMed", "id": "15065127", "url": "https://glygen.org/publication/PubMed/15065127" } ] }, { "annotation": "Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5#function" } ] }, { "annotation": "Interaction of N-acetyl-L-aspartate accumulation due to ASPA deficiency with an unstable neuronal membrane potential caused by HCN1 deficiency was involved in tremor development.", "evidence": [ { "database": "RefSeq", "id": "NP_077375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375" }, { "database": "PubMed", "id": "27026062", "url": "https://glygen.org/publication/PubMed/27026062" } ] }, { "annotation": "The N-terminal domain of aspartoacylase adopts a protein fold similar to that of zinc-dependent hydrolases related to carboxypeptidases A", "evidence": [ { "database": "RefSeq", "id": "NP_077375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375" }, { "database": "PubMed", "id": "17194761", "url": "https://glygen.org/publication/PubMed/17194761" } ] }, { "annotation": "The decrease in N-acetylaspartate following severe traumatic brain injury was characterized by profound mitochondrial malfunctioning, dramatic repression of Nat8l gene and concomitant increase in the ASPA gene and protein levels. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_077375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375" }, { "database": "PubMed", "id": "24515258", "url": "https://glygen.org/publication/PubMed/24515258" } ] }, { "annotation": "The develomental increase of this enzyme in oligodendrocytes parallels CNS myelination.", "evidence": [ { "database": "RefSeq", "id": "NP_077375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375" }, { "database": "PubMed", "id": "12524181", "url": "https://glygen.org/publication/PubMed/12524181" } ] }, { "annotation": "This study demonistrated that aspartoacylase expression in the rat white matter central nervous system.", "evidence": [ { "database": "RefSeq", "id": "NP_077375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375" }, { "database": "PubMed", "id": "21598311", "url": "https://glygen.org/publication/PubMed/21598311" } ] } ], "disease": [ { "disease_id": "DOID:3613", "recommended_name": { "id": "DOID:3613", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3613", "name": "Canavan disease", "description": "" }, "synonyms": [ { "id": "DOID:3613", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3613", "name": "CANAVAN-VAN BOGAERT-BERTRAND DISEASE", "description": "" }, { "id": "DOID:3613", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3613", "name": "Spongy degeneration of central nervous system", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "Canavan disease", "description": "A neurodegenerative disorder; its spectrum varies between severe forms with leukodystrophy, macrocephaly and severe developmental delay, and a very rare mild/juvenile form characterized by mild developmental delay." }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "ACY2 deficiency", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "Canavan disease", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "Canavan-VAN Bogaert-Bertrand disease", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "aminoacylase 2 deficiency", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "aspartoacylase deficiency", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "spongy degeneration of central nervous system", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "spongy degeneration of the brain", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "Acy2 deficiency", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "Asp deficiency", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "Aspa deficiency", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "Canavan-Van Bogaert-Bertrand disease", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "Von Bogaert-Bertrand disease", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "spongy Degeneration of central nervous system", "description": "" }, { "id": "MONDO:0010079", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010079", "name": "spongy degeneration of the central nervous system", "description": "" }, { "id": "MIM:271900", "resource": "MIM", "url": "https://www.omim.org/entry/271900", "name": "Canavan disease", "description": "Canavan disease" } ], "evidence": [ { "id": "3613", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3613" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ], "common_name": "Rat" } ], "gene": [ { "name": "Aspa", "url": "https://www.uniprot.org/uniprot/Q9R1T5", "locus": { "chromosome": "10", "start_pos": 57892104, "end_pos": 57945272, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000019659", "url": "https://www.ensembl.org/id/ENSRNOG00000019659" } ] } } ], "crossref": [ { "id": "ENSRNOG00000019659", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000019659", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.5.1.15", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.5.1.15&UniProtAcc=Q9R1T5", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd06909", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06909", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "79251", "url": "https://www.ncbi.nlm.nih.gov/gene/79251", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007036", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007036", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016708", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016708", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:79251", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:79251", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "THGNEIN", "url": "https://omabrowser.org/oma/group/THGNEIN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1003028at2759", "url": "http://www.orthodb.org/?query=1003028at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15162", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15162", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15162:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15162:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2GU2", "url": "https://www.rcsb.org/structure/2GU2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Q4Z", "url": "https://www.rcsb.org/structure/2Q4Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF04952", "url": "http://pfam.xfam.org/family/PF04952", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9R1T5", "url": "http://purl.obolibrary.org/obo/PR_Q9R1T5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-8963693", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8963693", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_077375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "621693", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=621693", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "10872", "url": "https://www.rhea-db.org/rhea/10872", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0H2UHY8", "url": "https://www.uniprot.org/uniprot/A0A0H2UHY8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0H2UHY8-1", "url": "https://www.uniprot.org/uniprot/A0A0H2UHY8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2Q5Z4", "url": "https://www.uniprot.org/uniprot/A0A1W2Q5Z4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2Q5Z4-1", "url": "https://www.uniprot.org/uniprot/A0A1W2Q5Z4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2Q6K0", "url": "https://www.uniprot.org/uniprot/A0A1W2Q6K0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2Q6K0-1", "url": "https://www.uniprot.org/uniprot/A0A1W2Q6K0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ATJ0", "url": "https://www.uniprot.org/uniprot/A0A8I6ATJ0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ATJ0-1", "url": "https://www.uniprot.org/uniprot/A0A8I6ATJ0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2RC31", "url": "https://www.uniprot.org/uniprot/A0A8L2RC31", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2RC31-1", "url": "https://www.uniprot.org/uniprot/A0A8L2RC31-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9R1T5-1", "url": "https://www.uniprot.org/uniprot/Q9R1T5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTSCVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRSTLH", "length": 312, "header": "sp|Q9R1T5-1|ACY2_RAT Isoform 1 of Aspartoacylase OS=Rattus norvegicus OX=10116 GN=Aspa PE=1 SV=2 CANONICAL=Q9R1T5-1" }, "isoforms": [ { "isoform_ac": "A0A0H2UHY8-1", "url": "", "sequence": { "sequence": "MTSCVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGSHYIAQVDLNSQRSCLSFLKVGITKAQHSQFLDAF", "length": 246, "header": "tr|A0A0H2UHY8-1|ACY2_RAT Computationally mapped isoform of Aspartoacylase OS=Rattus norvegicus OX=10116 GN=Aspa PE=1 SV=2 CANONICAL=Q9R1T5-1" }, "locus": { "chromosome": "10", "start_pos": 57940374, "end_pos": 57928088, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000049311.5", "url": "https://www.ensembl.org/id/ENSRNOT00000049311.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000050760.5", "url": "https://www.ensembl.org/id/ENSRNOP00000050760.5" } ] } }, { "isoform_ac": "A0A1W2Q5Z4-1", "url": "", "sequence": { "sequence": "MTSCVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQEEVTRVRDGPSRTER", "length": 262, "header": "tr|A0A1W2Q5Z4-1|ACY2_RAT Computationally mapped isoform of Aspartoacylase OS=Rattus norvegicus OX=10116 GN=Aspa PE=1 SV=2 CANONICAL=Q9R1T5-1" }, "locus": { "chromosome": "10", "start_pos": 57940374, "end_pos": 57892202, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000093579.2", "url": "https://www.ensembl.org/id/ENSRNOT00000093579.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000076074.2", "url": "https://www.ensembl.org/id/ENSRNOP00000076074.2" } ] } }, { "isoform_ac": "A0A1W2Q6K0-1", "url": "", "sequence": { "sequence": "MTSCVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDAHTPSLLSKATAVM", "length": 262, "header": "tr|A0A1W2Q6K0-1|A0A1W2Q6K0_RAT Computationally mapped isoform of Aspartoacylase OS=Rattus norvegicus OX=10116 GN=Aspa PE=1 SV=1 CANONICAL=Q9R1T5-1" }, "locus": { "chromosome": "10", "start_pos": 57940374, "end_pos": 57919641, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000093482.2", "url": "https://www.ensembl.org/id/ENSRNOT00000093482.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000076282.1", "url": "https://www.ensembl.org/id/ENSRNOP00000076282.1" } ] } }, { "isoform_ac": "A0A8I6ATJ0-1", "url": "", "sequence": { "sequence": "MTSCVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQVTFVSLKYCK", "length": 257, "header": "tr|A0A8I6ATJ0-1|ACY2_RAT Computationally mapped isoform of Aspartoacylase OS=Rattus norvegicus OX=10116 GN=Aspa PE=1 SV=1 CANONICAL=Q9R1T5-1" }, "locus": { "chromosome": "10", "start_pos": 57940374, "end_pos": 57923640, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000095739.1", "url": "https://www.ensembl.org/id/ENSRNOT00000095739.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000097883.1", "url": "https://www.ensembl.org/id/ENSRNOP00000097883.1" } ] } }, { "isoform_ac": "A0A8L2RC31-1", "url": "", "sequence": { "sequence": "MTSCVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQVTFVSLKGTSVSLM", "length": 261, "header": "tr|A0A8L2RC31-1|A0A8L2RC31_RAT Computationally mapped isoform of Aspartoacylase OS=Rattus norvegicus OX=10116 GN=Aspa PE=1 SV=1 CANONICAL=Q9R1T5-1" }, "locus": { "chromosome": "10", "start_pos": 57940374, "end_pos": 57923209, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000093230.2", "url": "https://www.ensembl.org/id/ENSRNOT00000093230.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000076091.2", "url": "https://www.ensembl.org/id/ENSRNOP00000076091.2" } ] } }, { "isoform_ac": "Q9R1T5-1", "url": "", "sequence": { "sequence": "MTSCVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRSTLH", "length": 312, "header": "sp|Q9R1T5-1|ACY2_RAT Isoform 1 of Aspartoacylase OS=Rattus norvegicus OX=10116 GN=Aspa PE=1 SV=2 CANONICAL=Q9R1T5-1" }, "locus": { "chromosome": "10", "start_pos": 57940374, "end_pos": 57920554, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000084432", "url": "https://www.ensembl.org/id/ENSRNOT00000084432" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000072876", "url": "https://www.ensembl.org/id/ENSRNOP00000072876" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Developmental increase of aspartoacylase in oligodendrocytes parallels CNS myelination.", "journal": "Brain research. Developmental brain research", "date": "2003", "authors": "Kirmani BF, Jacobowitz DM, Namboodiri MA", "evidence": [ { "database": "RefSeq", "id": "NP_077375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375" } ], "reference": [ { "type": "PubMed", "id": "12524181", "url": "https://glygen.org/publication/PubMed/12524181" } ] }, { "title": "Immunohistochemical localization of aspartoacylase in the rat central nervous system.", "journal": "The Journal of comparative neurology", "date": "2004", "authors": "Madhavarao CN, Moffett JR, Moore RA, Viola RE, Namboodiri MA, Jacobowitz DM", "evidence": [ { "database": "RefSeq", "id": "NP_077375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375" } ], "reference": [ { "type": "PubMed", "id": "15065127", "url": "https://glygen.org/publication/PubMed/15065127" } ] }, { "title": "Aspartoacylase is a regulated nuclear-cytoplasmic enzyme.", "journal": "FASEB J.", "date": "2006", "authors": "Garbern J.Y., Madhavarao C.N., Moffett J.R., Benjamins J.A., Hershfield J.R., Namboodiri A.", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ], "reference": [ { "type": "PubMed", "id": "16935940", "url": "https://glygen.org/publication/PubMed/16935940" } ] }, { "title": "Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2007", "authors": "Bitto E, Bingman CA, Wesenberg GE, McCoy JG, Phillips GN Jr", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" }, { "database": "RefSeq", "id": "NP_077375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375" } ], "reference": [ { "type": "PubMed", "id": "17194761", "url": "https://glygen.org/publication/PubMed/17194761" } ] }, { "title": "Extensive aspartoacylase expression in the rat central nervous system.", "journal": "Glia", "date": "2011", "authors": "Moffett JR, Arun P, Ariyannur PS, Garbern JY, Jacobowitz DM, Namboodiri AM", "evidence": [ { "database": "RefSeq", "id": "NP_077375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375" } ], "reference": [ { "type": "PubMed", "id": "21598311", "url": "https://glygen.org/publication/PubMed/21598311" } ] }, { "title": "The molecular mechanisms affecting N-acetylaspartate homeostasis following experimental graded traumatic brain injury.", "journal": "Molecular medicine (Cambridge, Mass.)", "date": "2014", "authors": "Di Pietro V, Amorini AM, Tavazzi B, Vagnozzi R, Logan A, Lazzarino G, Signoretti S, Lazzarino G, Belli A", "evidence": [ { "database": "RefSeq", "id": "NP_077375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375" } ], "reference": [ { "type": "PubMed", "id": "24515258", "url": "https://glygen.org/publication/PubMed/24515258" } ] }, { "title": "Involvement of aspartoacylase in tremor expression in rats.", "journal": "Experimental animals", "date": "2016", "authors": "Nishitani A, Tanaka M, Shimizu S, Kunisawa N, Yokoe M, Yoshida Y, Suzuki T, Sakuma T, Yamamoto T, Kuwamura M, Takenaka S, Ohno Y, Kuramoto T", "evidence": [ { "database": "RefSeq", "id": "NP_077375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077375" } ], "reference": [ { "type": "PubMed", "id": "27026062", "url": "https://glygen.org/publication/PubMed/27026062" } ] } ], "pathway": [ { "id": "rno:79251", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:79251", "resource": "KEGG Pathway" }, { "id": "R-RNO-8963693", "name": "Aspartate and asparagine metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8963693", "resource": "Reactome", "description": "Aspartate and asparagine metabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "P45381-1", "protein_name": "Aspartoacylase", "gene_name": "ASPA", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH", "length": 313 }, "evidence": [ { "id": "45234626", "url": "http://www.informatics.jax.org/homology/45234626", "database": "MGI" }, { "id": "Q9R1T5", "url": "https://omabrowser.org/oma/group/Q9R1T5/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8R3P0-1", "protein_name": "Aspartoacylase", "gene_name": "Aspa", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTSCVAKEPIKKIAIFGGTHGNELTGVFLVTHWLRNGTEVHRAGLDVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDLVFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRKMIKHALDFIQHFNEGKEFPPCSIDVYKIMEKVDYPRNESGDMAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLSAKSIRSTLH", "length": 312 }, "evidence": [ { "id": "45234626", "url": "http://www.informatics.jax.org/homology/45234626", "database": "MGI" }, { "id": "Q9R1T5", "url": "https://omabrowser.org/oma/group/Q9R1T5/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "hydrolase activity, acting on ester bonds", "id": "GO:0016788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016788", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ], "pmid": "" }, { "name": "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides", "id": "GO:0016811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016811", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ], "pmid": "" }, { "name": "aspartoacylase activity", "id": "GO:0019807", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019807", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "acetate metabolic process", "id": "GO:0006083", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006083", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ], "pmid": "" }, { "name": "central nervous system myelination", "id": "GO:0022010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022010", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ], "pmid": "" }, { "name": "positive regulation of oligodendrocyte differentiation", "id": "GO:0048714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048714", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ], "pmid": "" }, { "name": "aspartate metabolic process", "id": "GO:0006531", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006531", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9R1T5", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 116, "end_pos": 118, "annotation": "n_glycosylation_sequon" }, { "start_pos": 233, "end_pos": 235, "annotation": "n_glycosylation_sequon" }, { "start_pos": 76, "end_pos": 78, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "10872", "name": "", "equation": "H2O + N-acyl-L-aspartate = a carboxylate + L-aspartate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9R1T5-1", "P45381-1", "Q8R3P0-1" ], "evidence": [ { "id": "10872", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10872" } ] }, { "id": "R-RNO-5691507", "name": "ASPA deacetylates NAA to acetate and L-aspartate", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-5691492" ], "output_participant_list": [], "enzyme_list": [ "Q9R1T5-1" ], "evidence": [ { "id": "R-RNO-5691507", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5691507" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-5691492", "participant_name": "NAA [cytosol]", "crossref": [ { "id": "21547", "database": "ChEBI", "url": "" }, { "id": "C01042", "database": "COMPOUND", "url": "" }, { "id": "000002446417", "database": "ZINC", "url": "" }, { "id": "HMDB0000812", "database": "HMDB Metabolite", "url": "" }, { "id": "21547", "database": "ChEBI", "url": "" }, { "id": "C01042", "database": "COMPOUND", "url": "" }, { "id": "000002446417", "database": "ZINC", "url": "" }, { "id": "HMDB0000812", "database": "HMDB Metabolite", "url": "" }, { "id": "C01042", "database": "COMPOUND", "url": "" }, { "id": "21547", "database": "ChEBI", "url": "" }, { "id": "000002446417", "database": "ZINC", "url": "" }, { "id": "HMDB0000812", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P45381", "gene_name": "ASPA", "activity": [ { "ec_number": "3.5.1.15", "activity": "H2O + N-acyl-L-aspartate = a carboxylate + L-aspartate.", "evidence": [ { "id": "P45381", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45381" } ] }, { "ec_number": "3.5.1.15", "activity": "", "evidence": [ { "id": "P45381", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45381" } ] } ] }, { "uniprot_ac": "Q8R3P0", "gene_name": "Aspa", "activity": [ { "ec_number": "3.5.1.15", "activity": "H2O + N-acyl-L-aspartate = a carboxylate + L-aspartate.", "evidence": [ { "id": "Q8R3P0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3P0" } ] }, { "ec_number": "3.5.1.15", "activity": "", "evidence": [ { "id": "Q8R3P0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3P0" } ] } ] }, { "uniprot_ac": "Q9R1T5", "gene_name": "Aspa", "activity": [ { "ec_number": "3.5.1.15", "activity": "H2O + N-acyl-L-aspartate = a carboxylate + L-aspartate.", "evidence": [ { "id": "Q9R1T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ] }, { "ec_number": "3.5.1.15", "activity": "", "evidence": [ { "id": "Q9R1T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1T5" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }